F452382

General Info

Members Datasets Scaffolds Average Seq Length
481 276 962 171

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100002952|Ga0075430_1000029524
Length 192
Sequence MPARRGSGRVDGMTHNHDGTVDPACAMAHGDLPPEVGPRTLVAVFASPVAGYLLRFGLDLGYRTVLVEPDPVRLAGPPRPRSDQVVTAADKSIVDGNTDVVVTDHDRPELGSVLRAVLGLPARWVGVMGSPRHTAPHVAALRDLGVGEPDITRVHRPVGLNIGSRTPAEIAVATLAGLIADRNARPGGFDFG

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
273 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
274 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
275 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
276 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0.83
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 3.74
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100002952 3300006846 Bacteria 14232
2 JGI25406J46586_10003229 3300003203 Bacteria 7668
3 Ga0070658_10024564 3300005327 Bacteria 4833
4 Ga0070658_10031638 3300005327 Bacteria 4250
5 Ga0070658_10653379 3300005327 Bacteria 912
6 Ga0070683_100021534 3300005329 Bacteria 5754
7 Ga0070683_100030864 3300005329 Bacteria 4869
8 Ga0070683_100081037 3300005329 Bacteria 3038
9 Ga0070670_100053002 3300005331 Bacteria 3484
10 Ga0070670_100487496 3300005331 Bacteria 1095
11 Ga0068869_100011216 3300005334 Bacteria 5871
12 Ga0070666_10033702 3300005335 Bacteria 3390
13 Ga0070680_100096397 3300005336 Bacteria 2452
14 Ga0070682_101137352 3300005337 Bacteria 655
15 Ga0068868_100012048 3300005338 Bacteria 6314
16 Ga0068868_100265335 3300005338 Bacteria 1449
17 Ga0070689_100026991 3300005340 Bacteria 4327
18 Ga0070691_10020126 3300005341 Bacteria 3081
19 Ga0070691_10114338 3300005341 Bacteria 1353
20 Ga0070687_100049404 3300005343 Bacteria 2167
21 Ga0070661_100038665 3300005344 Bacteria 3474
22 Ga0070668_100058406 3300005347 Bacteria 2984
23 Ga0070668_100132063 3300005347 Bacteria 2005
24 Ga0070668_101295065 3300005347 Bacteria 662
25 Ga0070669_100085641 3300005353 Bacteria 2353
26 Ga0070675_100000709 3300005354 Bacteria 23182
27 Ga0070675_100115457 3300005354 Bacteria 2276
28 Ga0070673_100077329 3300005364 Bacteria 2689
29 Ga0070673_100528150 3300005364 Bacteria 1070
30 Ga0070688_100387135 3300005365 Bacteria 1032
31 Ga0070659_100228566 3300005366 Bacteria 1537
32 Ga0070659_101173127 3300005366 Bacteria 678
33 Ga0070709_10154233 3300005434 Bacteria 1590
34 Ga0070709_10379268 3300005434 Bacteria 1051
35 Ga0070714_100008219 3300005435 Bacteria 8133
36 Ga0070714_100869983 3300005435 Bacteria 874
37 Ga0070714_101039266 3300005435 Bacteria 798
38 Ga0070710_10000652 3300005437 Bacteria 16517
39 Ga0070701_10108943 3300005438 Bacteria 1545
40 Ga0070711_100191368 3300005439 Bacteria 1573
41 Ga0070711_100375806 3300005439 Bacteria 1148
42 Ga0070705_100638261 3300005440 Bacteria 829
43 Ga0070705_100868353 3300005440 Bacteria 723
44 Ga0070700_100351000 3300005441 Bacteria 1094
45 Ga0070708_100010115 3300005445 Bacteria 7633
46 Ga0070708_100123895 3300005445 Bacteria 2387
47 Ga0070663_100123450 3300005455 Bacteria 1959
48 Ga0070663_100291620 3300005455 Bacteria 1303
49 Ga0070678_100032204 3300005456 Bacteria 3626
50 Ga0070662_100098419 3300005457 Bacteria 2209
51 Ga0070662_100137710 3300005457 Bacteria 1889
52 Ga0070681_10025681 3300005458 Bacteria 5925
53 Ga0070681_10166426 3300005458 Bacteria 2127
54 Ga0068867_100395543 3300005459 Bacteria 1164
55 Ga0068867_100842990 3300005459 Bacteria 821
56 Ga0070685_10059428 3300005466 Bacteria 2232
57 Ga0070706_100012874 3300005467 Bacteria 7743
58 Ga0070706_100017847 3300005467 Bacteria 6547
59 Ga0070706_100031012 3300005467 Bacteria 4929
60 Ga0070707_100049375 3300005468 Bacteria 4033
61 Ga0070707_100157954 3300005468 Bacteria 2209
62 Ga0070698_100053913 3300005471 Bacteria 4085
63 Ga0070698_100067375 3300005471 Bacteria 3600
64 Ga0070698_100332511 3300005471 Bacteria 1450
65 Ga0070698_100553230 3300005471 Bacteria 1090
66 Ga0070699_100000709 3300005518 Bacteria 30905
67 Ga0070684_100018174 3300005535 Bacteria 5786
68 Ga0070684_100040644 3300005535 Bacteria 4006
69 Ga0070697_100002722 3300005536 Bacteria 13622
70 Ga0068853_100130358 3300005539 Bacteria 2250
71 Ga0070696_100411896 3300005546 Bacteria 1059
72 Ga0070693_100046960 3300005547 Bacteria 2454
73 Ga0070665_100073526 3300005548 Bacteria 3424
74 Ga0070664_100003527 3300005564 Bacteria 12632
75 Ga0068857_100018633 3300005577 Bacteria 6092
76 Ga0068857_100066274 3300005577 Bacteria 3212
77 Ga0068857_100111172 3300005577 Bacteria 2463
78 Ga0068857_101199668 3300005577 Unclassified 735
79 Ga0068854_100274204 3300005578 Bacteria 1355
80 Ga0068856_100016540 3300005614 Bacteria 7140
81 Ga0068856_100279902 3300005614 Bacteria 1685
82 Ga0070702_100362633 3300005615 Bacteria 1024
83 Ga0068852_100094515 3300005616 Bacteria 2682
84 Ga0068852_101801856 3300005616 Bacteria 634
85 Ga0068859_101361299 3300005617 Bacteria 783
86 Ga0068864_100082798 3300005618 Bacteria 2816
87 Ga0068864_100130334 3300005618 Bacteria 2258
88 Ga0068864_100215537 3300005618 Bacteria 1770
89 Ga0068861_100007492 3300005719 Bacteria 7483
90 Ga0068861_100134733 3300005719 Bacteria 2009
91 Ga0068851_10029269 3300005834 Bacteria 2726
92 Ga0068870_10073204 3300005840 Bacteria 1874
93 Ga0068863_100089467 3300005841 Bacteria 2919
94 Ga0068863_100195625 3300005841 Bacteria 1944
95 Ga0068860_101897886 3300005843 Bacteria 617
96 Ga0068862_100018951 3300005844 Bacteria 5735
97 Ga0068862_100154107 3300005844 Bacteria 2047
98 Ga0081539_10000812 3300005985 Bacteria 60683
99 Ga0070717_10036969 3300006028 Bacteria 3963
100 Ga0070717_10853733 3300006028 Bacteria 828
101 Ga0070716_100001905 3300006173 Bacteria 9470
102 Ga0070716_100005932 3300006173 Bacteria 5945
103 Ga0070712_100067013 3300006175 Bacteria 2554
104 Ga0070712_100138448 3300006175 Bacteria 1854
105 Ga0068871_100046384 3300006358 Bacteria 3500
106 Ga0075428_100059580 3300006844 Bacteria 4180
107 Ga0075428_100239237 3300006844 Bacteria 1959
108 Ga0075428_100390058 3300006844 Bacteria 1493
109 Ga0075428_100731926 3300006844 Bacteria 1053
110 Ga0075430_100140251 3300006846 Bacteria 2013
111 Ga0075430_100551252 3300006846 Bacteria 951
112 Ga0075431_100016438 3300006847 Bacteria 7510
113 Ga0075433_10426298 3300006852 Bacteria 1170
114 Ga0075429_100021782 3300006880 Bacteria 5557
115 Ga0075429_100153934 3300006880 Bacteria 2013
116 Ga0075429_100192856 3300006880 Bacteria 1785
117 Ga0068865_100081947 3300006881 Bacteria 2318
118 Ga0097620_101361251 3300006931 Bacteria 783
119 Ga0075435_100320513 3300007076 Bacteria 1327
120 Ga0105240_10035507 3300009093 Bacteria 6423
121 Ga0111539_10010605 3300009094 Bacteria 11604
122 Ga0105245_10042976 3300009098 Bacteria 4032
123 Ga0114129_10000031 3300009147 Bacteria 111827
124 Ga0114129_10001179 3300009147 Bacteria 34670
125 Ga0114129_10021677 3300009147 Bacteria 9118
126 Ga0114129_10021772 3300009147 Bacteria 9098
127 Ga0114129_10275023 3300009147 Bacteria 2252
128 Ga0114129_11656295 3300009147 Bacteria 782
129 Ga0105242_10259722 3300009176 Bacteria 1569
130 Ga0105248_10949398 3300009177 Bacteria 971
131 Ga0105249_10347498 3300009553 Bacteria 1502
132 Ga0105239_10045662 3300010375 Bacteria 4802
133 Ga0105239_10519902 3300010375 Unclassified 1354
134 Ga0105239_11147600 3300010375 Bacteria 895
135 Ga0157370_10046570 3300013104 Bacteria 4158
136 Ga0163162_10060440 3300013306 Bacteria 3825
137 Ga0163162_10323193 3300013306 Bacteria 1675
138 Ga0163162_10593809 3300013306 Bacteria 1234
139 Ga0163163_10145945 3300014325 Bacteria 2410
140 Ga0163163_10352506 3300014325 Bacteria 1528
141 Ga0163163_10699349 3300014325 Bacteria 1077
142 Ga0157377_10030877 3300014745 Bacteria 2906
143 Ga0157376_10632235 3300014969 Bacteria 1069
144 Ga0163161_10117701 3300017792 Bacteria 1993
145 Ga0206356_10955857 3300020070 Bacteria 2383
146 Ga0206354_10700772 3300020081 Bacteria 1490
147 Ga0206354_10834889 3300020081 Bacteria 1220
148 Ga0206353_10800801 3300020082 Bacteria 5951
149 Ga0213875_10060912 3300021388 Bacteria 1765
150 Ga0213875_10098879 3300021388 Bacteria 1362
151 Ga0207653_10006752 3300025885 Bacteria 3586
152 Ga0207692_10000106 3300025898 Bacteria 24772
153 Ga0207692_10089824 3300025898 Bacteria 1663
154 Ga0207692_10189377 3300025898 Bacteria 1203
155 Ga0207642_10012591 3300025899 Bacteria 3059
156 Ga0207688_10017786 3300025901 Bacteria 3868
157 Ga0207680_10039701 3300025903 Bacteria 2733
158 Ga0207685_10021524 3300025905 Bacteria 2163
159 Ga0207685_10035460 3300025905 Bacteria 1821
160 Ga0207685_10188920 3300025905 Bacteria 960
161 Ga0207699_10000670 3300025906 Bacteria 16413
162 Ga0207699_10007182 3300025906 Bacteria 5437
163 Ga0207699_10012444 3300025906 Bacteria 4329
164 Ga0207699_10095204 3300025906 Bacteria 1877
165 Ga0207645_10045880 3300025907 Bacteria 2792
166 Ga0207643_10024629 3300025908 Bacteria 3321
167 Ga0207705_10923009 3300025909 Bacteria 676
168 Ga0207684_10013865 3300025910 Bacteria 6960
169 Ga0207684_10109596 3300025910 Bacteria 2363
170 Ga0207684_10270875 3300025910 Bacteria 1465
171 Ga0207684_10308394 3300025910 Bacteria 1364
172 Ga0207654_10274320 3300025911 Bacteria 1139
173 Ga0207707_10005453 3300025912 Bacteria 11118
174 Ga0207707_11070629 3300025912 Bacteria 658
175 Ga0207693_10028485 3300025915 Bacteria 4413
176 Ga0207693_10041761 3300025915 Bacteria 3610
177 Ga0207693_10126409 3300025915 Bacteria 2009
178 Ga0207663_10005069 3300025916 Bacteria 6614
179 Ga0207663_10007836 3300025916 Bacteria 5563
180 Ga0207663_10413206 3300025916 Bacteria 1034
181 Ga0207660_10113246 3300025917 Bacteria 2045
182 Ga0207660_10188166 3300025917 Bacteria 1606
183 Ga0207662_10012669 3300025918 Bacteria 4699
184 Ga0207657_10007929 3300025919 Bacteria 10828
185 Ga0207657_10242694 3300025919 Bacteria 1438
186 Ga0207652_10017496 3300025921 Bacteria 5866
187 Ga0207646_10008588 3300025922 Bacteria 10209
188 Ga0207646_10049185 3300025922 Bacteria 3777
189 Ga0207646_10105495 3300025922 Bacteria 2527
190 Ga0207646_10888568 3300025922 Bacteria 791
191 Ga0207681_10746452 3300025923 Bacteria 816
192 Ga0207694_10233836 3300025924 Bacteria 1501
193 Ga0207650_10887051 3300025925 Bacteria 757
194 Ga0207659_10005955 3300025926 Bacteria 7441
195 Ga0207659_10114014 3300025926 Bacteria 2059
196 Ga0207687_10294610 3300025927 Bacteria 1305
197 Ga0207700_10000126 3300025928 Bacteria 45263
198 Ga0207700_10018060 3300025928 Bacteria 4728
199 Ga0207700_10048057 3300025928 Bacteria 3166
200 Ga0207700_10371244 3300025928 Bacteria 1249
201 Ga0207700_10900592 3300025928 Bacteria 792
202 Ga0207664_10000148 3300025929 Bacteria 57411
203 Ga0207664_10014200 3300025929 Bacteria 5744
204 Ga0207664_10046088 3300025929 Bacteria 3421
205 Ga0207664_10059608 3300025929 Bacteria 3040
206 Ga0207664_10216095 3300025929 Unclassified 1661
207 Ga0207644_10346553 3300025931 Bacteria 1205
208 Ga0207690_10229867 3300025932 Bacteria 1423
209 Ga0207690_10378397 3300025932 Bacteria 1125
210 Ga0207706_10073139 3300025933 Bacteria 3014
211 Ga0207706_10105369 3300025933 Bacteria 2481
212 Ga0207686_10088432 3300025934 Bacteria 2039
213 Ga0207670_10328438 3300025936 Bacteria 1205
214 Ga0207704_10430738 3300025938 Bacteria 1048
215 Ga0207665_10002850 3300025939 Bacteria 11611
216 Ga0207665_10004752 3300025939 Bacteria 9030
217 Ga0207665_10007233 3300025939 Bacteria 7344
218 Ga0207665_10010756 3300025939 Bacteria 6009
219 Ga0207691_10029764 3300025940 Bacteria 5107
220 Ga0207691_10128850 3300025940 Bacteria 2237
221 Ga0207711_10874076 3300025941 Bacteria 836
222 Ga0207689_10018649 3300025942 Bacteria 5853
223 Ga0207689_10040067 3300025942 Bacteria 3878
224 Ga0207661_10024104 3300025944 Bacteria 4606
225 Ga0207661_10042638 3300025944 Bacteria 3578
226 Ga0207661_10212414 3300025944 Bacteria 1706
227 Ga0207679_10168371 3300025945 Bacteria 1801
228 Ga0207667_10154722 3300025949 Bacteria 2359
229 Ga0207651_10224174 3300025960 Bacteria 1522
230 Ga0207712_10364550 3300025961 Bacteria 1205
231 Ga0207668_10046807 3300025972 Bacteria 2958
232 Ga0207668_10094040 3300025972 Bacteria 2210
233 Ga0207668_10153522 3300025972 Bacteria 1786
234 Ga0207640_10123691 3300025981 Bacteria 1858
235 Ga0207658_10011041 3300025986 Bacteria 6149
236 Ga0207677_10007853 3300026023 Bacteria 5929
237 Ga0207678_10016152 3300026067 Bacteria 6555
238 Ga0207678_10287108 3300026067 Bacteria 1413
239 Ga0207678_10969611 3300026067 Bacteria 752
240 Ga0207708_10003367 3300026075 Bacteria 11792
241 Ga0207708_10051611 3300026075 Bacteria 3132
242 Ga0207702_10087669 3300026078 Bacteria 2718
243 Ga0207702_10160539 3300026078 Bacteria 2052
244 Ga0207702_10418604 3300026078 Bacteria 1295
245 Ga0207641_10054080 3300026088 Bacteria 3405
246 Ga0207648_10016530 3300026089 Bacteria 6738
247 Ga0207648_10376352 3300026089 Bacteria 1283
248 Ga0207676_10123249 3300026095 Bacteria 2189
249 Ga0207674_10007368 3300026116 Bacteria 12815
250 Ga0207674_10030530 3300026116 Bacteria 5665
251 Ga0207674_10059196 3300026116 Bacteria 3877
252 Ga0207675_100005498 3300026118 Bacteria 12128
253 Ga0207675_100012094 3300026118 Bacteria 8064
254 Ga0207683_10001444 3300026121 Bacteria 21487
255 Ga0207683_11472018 3300026121 Bacteria 629
256 Ga0207698_10083792 3300026142 Bacteria 2582
257 Ga0207428_10017037 3300027907 Bacteria 6241
258 Ga0268266_10030750 3300028379 Bacteria 4561
259 Ga0268265_10020022 3300028380 Bacteria 4663
260 Ga0268265_10050335 3300028380 Bacteria 3139
261 Ga0268264_11010532 3300028381 Bacteria 838
262 Ga0307515_10052562 3300028794 Bacteria 6038
263 Ga0265338_10001573 3300028800 Bacteria 36794
264 Ga0307513_10045865 3300031456 Bacteria 4773
265 Ga0307405_10504338 3300031731 Bacteria 970
266 Ga0307413_10070140 3300031824 Bacteria 2202
267 Ga0307410_10140247 3300031852 Bacteria 1787
268 Ga0307406_10027536 3300031901 Bacteria 3426
269 Ga0307406_10221359 3300031901 Bacteria 1407
270 Ga0307406_10270574 3300031901 Bacteria 1290
271 Ga0307406_10919003 3300031901 Bacteria 746
272 Ga0307406_11609145 3300031901 Bacteria 574
273 Ga0307407_10017061 3300031903 Bacteria 3632
274 Ga0307412_10184707 3300031911 Bacteria 1571
275 Ga0307409_100166182 3300031995 Bacteria 1936
276 Ga0307416_102345756 3300032002 Bacteria 634
277 Ga0307414_10102934 3300032004 Bacteria 2153
278 Ga0307411_10227840 3300032005 Bacteria 1450
279 Ga0307415_100010742 3300032126 Bacteria 5202
280 Ga0307415_100111130 3300032126 Bacteria 2033
281 Ga0307415_100715511 3300032126 Bacteria 905
282 Ga0373926_0003380 3300035083 Bacteria 5140
283 Ga0373934_0045105 3300035086 Bacteria 1743
284 Ga0373940_0003011 3300035088 Bacteria 3375
285 Ga0373944_0002496 3300035089 Bacteria 4676
286 Ga0373951_0050116 3300035091 Bacteria 1026
287 Ga0373936_0000470 3300035113 Bacteria 13574
288 Ga0373936_0065649 3300035113 Bacteria 1489
289 Ga0373945_0002916 3300035116 Bacteria 5375
290 Ga0373953_0001216 3300035117 Bacteria 7336
291 Ga0373954_0004421 3300035118 Bacteria 6048
292 Ga0373957_0011715 3300035120 Bacteria 2934
293 Ga0373943_0001611 3300035170 Bacteria 10234
294 Ga0373946_0000157 3300035171 Bacteria 20583
295 Ga0373946_0041656 3300035171 Bacteria 1885
296 Ga0373955_0039166 3300035172 Bacteria 2528
297 Ga0373924_0001409 3300035410 Bacteria 7782
298 Ga0373931_0212776 3300035691 Bacteria 1160
299 Ga0373931_0487820 3300035691 Bacteria 793
300 Ga0373935_0002150 3300035692 Bacteria 11178
301 Ga0373927_0001789 3300035695 Bacteria 16045
302 Ga0373933_0175280 3300035724 Bacteria 1366
303 Ga0373947_0000869 3300035725 Bacteria 18266
304 Ga0373947_0082193 3300035725 Bacteria 1996
305 Ga0373937_0003839 3300036401 Bacteria 12700
306 Ga0373937_0015545 3300036401 Bacteria 6734
307 Ga0373937_0095762 3300036401 Bacteria 2752
308 Ga0373925_0005533 3300037068 Bacteria 9404
309 Ga0373925_0038883 3300037068 Bacteria 3519
310 Ga0395900_0179797 3300037418 Bacteria 2150
311 Ga0395898_0572884 3300037466 Bacteria 1071
312 Ga0395905_0427244 3300037471 Bacteria 1221
313 Ga0436364_0062473 3300037853 Bacteria 1034
314 Ga0436364_0193061 3300037853 Bacteria 3061
315 Ga0436364_0216301 3300037853 Bacteria 3683
316 Ga0436364_1240856 3300037853 Bacteria 4463
317 Ga0436365_1260571 3300039437 Bacteria 693
318 Ga0436361_0619471 3300039447 Bacteria 1811
319 Ga0436361_0890698 3300039447 Bacteria 794
320 Ga0436363_1001876 3300039450 Bacteria 1117
321 Ga0436363_1124399 3300039450 Bacteria 1006
322 Ga0436363_1383963 3300039450 Bacteria 2246
323 Ga0436363_1467973 3300039450 Bacteria 2233
324 Ga0436362_0176736 3300039453 Bacteria 899
325 Ga0451853_3210419 3300041512 Bacteria 1526
326 Ga0466963_0021420 3300044694 Bacteria 4078
327 Ga0466964_0443379 3300044706 Bacteria 687
328 Ga0466957_0015230 3300044842 Bacteria 4491
329 Ga0466967_0070726 3300045976 Bacteria 3122
330 Ga0495592_0004474 3300046454 Bacteria 10224
331 Ga0495592_0019840 3300046454 Bacteria 5111
332 Ga0495592_0093791 3300046454 Bacteria 2149
333 Ga0495603_0010077 3300046455 Bacteria 5719
334 Ga0495629_0001025 3300046459 Bacteria 22416
335 Ga0495629_0531335 3300046459 Bacteria 791
336 Ga0495641_0007182 3300046461 Bacteria 7025
337 Ga0495651_0003581 3300046462 Bacteria 11916
338 Ga0495651_0004163 3300046462 Bacteria 11077
339 Ga0495651_0024081 3300046462 Bacteria 4736
340 Ga0495653_0009655 3300046463 Bacteria 7892
341 Ga0495653_0140344 3300046463 Bacteria 1700
342 Ga0495653_0179688 3300046463 Bacteria 1453
343 Ga0495580_0024139 3300046472 Bacteria 4456
344 Ga0495582_0001856 3300046473 Bacteria 11912
345 Ga0495639_0000178 3300046475 Bacteria 33506
346 Ga0495662_0000896 3300046476 Bacteria 14545
347 Ga0495662_0271353 3300046476 Bacteria 835
348 Ga0495664_0005254 3300046477 Bacteria 7107
349 Ga0495664_0165544 3300046477 Bacteria 1342
350 Ga0495594_0004274 3300046499 Bacteria 7335
351 Ga0495606_0001559 3300046507 Bacteria 30113
352 Ga0495608_0001151 3300046511 Bacteria 18715
353 Ga0495608_0001626 3300046511 Bacteria 16124
354 Ga0495618_0001032 3300046514 Bacteria 19076
355 Ga0495618_0227355 3300046514 Bacteria 1175
356 Ga0495628_0014862 3300046516 Bacteria 6510
357 Ga0495628_0018685 3300046516 Bacteria 5736
358 Ga0495630_0001021 3300046517 Bacteria 19378
359 Ga0495630_0416902 3300046517 Bacteria 1029
360 Ga0495666_0002754 3300046526 Bacteria 8780
361 Ga0495652_0007089 3300046529 Bacteria 10344
362 Ga0495652_0009113 3300046529 Bacteria 9030
363 Ga0495652_0034553 3300046529 Bacteria 4405
364 Ga0495665_0000624 3300046531 Bacteria 18026
365 Ga0495640_0028963 3300046533 Bacteria 3981
366 Ga0495640_0036587 3300046533 Bacteria 3468
367 Ga0495640_0055997 3300046533 Bacteria 2696
368 Ga0495640_0122376 3300046533 Bacteria 1690
369 Ga0495586_0015770 3300046535 Bacteria 4019
370 Ga0495587_0007302 3300046536 Bacteria 7163
371 Ga0495587_0010655 3300046536 Bacteria 5839
372 Ga0495587_0089203 3300046536 Bacteria 1782
373 Ga0495645_0004751 3300046543 Bacteria 9283
374 Ga0495645_0018882 3300046543 Bacteria 4959
375 Ga0495645_0342314 3300046543 Bacteria 965
376 Ga0495667_0000485 3300046559 Bacteria 25334
377 Ga0495667_0002000 3300046559 Bacteria 13503
378 Ga0495667_0110773 3300046559 Bacteria 1773
379 Ga0495668_0000173 3300046616 Bacteria 95830
380 Ga0495634_0000635 3300046642 Bacteria 34152
381 Ga0495625_0001109 3300046660 Bacteria 34897
382 Ga0495635_0009882 3300046663 Bacteria 6669
383 Ga0495635_0016009 3300046663 Bacteria 5237
384 Ga0495635_0138745 3300046663 Bacteria 1656
385 Ga0495635_0509760 3300046663 Bacteria 791
386 Ga0495588_0025340 3300046674 Bacteria 2954
387 Ga0495657_0006491 3300046675 Bacteria 9143
388 Ga0495657_0011950 3300046675 Bacteria 6468
389 Ga0495657_0027934 3300046675 Bacteria 3973
390 Ga0495599_0018253 3300046678 Bacteria 4370
391 Ga0495599_0734496 3300046678 Bacteria 567
392 Ga0495623_0013441 3300046679 Bacteria 5307
393 Ga0495623_0036631 3300046679 Bacteria 3141
394 Ga0495623_0065384 3300046679 Bacteria 2274
395 Ga0495646_0000829 3300046680 Bacteria 17410
396 Ga0495646_0052105 3300046680 Bacteria 2474
397 Ga0495646_0186854 3300046680 Bacteria 1134
398 Ga0495647_0003194 3300046681 Bacteria 5246
399 Ga0495658_0000853 3300046683 Bacteria 16387
400 Ga0495613_0007686 3300046689 Bacteria 8020
401 Ga0495624_0004885 3300046690 Bacteria 9740
402 Ga0495600_0000498 3300046809 Bacteria 20349
403 Ga0495600_0000592 3300046809 Bacteria 18722
404 Ga0495600_0211257 3300046809 Bacteria 1243
405 Ga0495581_0000108 3300047315 Bacteria 34596
406 Ga0495604_0004559 3300047317 Bacteria 10977
407 Ga0495604_0019817 3300047317 Bacteria 5380
408 Ga0495604_0088942 3300047317 Bacteria 2297
409 Ga0495674_0006421 3300047319 Bacteria 11275
410 Ga0495674_0015792 3300047319 Bacteria 7048
411 Ga0495674_0089614 3300047319 Bacteria 2629
412 Ga0495676_0000849 3300047321 Bacteria 25619
413 Ga0495680_0004602 3300047322 Bacteria 13155
414 Ga0495680_0010638 3300047322 Bacteria 8204
415 Ga0495680_0031454 3300047322 Bacteria 4319
416 Ga0495675_0002183 3300047444 Bacteria 11665
417 Ga0495675_0071950 3300047444 Bacteria 2182
418 Ga0495684_0001526 3300047471 Bacteria 18551
419 Ga0495684_0132841 3300047471 Bacteria 1868
420 Ga0495684_0187126 3300047471 Bacteria 1533
421 Ga0495593_0000581 3300047673 Bacteria 20813
422 Ga0495602_0023191 3300048088 Bacteria 6053
423 Ga0495602_0038902 3300048088 Bacteria 4389
424 Ga0495602_0100477 3300048088 Bacteria 2375
425 Ga0495614_0006575 3300048089 Bacteria 5208
426 Ga0495626_0000267 3300048091 Bacteria 58992
427 Ga0496101_0573391 3300048904 Bacteria 892
428 Ga0496102_0221622 3300048905 Bacteria 1783
429 Ga0496102_0729627 3300048905 Bacteria 914
430 Ga0496104_0034918 3300048907 Bacteria 4691
431 Ga0496104_0140995 3300048907 Bacteria 2315
432 Ga0496104_0787648 3300048907 Bacteria 857
433 Ga0496105_0024147 3300048908 Bacteria 4937
434 Ga0496105_0839683 3300048908 Bacteria 696
435 Ga0496108_0593893 3300048911 Bacteria 965
436 Ga0496109_0312087 3300048912 Bacteria 1484
437 Ga0496109_1302276 3300048912 Bacteria 663
438 Ga0496110_0209270 3300048913 Bacteria 1773
439 Ga0496112_0000943 3300048915 Bacteria 21100
440 Ga0496112_0002994 3300048915 Bacteria 13799
441 Ga0496112_0211054 3300048915 Bacteria 1899
442 Ga0496112_0967927 3300048915 Bacteria 772
443 Ga0496113_0248323 3300048916 Bacteria 1420
444 Ga0496115_0062416 3300048918 Bacteria 3006
445 Ga0496126_0139486 3300048929 Bacteria 2088
446 Ga0501040_0524156 3300049576 Bacteria 855
447 Ga0501042_0730936 3300049578 Bacteria 720
448 Ga0501067_0360329 3300049583 Bacteria 811
449 Ga0501077_0496308 3300049593 Bacteria 783
450 nmdc:mga05p37_155617_c1 3300050507 Bacteria 2794
451 nmdc:mga05p37_19698_c1 3300050507 Bacteria 8162
452 nmdc:mga05p37_25839_c1 3300050507 Bacteria 7140
453 nmdc:mga05p37_339334_c1 3300050507 Bacteria 1772
454 nmdc:mga05p37_62625_c1 3300050507 Bacteria 4578
455 nmdc:mga05p37_79393_c1 3300050507 Bacteria 4040
456 nmdc:mga09592_11_c1 3300050508 Bacteria 73718
457 nmdc:mga09592_199278_c1 3300050508 Bacteria 1734
458 nmdc:mga09592_284904_c1 3300050508 Bacteria 1433
459 nmdc:mga0qj67_1544_c1 3300050509 Bacteria 16156
460 nmdc:mga0qj67_46_c1 3300050509 Bacteria 72974
461 nmdc:mga06r32_174209_c1 3300050510 Bacteria 2136
462 nmdc:mga06r32_5_c1 3300050510 Bacteria 79813
463 nmdc:mga06r32_647667_c1 3300050510 Bacteria 1025
464 nmdc:mga08y16_14057_c1 3300050511 Bacteria 8425
465 Ga0495601_0000533 3300053077 Bacteria 20122
466 Ga0495601_0076020 3300053077 Bacteria 2150
467 Ga0495601_0129771 3300053077 Bacteria 1641
468 Ga0495601_0671164 3300053077 Bacteria 662
469 Ga0495612_0001685 3300053078 Bacteria 9101
470 Ga0495612_0126509 3300053078 Bacteria 1102
471 Ga0495595_0037320 3300053084 Bacteria 2208
472 Ga0495595_0073396 3300053084 Bacteria 1620
473 Ga0495595_0114450 3300053084 Bacteria 1310
474 Ga0495619_0008192 3300053085 Bacteria 6608
475 Ga0495619_0105517 3300053085 Bacteria 1921
476 Ga0500559_0012007 3300053136 Bacteria 3690
477 2887480925 2887478801 Bacteria 8972725
478 2891561120 2891554331 Bacteria 8812224
479 3003006449 3002998708 Bacteria 11715108
480 8001785397 8001781756 Bacteria 9586736
481 8055174857 8055172936 Bacteria 9305943
482 Ga0075430_100002952
483 JGI25406J46586_10003229
484 Ga0070658_10024564
485 Ga0070658_10031638
486 Ga0070658_10653379
487 Ga0070683_100021534
488 Ga0070683_100030864
489 Ga0070683_100081037
490 Ga0070670_100053002
491 Ga0070670_100487496
492 Ga0068869_100011216
493 Ga0070666_10033702
494 Ga0070680_100096397
495 Ga0070682_101137352
496 Ga0068868_100012048
497 Ga0068868_100265335
498 Ga0070689_100026991
499 Ga0070691_10020126
500 Ga0070691_10114338
501 Ga0070687_100049404
502 Ga0070661_100038665
503 Ga0070668_100058406
504 Ga0070668_100132063
505 Ga0070668_101295065
506 Ga0070669_100085641
507 Ga0070675_100000709
508 Ga0070675_100115457
509 Ga0070673_100077329
510 Ga0070673_100528150
511 Ga0070688_100387135
512 Ga0070659_100228566
513 Ga0070659_101173127
514 Ga0070709_10154233
515 Ga0070709_10379268
516 Ga0070714_100008219
517 Ga0070714_100869983
518 Ga0070714_101039266
519 Ga0070710_10000652
520 Ga0070701_10108943
521 Ga0070711_100191368
522 Ga0070711_100375806
523 Ga0070705_100638261
524 Ga0070705_100868353
525 Ga0070700_100351000
526 Ga0070708_100010115
527 Ga0070708_100123895
528 Ga0070663_100123450
529 Ga0070663_100291620
530 Ga0070678_100032204
531 Ga0070662_100098419
532 Ga0070662_100137710
533 Ga0070681_10025681
534 Ga0070681_10166426
535 Ga0068867_100395543
536 Ga0068867_100842990
537 Ga0070685_10059428
538 Ga0070706_100012874
539 Ga0070706_100017847
540 Ga0070706_100031012
541 Ga0070707_100049375
542 Ga0070707_100157954
543 Ga0070698_100053913
544 Ga0070698_100067375
545 Ga0070698_100332511
546 Ga0070698_100553230
547 Ga0070699_100000709
548 Ga0070684_100018174
549 Ga0070684_100040644
550 Ga0070697_100002722
551 Ga0068853_100130358
552 Ga0070696_100411896
553 Ga0070693_100046960
554 Ga0070665_100073526
555 Ga0070664_100003527
556 Ga0068857_100018633
557 Ga0068857_100066274
558 Ga0068857_100111172
559 Ga0068857_101199668
560 Ga0068854_100274204
561 Ga0068856_100016540
562 Ga0068856_100279902
563 Ga0070702_100362633
564 Ga0068852_100094515
565 Ga0068852_101801856
566 Ga0068859_101361299
567 Ga0068864_100082798
568 Ga0068864_100130334
569 Ga0068864_100215537
570 Ga0068861_100007492
571 Ga0068861_100134733
572 Ga0068851_10029269
573 Ga0068870_10073204
574 Ga0068863_100089467
575 Ga0068863_100195625
576 Ga0068860_101897886
577 Ga0068862_100018951
578 Ga0068862_100154107
579 Ga0081539_10000812
580 Ga0070717_10036969
581 Ga0070717_10853733
582 Ga0070716_100001905
583 Ga0070716_100005932
584 Ga0070712_100067013
585 Ga0070712_100138448
586 Ga0068871_100046384
587 Ga0075428_100059580
588 Ga0075428_100239237
589 Ga0075428_100390058
590 Ga0075428_100731926
591 Ga0075430_100140251
592 Ga0075430_100551252
593 Ga0075431_100016438
594 Ga0075433_10426298
595 Ga0075429_100021782
596 Ga0075429_100153934
597 Ga0075429_100192856
598 Ga0068865_100081947
599 Ga0097620_101361251
600 Ga0075435_100320513
601 Ga0105240_10035507
602 Ga0111539_10010605
603 Ga0105245_10042976
604 Ga0114129_10000031
605 Ga0114129_10001179
606 Ga0114129_10021677
607 Ga0114129_10021772
608 Ga0114129_10275023
609 Ga0114129_11656295
610 Ga0105242_10259722
611 Ga0105248_10949398
612 Ga0105249_10347498
613 Ga0105239_10045662
614 Ga0105239_10519902
615 Ga0105239_11147600
616 Ga0157370_10046570
617 Ga0163162_10060440
618 Ga0163162_10323193
619 Ga0163162_10593809
620 Ga0163163_10145945
621 Ga0163163_10352506
622 Ga0163163_10699349
623 Ga0157377_10030877
624 Ga0157376_10632235
625 Ga0163161_10117701
626 Ga0206356_10955857
627 Ga0206354_10700772
628 Ga0206354_10834889
629 Ga0206353_10800801
630 Ga0213875_10060912
631 Ga0213875_10098879
632 Ga0207653_10006752
633 Ga0207692_10000106
634 Ga0207692_10089824
635 Ga0207692_10189377
636 Ga0207642_10012591
637 Ga0207688_10017786
638 Ga0207680_10039701
639 Ga0207685_10021524
640 Ga0207685_10035460
641 Ga0207685_10188920
642 Ga0207699_10000670
643 Ga0207699_10007182
644 Ga0207699_10012444
645 Ga0207699_10095204
646 Ga0207645_10045880
647 Ga0207643_10024629
648 Ga0207705_10923009
649 Ga0207684_10013865
650 Ga0207684_10109596
651 Ga0207684_10270875
652 Ga0207684_10308394
653 Ga0207654_10274320
654 Ga0207707_10005453
655 Ga0207707_11070629
656 Ga0207693_10028485
657 Ga0207693_10041761
658 Ga0207693_10126409
659 Ga0207663_10005069
660 Ga0207663_10007836
661 Ga0207663_10413206
662 Ga0207660_10113246
663 Ga0207660_10188166
664 Ga0207662_10012669
665 Ga0207657_10007929
666 Ga0207657_10242694
667 Ga0207652_10017496
668 Ga0207646_10008588
669 Ga0207646_10049185
670 Ga0207646_10105495
671 Ga0207646_10888568
672 Ga0207681_10746452
673 Ga0207694_10233836
674 Ga0207650_10887051
675 Ga0207659_10005955
676 Ga0207659_10114014
677 Ga0207687_10294610
678 Ga0207700_10000126
679 Ga0207700_10018060
680 Ga0207700_10048057
681 Ga0207700_10371244
682 Ga0207700_10900592
683 Ga0207664_10000148
684 Ga0207664_10014200
685 Ga0207664_10046088
686 Ga0207664_10059608
687 Ga0207664_10216095
688 Ga0207644_10346553
689 Ga0207690_10229867
690 Ga0207690_10378397
691 Ga0207706_10073139
692 Ga0207706_10105369
693 Ga0207686_10088432
694 Ga0207670_10328438
695 Ga0207704_10430738
696 Ga0207665_10002850
697 Ga0207665_10004752
698 Ga0207665_10007233
699 Ga0207665_10010756
700 Ga0207691_10029764
701 Ga0207691_10128850
702 Ga0207711_10874076
703 Ga0207689_10018649
704 Ga0207689_10040067
705 Ga0207661_10024104
706 Ga0207661_10042638
707 Ga0207661_10212414
708 Ga0207679_10168371
709 Ga0207667_10154722
710 Ga0207651_10224174
711 Ga0207712_10364550
712 Ga0207668_10046807
713 Ga0207668_10094040
714 Ga0207668_10153522
715 Ga0207640_10123691
716 Ga0207658_10011041
717 Ga0207677_10007853
718 Ga0207678_10016152
719 Ga0207678_10287108
720 Ga0207678_10969611
721 Ga0207708_10003367
722 Ga0207708_10051611
723 Ga0207702_10087669
724 Ga0207702_10160539
725 Ga0207702_10418604
726 Ga0207641_10054080
727 Ga0207648_10016530
728 Ga0207648_10376352
729 Ga0207676_10123249
730 Ga0207674_10007368
731 Ga0207674_10030530
732 Ga0207674_10059196
733 Ga0207675_100005498
734 Ga0207675_100012094
735 Ga0207683_10001444
736 Ga0207683_11472018
737 Ga0207698_10083792
738 Ga0207428_10017037
739 Ga0268266_10030750
740 Ga0268265_10020022
741 Ga0268265_10050335
742 Ga0268264_11010532
743 Ga0307515_10052562
744 Ga0265338_10001573
745 Ga0307513_10045865
746 Ga0307405_10504338
747 Ga0307413_10070140
748 Ga0307410_10140247
749 Ga0307406_10027536
750 Ga0307406_10221359
751 Ga0307406_10270574
752 Ga0307406_10919003
753 Ga0307406_11609145
754 Ga0307407_10017061
755 Ga0307412_10184707
756 Ga0307409_100166182
757 Ga0307416_102345756
758 Ga0307414_10102934
759 Ga0307411_10227840
760 Ga0307415_100010742
761 Ga0307415_100111130
762 Ga0307415_100715511
763 Ga0373926_0003380
764 Ga0373934_0045105
765 Ga0373940_0003011
766 Ga0373944_0002496
767 Ga0373951_0050116
768 Ga0373936_0000470
769 Ga0373936_0065649
770 Ga0373945_0002916
771 Ga0373953_0001216
772 Ga0373954_0004421
773 Ga0373957_0011715
774 Ga0373943_0001611
775 Ga0373946_0000157
776 Ga0373946_0041656
777 Ga0373955_0039166
778 Ga0373924_0001409
779 Ga0373931_0212776
780 Ga0373931_0487820
781 Ga0373935_0002150
782 Ga0373927_0001789
783 Ga0373933_0175280
784 Ga0373947_0000869
785 Ga0373947_0082193
786 Ga0373937_0003839
787 Ga0373937_0015545
788 Ga0373937_0095762
789 Ga0373925_0005533
790 Ga0373925_0038883
791 Ga0395900_0179797
792 Ga0395898_0572884
793 Ga0395905_0427244
794 Ga0436364_0062473
795 Ga0436364_0193061
796 Ga0436364_0216301
797 Ga0436364_1240856
798 Ga0436365_1260571
799 Ga0436361_0619471
800 Ga0436361_0890698
801 Ga0436363_1001876
802 Ga0436363_1124399
803 Ga0436363_1383963
804 Ga0436363_1467973
805 Ga0436362_0176736
806 Ga0451853_3210419
807 Ga0466963_0021420
808 Ga0466964_0443379
809 Ga0466957_0015230
810 Ga0466967_0070726
811 Ga0495592_0004474
812 Ga0495592_0019840
813 Ga0495592_0093791
814 Ga0495603_0010077
815 Ga0495629_0001025
816 Ga0495629_0531335
817 Ga0495641_0007182
818 Ga0495651_0003581
819 Ga0495651_0004163
820 Ga0495651_0024081
821 Ga0495653_0009655
822 Ga0495653_0140344
823 Ga0495653_0179688
824 Ga0495580_0024139
825 Ga0495582_0001856
826 Ga0495639_0000178
827 Ga0495662_0000896
828 Ga0495662_0271353
829 Ga0495664_0005254
830 Ga0495664_0165544
831 Ga0495594_0004274
832 Ga0495606_0001559
833 Ga0495608_0001151
834 Ga0495608_0001626
835 Ga0495618_0001032
836 Ga0495618_0227355
837 Ga0495628_0014862
838 Ga0495628_0018685
839 Ga0495630_0001021
840 Ga0495630_0416902
841 Ga0495666_0002754
842 Ga0495652_0007089
843 Ga0495652_0009113
844 Ga0495652_0034553
845 Ga0495665_0000624
846 Ga0495640_0028963
847 Ga0495640_0036587
848 Ga0495640_0055997
849 Ga0495640_0122376
850 Ga0495586_0015770
851 Ga0495587_0007302
852 Ga0495587_0010655
853 Ga0495587_0089203
854 Ga0495645_0004751
855 Ga0495645_0018882
856 Ga0495645_0342314
857 Ga0495667_0000485
858 Ga0495667_0002000
859 Ga0495667_0110773
860 Ga0495668_0000173
861 Ga0495634_0000635
862 Ga0495625_0001109
863 Ga0495635_0009882
864 Ga0495635_0016009
865 Ga0495635_0138745
866 Ga0495635_0509760
867 Ga0495588_0025340
868 Ga0495657_0006491
869 Ga0495657_0011950
870 Ga0495657_0027934
871 Ga0495599_0018253
872 Ga0495599_0734496
873 Ga0495623_0013441
874 Ga0495623_0036631
875 Ga0495623_0065384
876 Ga0495646_0000829
877 Ga0495646_0052105
878 Ga0495646_0186854
879 Ga0495647_0003194
880 Ga0495658_0000853
881 Ga0495613_0007686
882 Ga0495624_0004885
883 Ga0495600_0000498
884 Ga0495600_0000592
885 Ga0495600_0211257
886 Ga0495581_0000108
887 Ga0495604_0004559
888 Ga0495604_0019817
889 Ga0495604_0088942
890 Ga0495674_0006421
891 Ga0495674_0015792
892 Ga0495674_0089614
893 Ga0495676_0000849
894 Ga0495680_0004602
895 Ga0495680_0010638
896 Ga0495680_0031454
897 Ga0495675_0002183
898 Ga0495675_0071950
899 Ga0495684_0001526
900 Ga0495684_0132841
901 Ga0495684_0187126
902 Ga0495593_0000581
903 Ga0495602_0023191
904 Ga0495602_0038902
905 Ga0495602_0100477
906 Ga0495614_0006575
907 Ga0495626_0000267
908 Ga0496101_0573391
909 Ga0496102_0221622
910 Ga0496102_0729627
911 Ga0496104_0034918
912 Ga0496104_0140995
913 Ga0496104_0787648
914 Ga0496105_0024147
915 Ga0496105_0839683
916 Ga0496108_0593893
917 Ga0496109_0312087
918 Ga0496109_1302276
919 Ga0496110_0209270
920 Ga0496112_0000943
921 Ga0496112_0002994
922 Ga0496112_0211054
923 Ga0496112_0967927
924 Ga0496113_0248323
925 Ga0496115_0062416
926 Ga0496126_0139486
927 Ga0501040_0524156
928 Ga0501042_0730936
929 Ga0501067_0360329
930 Ga0501077_0496308
931 nmdc:mga05p37_155617_c1
932 nmdc:mga05p37_19698_c1
933 nmdc:mga05p37_25839_c1
934 nmdc:mga05p37_339334_c1
935 nmdc:mga05p37_62625_c1
936 nmdc:mga05p37_79393_c1
937 nmdc:mga09592_11_c1
938 nmdc:mga09592_199278_c1
939 nmdc:mga09592_284904_c1
940 nmdc:mga0qj67_1544_c1
941 nmdc:mga0qj67_46_c1
942 nmdc:mga06r32_174209_c1
943 nmdc:mga06r32_5_c1
944 nmdc:mga06r32_647667_c1
945 nmdc:mga08y16_14057_c1
946 Ga0495601_0000533
947 Ga0495601_0076020
948 Ga0495601_0129771
949 Ga0495601_0671164
950 Ga0495612_0001685
951 Ga0495612_0126509
952 Ga0495595_0037320
953 Ga0495595_0073396
954 Ga0495595_0114450
955 Ga0495619_0008192
956 Ga0495619_0105517
957 Ga0500559_0012007
958 2887480925
959 2891561120
960 3003006449
961 8001785397
962 8055174857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13478

XdhC_C

XdhC Rossmann domain

41

178

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zx9-assembly1.cif.gz_A crystal structure of tn501 mera 0.8994 22 54
8odw-assembly1.cif.gz_A crystal structure of lbma ox-acp didomain in complex with nadp and ethyl glycinate from the lobatamide pks (gynuella sunshinyii) 0.8882 23 54
6kgy-assembly1.cif.gz_A hocl-induced flavoprotein disulfide reductase rcla from escherichia coli 0.887 24 52
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.8842 23 53
7d6x-assembly1.cif.gz_A mycobacterium smegmatis sdh1 complex in the apo form 0.8833 24 54
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9013 25 55 3.50.50.60
af_Q54H02_2_246_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.891 22 54 3.50.50.60
4i58A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8719 23 54 3.50.50.60
af_I1MHA5_112_472_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8665 24 51 3.50.50.60
5bvaA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8646 23 54 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7Y0JUE4-F1-model_v4 XdhC/CoxF family protein 0.9427 29 175
AF-A0A7Y0JUE4-F1-model_v4 XdhC/CoxF family protein 0.9304 29 175
AF-A0A3T1AUX7-F1-model_v4 Xanthine dehydrogenase accessory factor 0.9281 28 175
AF-A0A4Y9N7R3-F1-model_v4 Xanthine dehydrogenase 0.9248 2 172
AF-A0A1Q7VV43-F1-model_v4 Xanthine dehydrogenase 0.9213 16 175

Map