F452372

General Info

Members Datasets Scaffolds Average Seq Length
481 291 962 125

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_11297874|Ga0070685_112978741
Length 141
Sequence VPGIHVLQTLSPAKEGLLSAERQRIDKWLWHARVVRTRTAAASLVNEGHVRLNGERVAAASRPVKPGDVVTIALDRTVRILRVTGFAERRGDADAARLLCEDLTPTSQVAPADPVSSERERGSGRPTKQERRATDRLLGRD

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.86
Nodule 0
Rhizoplane 7.69
Rhizosphere 83.99
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_11297874 3300005466 Bacteria 556
2 JGI25406J46586_10017011 3300003203 Bacteria 3015
3 Ga0070658_10299026 3300005327 Bacteria 1372
4 Ga0070676_10032308 3300005328 Bacteria 2998
5 Ga0070683_100464425 3300005329 Bacteria 1208
6 Ga0070683_100592234 3300005329 Bacteria 1061
7 Ga0070690_100058387 3300005330 Bacteria 2477
8 Ga0070670_100246260 3300005331 Bacteria 1556
9 Ga0070677_10129816 3300005333 Bacteria 1149
10 Ga0068869_100040927 3300005334 Bacteria 3315
11 Ga0070666_10335111 3300005335 Bacteria 1081
12 Ga0070680_100011512 3300005336 Bacteria 6848
13 Ga0070689_100003207 3300005340 Bacteria 10836
14 Ga0070689_100152553 3300005340 Bacteria 1864
15 Ga0070689_100762554 3300005340 Bacteria 849
16 Ga0070687_100019841 3300005343 Bacteria 3135
17 Ga0070692_10585692 3300005345 Bacteria 736
18 Ga0070668_100303574 3300005347 Bacteria 1339
19 Ga0070668_101324871 3300005347 Unclassified 655
20 Ga0070669_100197867 3300005353 Bacteria 1580
21 Ga0070669_100332165 3300005353 Bacteria 1230
22 Ga0070675_100037693 3300005354 Bacteria 3940
23 Ga0070675_101290103 3300005354 Bacteria 673
24 Ga0070671_100053923 3300005355 Bacteria 3342
25 Ga0070671_100319103 3300005355 Bacteria 1324
26 Ga0070674_100119181 3300005356 Bacteria 1951
27 Ga0070673_100677143 3300005364 Bacteria 946
28 Ga0070673_100738229 3300005364 Bacteria 906
29 Ga0070688_100043298 3300005365 Bacteria 2773
30 Ga0070688_100492731 3300005365 Bacteria 923
31 Ga0070659_100006049 3300005366 Bacteria 8728
32 Ga0070659_102090205 3300005366 Bacteria 509
33 Ga0070667_100544121 3300005367 Bacteria 1067
34 Ga0070713_100511420 3300005436 Bacteria 1134
35 Ga0070713_101704200 3300005436 Bacteria 612
36 Ga0070701_10711112 3300005438 Bacteria 677
37 Ga0070700_100713839 3300005441 Bacteria 798
38 Ga0070681_11030827 3300005458 Bacteria 743
39 Ga0068867_100241679 3300005459 Bacteria 1465
40 Ga0068867_100389068 3300005459 Unclassified 1173
41 Ga0070685_10116918 3300005466 Bacteria 1651
42 Ga0070685_10557472 3300005466 Bacteria 819
43 Ga0070679_100014493 3300005530 Bacteria 7573
44 Ga0070684_100093357 3300005535 Bacteria 2679
45 Ga0068853_100206823 3300005539 Bacteria 1788
46 Ga0070672_100416089 3300005543 Bacteria 1154
47 Ga0070686_100255919 3300005544 Bacteria 1281
48 Ga0070693_100882116 3300005547 Bacteria 669
49 Ga0070665_100790936 3300005548 Bacteria 962
50 Ga0070704_101068449 3300005549 Bacteria 732
51 Ga0068856_100605064 3300005614 Bacteria 1117
52 Ga0068859_100027589 3300005617 Bacteria 5695
53 Ga0068859_100596523 3300005617 Bacteria 1198
54 Ga0068864_100022878 3300005618 Bacteria 5243
55 Ga0068864_100096194 3300005618 Bacteria 2620
56 Ga0068864_100310974 3300005618 Bacteria 1477
57 Ga0068866_10092575 3300005718 Bacteria 1650
58 Ga0068866_11325365 3300005718 Unclassified 524
59 Ga0068863_100419021 3300005841 Bacteria 1311
60 Ga0068863_100458263 3300005841 Bacteria 1252
61 Ga0068863_102395459 3300005841 Bacteria 537
62 Ga0068858_100969264 3300005842 Bacteria 833
63 Ga0068858_101676440 3300005842 Bacteria 628
64 Ga0068860_100167179 3300005843 Bacteria 2123
65 Ga0068860_101950714 3300005843 Unclassified 609
66 Ga0068862_100185555 3300005844 Bacteria 1869
67 Ga0081455_10023650 3300005937 Bacteria 5713
68 Ga0081540_1000005 3300005983 Bacteria 227052
69 Ga0081540_1048129 3300005983 Bacteria 2138
70 Ga0081539_10000522 3300005985 Bacteria 79973
71 Ga0070717_10679769 3300006028 Bacteria 935
72 Ga0075365_10542522 3300006038 Bacteria 822
73 Ga0075365_10824470 3300006038 Bacteria 654
74 Ga0075368_10089634 3300006042 Bacteria 1257
75 Ga0075368_10105314 3300006042 Bacteria 1160
76 Ga0075363_100209157 3300006048 Bacteria 1116
77 Ga0075364_10140838 3300006051 Bacteria 1622
78 Ga0075367_10401455 3300006178 Bacteria 867
79 Ga0075367_10463439 3300006178 Bacteria 803
80 Ga0097621_100051385 3300006237 Bacteria 3355
81 Ga0097621_100717132 3300006237 Bacteria 922
82 Ga0075370_10135736 3300006353 Bacteria 1437
83 Ga0075370_10176011 3300006353 Bacteria 1258
84 Ga0075428_100011642 3300006844 Bacteria 9787
85 Ga0075428_100052192 3300006844 Bacteria 4483
86 Ga0075428_100398713 3300006844 Bacteria 1475
87 Ga0075430_100014318 3300006846 Bacteria 6760
88 Ga0075431_100000584 3300006847 Bacteria 30912
89 Ga0075431_100316387 3300006847 Bacteria 1575
90 Ga0075431_100800235 3300006847 Bacteria 916
91 Ga0075433_10288101 3300006852 Bacteria 1455
92 Ga0075429_100384914 3300006880 Bacteria 1228
93 Ga0075429_100539466 3300006880 Bacteria 1022
94 Ga0068865_100375039 3300006881 Bacteria 1159
95 Ga0068865_100762859 3300006881 Bacteria 832
96 Ga0097620_100027588 3300006931 Bacteria 5695
97 Ga0097620_100596556 3300006931 Bacteria 1198
98 Ga0075435_100402024 3300007076 Bacteria 1178
99 Ga0099795_10055431 3300007788 Bacteria 1456
100 Ga0105240_10185993 3300009093 Bacteria 2447
101 Ga0105240_10963909 3300009093 Bacteria 914
102 Ga0111539_10000705 3300009094 Bacteria 43338
103 Ga0111539_10031016 3300009094 Bacteria 6494
104 Ga0111539_11260743 3300009094 Bacteria 858
105 Ga0105245_10125657 3300009098 Bacteria 2401
106 Ga0105245_10193954 3300009098 Bacteria 1947
107 Ga0105247_10605457 3300009101 Bacteria 813
108 Ga0114129_10000057 3300009147 Bacteria 99258
109 Ga0114129_10008061 3300009147 Bacteria 15010
110 Ga0114129_10239646 3300009147 Bacteria 2438
111 Ga0114129_10291675 3300009147 Bacteria 2177
112 Ga0114129_11524841 3300009147 Bacteria 820
113 Ga0105243_10143303 3300009148 Bacteria 2041
114 Ga0105243_11695617 3300009148 Bacteria 661
115 Ga0105241_11424866 3300009174 Bacteria 664
116 Ga0105242_10051915 3300009176 Bacteria 3344
117 Ga0105248_10118877 3300009177 Bacteria 2981
118 Ga0105248_10636484 3300009177 Bacteria 1203
119 Ga0105237_10822893 3300009545 Bacteria 935
120 Ga0105238_10046231 3300009551 Bacteria 4394
121 Ga0105238_10446620 3300009551 Bacteria 1290
122 Ga0105238_11271718 3300009551 Bacteria 761
123 Ga0105249_10257842 3300009553 Bacteria 1731
124 Ga0105249_10278675 3300009553 Bacteria 1669
125 Ga0105249_10388897 3300009553 Bacteria 1422
126 Ga0105249_10894459 3300009553 Bacteria 955
127 Ga0105033_108845 3300009986 Bacteria 878
128 Ga0105239_10218097 3300010375 Bacteria 2139
129 Ga0105246_10119083 3300011119 Bacteria 1953
130 Ga0105246_10476080 3300011119 Bacteria 1055
131 Ga0157374_11636344 3300013296 Bacteria 668
132 Ga0163162_12816092 3300013306 Unclassified 560
133 Ga0163163_10052308 3300014325 Bacteria 4030
134 Ga0163163_11142891 3300014325 Bacteria 841
135 Ga0182008_10304711 3300014497 Bacteria 834
136 Ga0157379_10068567 3300014968 Bacteria 3171
137 Ga0157376_10479388 3300014969 Bacteria 1219
138 Ga0182007_10057103 3300015262 Bacteria 1281
139 Ga0213876_10065311 3300021384 Bacteria 1920
140 Ga0207697_10187862 3300025315 Bacteria 907
141 Ga0207682_10161122 3300025893 Bacteria 1016
142 Ga0207642_10584438 3300025899 Bacteria 693
143 Ga0207710_10044175 3300025900 Bacteria 1984
144 Ga0207710_10303447 3300025900 Bacteria 807
145 Ga0207680_10291159 3300025903 Bacteria 1136
146 Ga0207645_10011751 3300025907 Bacteria 5966
147 Ga0207645_10648946 3300025907 Bacteria 717
148 Ga0207705_10191543 3300025909 Bacteria 1547
149 Ga0207707_10093259 3300025912 Bacteria 2630
150 Ga0207671_10173385 3300025914 Bacteria 1676
151 Ga0207662_10008746 3300025918 Bacteria 5554
152 Ga0207662_10123210 3300025918 Bacteria 1627
153 Ga0207652_10478828 3300025921 Bacteria 1121
154 Ga0207681_10130499 3300025923 Bacteria 1857
155 Ga0207681_11387494 3300025923 Bacteria 590
156 Ga0207694_10061282 3300025924 Bacteria 2928
157 Ga0207694_11158209 3300025924 Bacteria 654
158 Ga0207650_10001900 3300025925 Bacteria 14725
159 Ga0207650_10502652 3300025925 Bacteria 1013
160 Ga0207659_10541639 3300025926 Bacteria 989
161 Ga0207659_10918402 3300025926 Bacteria 753
162 Ga0207659_11042235 3300025926 Bacteria 704
163 Ga0207687_10101478 3300025927 Bacteria 2118
164 Ga0207644_10213400 3300025931 Bacteria 1527
165 Ga0207644_10392319 3300025931 Bacteria 1133
166 Ga0207644_10573511 3300025931 Bacteria 935
167 Ga0207686_10065635 3300025934 Bacteria 2315
168 Ga0207709_10068932 3300025935 Bacteria 2237
169 Ga0207670_10002069 3300025936 Bacteria 10500
170 Ga0207670_10118427 3300025936 Bacteria 1921
171 Ga0207670_10325258 3300025936 Bacteria 1211
172 Ga0207670_10552411 3300025936 Bacteria 941
173 Ga0207669_10011675 3300025937 Bacteria 4286
174 Ga0207704_10030922 3300025938 Bacteria 3009
175 Ga0207704_10059785 3300025938 Bacteria 2354
176 Ga0207704_10849020 3300025938 Bacteria 765
177 Ga0207711_10064141 3300025941 Bacteria 3172
178 Ga0207689_10013411 3300025942 Bacteria 6996
179 Ga0207661_10050399 3300025944 Bacteria 3317
180 Ga0207651_10115709 3300025960 Bacteria 2023
181 Ga0207651_10875710 3300025960 Bacteria 799
182 Ga0207651_11694576 3300025960 Bacteria 569
183 Ga0207712_10175200 3300025961 Bacteria 1680
184 Ga0207712_10967961 3300025961 Bacteria 754
185 Ga0207712_11147802 3300025961 Bacteria 692
186 Ga0207668_10196448 3300025972 Bacteria 1603
187 Ga0207668_11428133 3300025972 Bacteria 624
188 Ga0207658_10502273 3300025986 Bacteria 1080
189 Ga0207677_10438516 3300026023 Bacteria 1116
190 Ga0207677_11967813 3300026023 Bacteria 543
191 Ga0207677_12190910 3300026023 Bacteria 514
192 Ga0207703_10127696 3300026035 Bacteria 2192
193 Ga0207639_10156431 3300026041 Bacteria 1915
194 Ga0207639_10172569 3300026041 Bacteria 1833
195 Ga0207639_11026822 3300026041 Bacteria 772
196 Ga0207708_10035554 3300026075 Bacteria 3791
197 Ga0207702_10088255 3300026078 Bacteria 2709
198 Ga0207641_10293189 3300026088 Bacteria 1534
199 Ga0207641_10447791 3300026088 Bacteria 1247
200 Ga0207648_10010490 3300026089 Bacteria 8777
201 Ga0207648_10177835 3300026089 Bacteria 1882
202 Ga0207676_10011519 3300026095 Bacteria 6325
203 Ga0207676_10024304 3300026095 Bacteria 4481
204 Ga0207676_10375471 3300026095 Bacteria 1322
205 Ga0207675_100472478 3300026118 Bacteria 1245
206 Ga0207683_10030131 3300026121 Bacteria 4700
207 Ga0209813_10042626 3300027866 Bacteria 1387
208 Ga0207428_10095323 3300027907 Bacteria 2305
209 Ga0207428_10437884 3300027907 Bacteria 954
210 Ga0268266_10768667 3300028379 Bacteria 930
211 Ga0268266_10840990 3300028379 Bacteria 887
212 Ga0268265_10501217 3300028380 Bacteria 1144
213 Ga0268265_10617477 3300028380 Bacteria 1038
214 Ga0268264_10286029 3300028381 Bacteria 1546
215 Ga0265325_10148449 3300031241 Bacteria 1110
216 Ga0265325_10148887 3300031241 Bacteria 1108
217 Ga0265325_10428267 3300031241 Bacteria 578
218 Ga0265331_10084751 3300031250 Bacteria 1469
219 Ga0265331_10372927 3300031250 Unclassified 639
220 Ga0307408_100589889 3300031548 Bacteria 986
221 Ga0307409_101227247 3300031995 Bacteria 774
222 Ga0373930_0089953 3300034816 Bacteria 719
223 Ga0373930_0123591 3300034816 Bacteria 632
224 Ga0373948_0014220 3300034817 Bacteria 1447
225 Ga0373929_0002299 3300035085 Bacteria 3524
226 Ga0373929_0122813 3300035085 Bacteria 674
227 Ga0373940_0080110 3300035088 Bacteria 964
228 Ga0373940_0284158 3300035088 Bacteria 566
229 Ga0373944_0015622 3300035089 Bacteria 2132
230 Ga0373944_0175861 3300035089 Bacteria 766
231 Ga0373951_0014166 3300035091 Bacteria 1791
232 Ga0373952_0015860 3300035092 Bacteria 1525
233 Ga0373952_0042671 3300035092 Bacteria 1054
234 Ga0373923_0027733 3300035111 Bacteria 2261
235 Ga0373932_0332010 3300035112 Bacteria 574
236 Ga0373936_0010842 3300035113 Bacteria 3443
237 Ga0373936_0139560 3300035113 Bacteria 1046
238 Ga0373939_0035993 3300035114 Bacteria 1462
239 Ga0373957_0486481 3300035120 Bacteria 536
240 Ga0373960_0011908 3300035121 Bacteria 2152
241 Ga0373960_0090088 3300035121 Bacteria 979
242 Ga0373943_0101161 3300035170 Bacteria 1507
243 Ga0373943_0148921 3300035170 Bacteria 1267
244 Ga0373946_0010305 3300035171 Bacteria 3456
245 Ga0373946_0100683 3300035171 Bacteria 1295
246 Ga0373955_0077850 3300035172 Bacteria 1868
247 Ga0373955_0139084 3300035172 Bacteria 1423
248 Ga0373942_0080903 3300035207 Bacteria 964
249 Ga0373961_0126326 3300035241 Bacteria 852
250 Ga0373924_0097547 3300035410 Bacteria 1262
251 Ga0373931_0000511 3300035691 Bacteria 15892
252 Ga0373931_0015492 3300035691 Bacteria 3741
253 Ga0373931_0016734 3300035691 Bacteria 3614
254 Ga0373931_0818920 3300035691 Bacteria 622
255 Ga0373935_0082488 3300035692 Bacteria 2092
256 Ga0373935_0084764 3300035692 Bacteria 2064
257 Ga0373935_0229796 3300035692 Bacteria 1291
258 Ga0373927_0011865 3300035695 Bacteria 5804
259 Ga0373927_0091070 3300035695 Bacteria 1981
260 Ga0373927_0307630 3300035695 Bacteria 1043
261 Ga0373927_0545695 3300035695 Bacteria 766
262 Ga0373947_0007784 3300035725 Bacteria 6189
263 Ga0373947_0117975 3300035725 Bacteria 1684
264 Ga0373937_0200055 3300036401 Bacteria 1878
265 Ga0373925_0180075 3300037068 Bacteria 1672
266 Ga0373925_0207198 3300037068 Bacteria 1561
267 Ga0373925_0732115 3300037068 Bacteria 815
268 Ga0373925_0878248 3300037068 Bacteria 739
269 Ga0395900_0249292 3300037418 Bacteria 1778
270 Ga0395898_1737752 3300037466 Bacteria 546
271 Ga0395905_1437081 3300037471 Bacteria 594
272 Ga0436364_0088676 3300037853 Bacteria 2541
273 Ga0436365_0739073 3300039437 Bacteria 646
274 Ga0436365_1110589 3300039437 Bacteria 2749
275 Ga0436365_1264108 3300039437 Bacteria 538
276 Ga0436363_0357360 3300039450 Bacteria 2365
277 Ga0436362_0175594 3300039453 Bacteria 843
278 Ga0439456_015243 3300042013 Bacteria 1605
279 Ga0439446_0201154 3300042156 Bacteria 672
280 Ga0451577_0034458 3300042876 Bacteria 4563
281 Ga0453684_0073423 3300044712 Bacteria 4312
282 Ga0466971_0560740 3300044719 Bacteria 567
283 Ga0466957_0748821 3300044842 Bacteria 692
284 Ga0451576_2185883 3300045051 Bacteria 568
285 Ga0466967_0833834 3300045976 Bacteria 916
286 Ga0495592_0008058 3300046454 Bacteria 7911
287 Ga0495603_0021396 3300046455 Bacteria 3917
288 Ga0495629_0534079 3300046459 Bacteria 788
289 Ga0495641_0022906 3300046461 Bacteria 3115
290 Ga0495651_0372377 3300046462 Bacteria 939
291 Ga0495580_0029691 3300046472 Bacteria 3967
292 Ga0495605_0160445 3300046474 Bacteria 998
293 Ga0495639_0052657 3300046475 Bacteria 1853
294 Ga0495662_0224691 3300046476 Bacteria 926
295 Ga0495664_0548567 3300046477 Bacteria 689
296 Ga0495584_0001682 3300046491 Bacteria 12963
297 Ga0495584_0134012 3300046491 Bacteria 1257
298 Ga0495585_0100046 3300046492 Bacteria 1551
299 Ga0495594_0008985 3300046499 Bacteria 5153
300 Ga0495616_0142703 3300046513 Bacteria 1089
301 Ga0495628_0065514 3300046516 Bacteria 2841
302 Ga0495630_0231652 3300046517 Bacteria 1411
303 Ga0495631_0087316 3300046518 Bacteria 1343
304 Ga0495663_0156111 3300046525 Bacteria 781
305 Ga0495666_0010639 3300046526 Bacteria 4587
306 Ga0495654_0175056 3300046530 Bacteria 933
307 Ga0495665_0027838 3300046531 Bacteria 3034
308 Ga0495586_0251074 3300046535 Bacteria 1009
309 Ga0495586_0315287 3300046535 Bacteria 897
310 Ga0495598_0000505 3300046537 Bacteria 7221
311 Ga0495598_0329563 3300046537 Bacteria 583
312 Ga0495621_0005180 3300046539 Bacteria 3731
313 Ga0495633_0033355 3300046558 Bacteria 2483
314 Ga0495667_0602697 3300046559 Bacteria 684
315 Ga0495656_0003130 3300046615 Bacteria 5564
316 Ga0495588_0021647 3300046674 Bacteria 3171
317 Ga0495599_0249376 3300046678 Bacteria 1081
318 Ga0495646_0181757 3300046680 Bacteria 1154
319 Ga0495647_0621492 3300046681 Bacteria 508
320 Ga0495658_0016835 3300046683 Bacteria 3767
321 Ga0495669_0020062 3300046684 Bacteria 2889
322 Ga0495624_0017034 3300046690 Bacteria 4884
323 Ga0495670_0054527 3300046691 Bacteria 2003
324 Ga0495671_0421725 3300046692 Bacteria 638
325 Ga0495649_0254281 3300046694 Bacteria 902
326 Ga0495600_0228433 3300046809 Bacteria 1189
327 Ga0495581_0054215 3300047315 Bacteria 2315
328 Ga0495581_0210301 3300047315 Bacteria 1138
329 Ga0495581_0351298 3300047315 Bacteria 861
330 Ga0495604_0102086 3300047317 Bacteria 2106
331 Ga0495674_0281595 3300047319 Bacteria 1362
332 Ga0495676_0101327 3300047321 Bacteria 2130
333 Ga0495676_0408739 3300047321 Bacteria 900
334 Ga0495677_0280994 3300047445 Bacteria 653
335 Ga0495686_0517926 3300047472 Bacteria 626
336 Ga0495614_0120409 3300048089 Bacteria 1157
337 Ga0495614_0198214 3300048089 Bacteria 908
338 Ga0496100_0006463 3300048903 Bacteria 6391
339 Ga0496100_0013434 3300048903 Bacteria 4723
340 Ga0496100_0097269 3300048903 Bacteria 2021
341 Ga0496101_0015563 3300048904 Bacteria 5129
342 Ga0496101_0710402 3300048904 Bacteria 793
343 Ga0496102_0010899 3300048905 Bacteria 7829
344 Ga0496102_0195807 3300048905 Bacteria 1904
345 Ga0496103_0171302 3300048906 Bacteria 1394
346 Ga0496104_0001225 3300048907 Bacteria 22061
347 Ga0496104_0018088 3300048907 Bacteria 6426
348 Ga0496105_0000637 3300048908 Bacteria 23492
349 Ga0496105_0001797 3300048908 Bacteria 15330
350 Ga0496106_0021561 3300048909 Bacteria 4784
351 Ga0496106_0048898 3300048909 Bacteria 3185
352 Ga0496107_0046749 3300048910 Bacteria 3115
353 Ga0496108_0000745 3300048911 Bacteria 25333
354 Ga0496108_0084078 3300048911 Bacteria 2700
355 Ga0496109_0008952 3300048912 Bacteria 8527
356 Ga0496109_0017791 3300048912 Bacteria 6233
357 Ga0496110_0008410 3300048913 Bacteria 8302
358 Ga0496110_0026203 3300048913 Bacteria 4986
359 Ga0496110_0165456 3300048913 Bacteria 2006
360 Ga0496110_0908327 3300048913 Bacteria 787
361 Ga0496111_0000254 3300048914 Bacteria 25829
362 Ga0496111_0012993 3300048914 Bacteria 5652
363 Ga0496112_0002996 3300048915 Bacteria 13797
364 Ga0496112_0021077 3300048915 Bacteria 6191
365 Ga0496112_0073768 3300048915 Bacteria 3373
366 Ga0496112_1183536 3300048915 Bacteria 681
367 Ga0496113_0000209 3300048916 Bacteria 27329
368 Ga0496113_0029342 3300048916 Bacteria 3971
369 Ga0496113_0967372 3300048916 Bacteria 671
370 Ga0496113_1072057 3300048916 Bacteria 633
371 Ga0496114_0423361 3300048917 Bacteria 1179
372 Ga0496115_0081270 3300048918 Bacteria 2639
373 Ga0496115_0473340 3300048918 Bacteria 1009
374 Ga0496115_0554237 3300048918 Bacteria 918
375 Ga0496126_1152541 3300048929 Bacteria 573
376 Ga0501290_109326 3300049513 Unclassified 500
377 Ga0501032_0105949 3300049569 Bacteria 1862
378 Ga0501032_0294079 3300049569 Bacteria 1050
379 Ga0501033_0070420 3300049570 Bacteria 2569
380 Ga0501033_0254600 3300049570 Bacteria 1243
381 Ga0501034_0087616 3300049571 Bacteria 3112
382 Ga0501034_0224977 3300049571 Bacteria 1827
383 Ga0501036_0186738 3300049572 Bacteria 1744
384 Ga0501036_0869843 3300049572 Bacteria 740
385 Ga0501037_0037243 3300049573 Bacteria 3585
386 Ga0501037_0229233 3300049573 Bacteria 1305
387 Ga0501038_0038127 3300049574 Bacteria 4209
388 Ga0501038_0060367 3300049574 Bacteria 3245
389 Ga0501039_0687748 3300049575 Bacteria 800
390 Ga0501043_0263892 3300049579 Bacteria 1323
391 Ga0501047_0159648 3300049581 Bacteria 2126
392 Ga0501047_0572574 3300049581 Bacteria 953
393 Ga0501048_0039094 3300049582 Bacteria 3404
394 Ga0501067_0622488 3300049583 Bacteria 606
395 Ga0501069_0006207 3300049585 Bacteria 6244
396 Ga0501070_0072330 3300049586 Bacteria 2854
397 Ga0501070_0122039 3300049586 Bacteria 2153
398 Ga0501070_0474049 3300049586 Bacteria 1007
399 Ga0501070_0548477 3300049586 Bacteria 926
400 Ga0501071_0513576 3300049587 Bacteria 919
401 Ga0501071_0653963 3300049587 Bacteria 809
402 Ga0501071_1322071 3300049587 Bacteria 557
403 Ga0501072_1134732 3300049588 Bacteria 608
404 Ga0501072_1305357 3300049588 Bacteria 562
405 Ga0501073_0035747 3300049589 Bacteria 3529
406 Ga0501073_0902304 3300049589 Unclassified 608
407 Ga0501074_0069597 3300049590 Bacteria 2530
408 Ga0501074_0375642 3300049590 Bacteria 1008
409 Ga0501074_0818143 3300049590 Unclassified 656
410 Ga0501076_1771300 3300049592 Unclassified 506
411 Ga0501077_0272090 3300049593 Bacteria 1078
412 Ga0501079_0824030 3300049741 Bacteria 731
413 Ga0501079_1029932 3300049741 Bacteria 648
414 Ga0501080_0075089 3300049742 Bacteria 3144
415 Ga0501080_0110534 3300049742 Bacteria 2547
416 Ga0501080_0326459 3300049742 Bacteria 1388
417 Ga0501080_1080758 3300049742 Bacteria 693
418 Ga0501081_0851663 3300049743 Bacteria 687
419 Ga0501083_0488999 3300049744 Bacteria 801
420 Ga0501083_0701879 3300049744 Bacteria 658
421 Ga0501035_0275000 3300049822 Bacteria 1424
422 Ga0501035_0839349 3300049822 Bacteria 731
423 Ga0501035_1244887 3300049822 Bacteria 576
424 Ga0501044_0086685 3300049823 Bacteria 3162
425 Ga0501044_0295723 3300049823 Bacteria 1549
426 Ga0501044_0695388 3300049823 Bacteria 902
427 Ga0501045_0143998 3300049824 Bacteria 1773
428 Ga0501045_0164703 3300049824 Bacteria 1651
429 nmdc:mga03683_25182_c1 3300050489 Bacteria 2335
430 nmdc:mga03683_662320_c1 3300050489 Bacteria 514
431 nmdc:mga00v17_171647_c1 3300050491 Bacteria 1398
432 nmdc:mga0yw44_312894_c1 3300050492 Bacteria 1054
433 nmdc:mga0yw44_396112_c1 3300050492 Bacteria 933
434 nmdc:mga0yw44_556171_c1 3300050492 Bacteria 779
435 nmdc:mga0yw44_73451_c1 3300050492 Bacteria 2128
436 nmdc:mga0k408_55865_c1 3300050493 Bacteria 2290
437 nmdc:mga06z11_250020_c1 3300050494 Bacteria 1044
438 nmdc:mga06z11_280159_c1 3300050494 Bacteria 988
439 nmdc:mga06z11_449811_c1 3300050494 Bacteria 778
440 nmdc:mga04h51_154272_c1 3300050495 Bacteria 880
441 nmdc:mga04h51_27774_c1 3300050495 Bacteria 1761
442 nmdc:mga07m45_133848_c2 3300050496 Bacteria 704
443 nmdc:mga05p37_1423108_c1 3300050507 Unclassified 696
444 nmdc:mga05p37_197743_c1 3300050507 Bacteria 2437
445 nmdc:mga05p37_368_c1 3300050507 Bacteria 48338
446 nmdc:mga05p37_62516_c1 3300050507 Bacteria 4582
447 nmdc:mga09592_145547_c1 3300050508 Bacteria 2043
448 nmdc:mga09592_32653_c1 3300050508 Bacteria 4340
449 nmdc:mga09592_766368_c1 3300050508 Bacteria 818
450 nmdc:mga0qj67_17035_c1 3300050509 Bacteria 5520
451 nmdc:mga0qj67_236882_c1 3300050509 Bacteria 1481
452 nmdc:mga06r32_318026_c1 3300050510 Bacteria 1542
453 nmdc:mga06r32_559990_c1 3300050510 Bacteria 1116
454 nmdc:mga06r32_721452_c1 3300050510 Bacteria 961
455 nmdc:mga06r32_931_c1 3300050510 Bacteria 26013
456 nmdc:mga08y16_107_c1 3300050511 Bacteria 69847
457 nmdc:mga08y16_176090_c1 3300050511 Bacteria 2221
458 nmdc:mga08y16_691886_c1 3300050511 Bacteria 1020
459 nmdc:mga08y16_970498_c1 3300050511 Bacteria 832
460 nmdc:mga0n895_107900_c1 3300050512 Bacteria 2798
461 nmdc:mga0n895_171015_c1 3300050512 Bacteria 2205
462 nmdc:mga0rr50_68855_c1 3300050513 Bacteria 2692
463 nmdc:mga0a205_397343_c1 3300050515 Bacteria 1242
464 nmdc:mga0sz30_262581_c1 3300050516 Archaea 769
465 Ga0495601_0051827 3300053077 Bacteria 2590
466 Ga0495612_0017045 3300053078 Bacteria 2910
467 Ga0495595_0005221 3300053084 Bacteria 5246
468 Ga0495619_0048165 3300053085 Bacteria 2808
469 Ga0495619_0055680 3300053085 Bacteria 2620
470 Ga0500641_0002474 3300053096 Bacteria 6527
471 Ga0500641_0080143 3300053096 Bacteria 1384
472 Ga0500642_0093683 3300053130 Bacteria 1391
473 Ga0500568_0072795 3300053139 Bacteria 1314
474 Ga0500604_0013773 3300053151 Bacteria 2195
475 Ga0500616_0012622 3300053153 Bacteria 4940
476 Ga0500616_0159343 3300053153 Bacteria 1036
477 Ga0501084_0060495 3300054114 Bacteria 3171
478 Ga0501084_0385667 3300054114 Bacteria 1184
479 Ga0501084_1145163 3300054114 Bacteria 653
480 Ga0501084_1303613 3300054114 Bacteria 609
481 Ga0501082_0225938 3300060353 Bacteria 1629
482 Ga0070685_11297874
483 JGI25406J46586_10017011
484 Ga0070658_10299026
485 Ga0070676_10032308
486 Ga0070683_100464425
487 Ga0070683_100592234
488 Ga0070690_100058387
489 Ga0070670_100246260
490 Ga0070677_10129816
491 Ga0068869_100040927
492 Ga0070666_10335111
493 Ga0070680_100011512
494 Ga0070689_100003207
495 Ga0070689_100152553
496 Ga0070689_100762554
497 Ga0070687_100019841
498 Ga0070692_10585692
499 Ga0070668_100303574
500 Ga0070668_101324871
501 Ga0070669_100197867
502 Ga0070669_100332165
503 Ga0070675_100037693
504 Ga0070675_101290103
505 Ga0070671_100053923
506 Ga0070671_100319103
507 Ga0070674_100119181
508 Ga0070673_100677143
509 Ga0070673_100738229
510 Ga0070688_100043298
511 Ga0070688_100492731
512 Ga0070659_100006049
513 Ga0070659_102090205
514 Ga0070667_100544121
515 Ga0070713_100511420
516 Ga0070713_101704200
517 Ga0070701_10711112
518 Ga0070700_100713839
519 Ga0070681_11030827
520 Ga0068867_100241679
521 Ga0068867_100389068
522 Ga0070685_10116918
523 Ga0070685_10557472
524 Ga0070679_100014493
525 Ga0070684_100093357
526 Ga0068853_100206823
527 Ga0070672_100416089
528 Ga0070686_100255919
529 Ga0070693_100882116
530 Ga0070665_100790936
531 Ga0070704_101068449
532 Ga0068856_100605064
533 Ga0068859_100027589
534 Ga0068859_100596523
535 Ga0068864_100022878
536 Ga0068864_100096194
537 Ga0068864_100310974
538 Ga0068866_10092575
539 Ga0068866_11325365
540 Ga0068863_100419021
541 Ga0068863_100458263
542 Ga0068863_102395459
543 Ga0068858_100969264
544 Ga0068858_101676440
545 Ga0068860_100167179
546 Ga0068860_101950714
547 Ga0068862_100185555
548 Ga0081455_10023650
549 Ga0081540_1000005
550 Ga0081540_1048129
551 Ga0081539_10000522
552 Ga0070717_10679769
553 Ga0075365_10542522
554 Ga0075365_10824470
555 Ga0075368_10089634
556 Ga0075368_10105314
557 Ga0075363_100209157
558 Ga0075364_10140838
559 Ga0075367_10401455
560 Ga0075367_10463439
561 Ga0097621_100051385
562 Ga0097621_100717132
563 Ga0075370_10135736
564 Ga0075370_10176011
565 Ga0075428_100011642
566 Ga0075428_100052192
567 Ga0075428_100398713
568 Ga0075430_100014318
569 Ga0075431_100000584
570 Ga0075431_100316387
571 Ga0075431_100800235
572 Ga0075433_10288101
573 Ga0075429_100384914
574 Ga0075429_100539466
575 Ga0068865_100375039
576 Ga0068865_100762859
577 Ga0097620_100027588
578 Ga0097620_100596556
579 Ga0075435_100402024
580 Ga0099795_10055431
581 Ga0105240_10185993
582 Ga0105240_10963909
583 Ga0111539_10000705
584 Ga0111539_10031016
585 Ga0111539_11260743
586 Ga0105245_10125657
587 Ga0105245_10193954
588 Ga0105247_10605457
589 Ga0114129_10000057
590 Ga0114129_10008061
591 Ga0114129_10239646
592 Ga0114129_10291675
593 Ga0114129_11524841
594 Ga0105243_10143303
595 Ga0105243_11695617
596 Ga0105241_11424866
597 Ga0105242_10051915
598 Ga0105248_10118877
599 Ga0105248_10636484
600 Ga0105237_10822893
601 Ga0105238_10046231
602 Ga0105238_10446620
603 Ga0105238_11271718
604 Ga0105249_10257842
605 Ga0105249_10278675
606 Ga0105249_10388897
607 Ga0105249_10894459
608 Ga0105033_108845
609 Ga0105239_10218097
610 Ga0105246_10119083
611 Ga0105246_10476080
612 Ga0157374_11636344
613 Ga0163162_12816092
614 Ga0163163_10052308
615 Ga0163163_11142891
616 Ga0182008_10304711
617 Ga0157379_10068567
618 Ga0157376_10479388
619 Ga0182007_10057103
620 Ga0213876_10065311
621 Ga0207697_10187862
622 Ga0207682_10161122
623 Ga0207642_10584438
624 Ga0207710_10044175
625 Ga0207710_10303447
626 Ga0207680_10291159
627 Ga0207645_10011751
628 Ga0207645_10648946
629 Ga0207705_10191543
630 Ga0207707_10093259
631 Ga0207671_10173385
632 Ga0207662_10008746
633 Ga0207662_10123210
634 Ga0207652_10478828
635 Ga0207681_10130499
636 Ga0207681_11387494
637 Ga0207694_10061282
638 Ga0207694_11158209
639 Ga0207650_10001900
640 Ga0207650_10502652
641 Ga0207659_10541639
642 Ga0207659_10918402
643 Ga0207659_11042235
644 Ga0207687_10101478
645 Ga0207644_10213400
646 Ga0207644_10392319
647 Ga0207644_10573511
648 Ga0207686_10065635
649 Ga0207709_10068932
650 Ga0207670_10002069
651 Ga0207670_10118427
652 Ga0207670_10325258
653 Ga0207670_10552411
654 Ga0207669_10011675
655 Ga0207704_10030922
656 Ga0207704_10059785
657 Ga0207704_10849020
658 Ga0207711_10064141
659 Ga0207689_10013411
660 Ga0207661_10050399
661 Ga0207651_10115709
662 Ga0207651_10875710
663 Ga0207651_11694576
664 Ga0207712_10175200
665 Ga0207712_10967961
666 Ga0207712_11147802
667 Ga0207668_10196448
668 Ga0207668_11428133
669 Ga0207658_10502273
670 Ga0207677_10438516
671 Ga0207677_11967813
672 Ga0207677_12190910
673 Ga0207703_10127696
674 Ga0207639_10156431
675 Ga0207639_10172569
676 Ga0207639_11026822
677 Ga0207708_10035554
678 Ga0207702_10088255
679 Ga0207641_10293189
680 Ga0207641_10447791
681 Ga0207648_10010490
682 Ga0207648_10177835
683 Ga0207676_10011519
684 Ga0207676_10024304
685 Ga0207676_10375471
686 Ga0207675_100472478
687 Ga0207683_10030131
688 Ga0209813_10042626
689 Ga0207428_10095323
690 Ga0207428_10437884
691 Ga0268266_10768667
692 Ga0268266_10840990
693 Ga0268265_10501217
694 Ga0268265_10617477
695 Ga0268264_10286029
696 Ga0265325_10148449
697 Ga0265325_10148887
698 Ga0265325_10428267
699 Ga0265331_10084751
700 Ga0265331_10372927
701 Ga0307408_100589889
702 Ga0307409_101227247
703 Ga0373930_0089953
704 Ga0373930_0123591
705 Ga0373948_0014220
706 Ga0373929_0002299
707 Ga0373929_0122813
708 Ga0373940_0080110
709 Ga0373940_0284158
710 Ga0373944_0015622
711 Ga0373944_0175861
712 Ga0373951_0014166
713 Ga0373952_0015860
714 Ga0373952_0042671
715 Ga0373923_0027733
716 Ga0373932_0332010
717 Ga0373936_0010842
718 Ga0373936_0139560
719 Ga0373939_0035993
720 Ga0373957_0486481
721 Ga0373960_0011908
722 Ga0373960_0090088
723 Ga0373943_0101161
724 Ga0373943_0148921
725 Ga0373946_0010305
726 Ga0373946_0100683
727 Ga0373955_0077850
728 Ga0373955_0139084
729 Ga0373942_0080903
730 Ga0373961_0126326
731 Ga0373924_0097547
732 Ga0373931_0000511
733 Ga0373931_0015492
734 Ga0373931_0016734
735 Ga0373931_0818920
736 Ga0373935_0082488
737 Ga0373935_0084764
738 Ga0373935_0229796
739 Ga0373927_0011865
740 Ga0373927_0091070
741 Ga0373927_0307630
742 Ga0373927_0545695
743 Ga0373947_0007784
744 Ga0373947_0117975
745 Ga0373937_0200055
746 Ga0373925_0180075
747 Ga0373925_0207198
748 Ga0373925_0732115
749 Ga0373925_0878248
750 Ga0395900_0249292
751 Ga0395898_1737752
752 Ga0395905_1437081
753 Ga0436364_0088676
754 Ga0436365_0739073
755 Ga0436365_1110589
756 Ga0436365_1264108
757 Ga0436363_0357360
758 Ga0436362_0175594
759 Ga0439456_015243
760 Ga0439446_0201154
761 Ga0451577_0034458
762 Ga0453684_0073423
763 Ga0466971_0560740
764 Ga0466957_0748821
765 Ga0451576_2185883
766 Ga0466967_0833834
767 Ga0495592_0008058
768 Ga0495603_0021396
769 Ga0495629_0534079
770 Ga0495641_0022906
771 Ga0495651_0372377
772 Ga0495580_0029691
773 Ga0495605_0160445
774 Ga0495639_0052657
775 Ga0495662_0224691
776 Ga0495664_0548567
777 Ga0495584_0001682
778 Ga0495584_0134012
779 Ga0495585_0100046
780 Ga0495594_0008985
781 Ga0495616_0142703
782 Ga0495628_0065514
783 Ga0495630_0231652
784 Ga0495631_0087316
785 Ga0495663_0156111
786 Ga0495666_0010639
787 Ga0495654_0175056
788 Ga0495665_0027838
789 Ga0495586_0251074
790 Ga0495586_0315287
791 Ga0495598_0000505
792 Ga0495598_0329563
793 Ga0495621_0005180
794 Ga0495633_0033355
795 Ga0495667_0602697
796 Ga0495656_0003130
797 Ga0495588_0021647
798 Ga0495599_0249376
799 Ga0495646_0181757
800 Ga0495647_0621492
801 Ga0495658_0016835
802 Ga0495669_0020062
803 Ga0495624_0017034
804 Ga0495670_0054527
805 Ga0495671_0421725
806 Ga0495649_0254281
807 Ga0495600_0228433
808 Ga0495581_0054215
809 Ga0495581_0210301
810 Ga0495581_0351298
811 Ga0495604_0102086
812 Ga0495674_0281595
813 Ga0495676_0101327
814 Ga0495676_0408739
815 Ga0495677_0280994
816 Ga0495686_0517926
817 Ga0495614_0120409
818 Ga0495614_0198214
819 Ga0496100_0006463
820 Ga0496100_0013434
821 Ga0496100_0097269
822 Ga0496101_0015563
823 Ga0496101_0710402
824 Ga0496102_0010899
825 Ga0496102_0195807
826 Ga0496103_0171302
827 Ga0496104_0001225
828 Ga0496104_0018088
829 Ga0496105_0000637
830 Ga0496105_0001797
831 Ga0496106_0021561
832 Ga0496106_0048898
833 Ga0496107_0046749
834 Ga0496108_0000745
835 Ga0496108_0084078
836 Ga0496109_0008952
837 Ga0496109_0017791
838 Ga0496110_0008410
839 Ga0496110_0026203
840 Ga0496110_0165456
841 Ga0496110_0908327
842 Ga0496111_0000254
843 Ga0496111_0012993
844 Ga0496112_0002996
845 Ga0496112_0021077
846 Ga0496112_0073768
847 Ga0496112_1183536
848 Ga0496113_0000209
849 Ga0496113_0029342
850 Ga0496113_0967372
851 Ga0496113_1072057
852 Ga0496114_0423361
853 Ga0496115_0081270
854 Ga0496115_0473340
855 Ga0496115_0554237
856 Ga0496126_1152541
857 Ga0501290_109326
858 Ga0501032_0105949
859 Ga0501032_0294079
860 Ga0501033_0070420
861 Ga0501033_0254600
862 Ga0501034_0087616
863 Ga0501034_0224977
864 Ga0501036_0186738
865 Ga0501036_0869843
866 Ga0501037_0037243
867 Ga0501037_0229233
868 Ga0501038_0038127
869 Ga0501038_0060367
870 Ga0501039_0687748
871 Ga0501043_0263892
872 Ga0501047_0159648
873 Ga0501047_0572574
874 Ga0501048_0039094
875 Ga0501067_0622488
876 Ga0501069_0006207
877 Ga0501070_0072330
878 Ga0501070_0122039
879 Ga0501070_0474049
880 Ga0501070_0548477
881 Ga0501071_0513576
882 Ga0501071_0653963
883 Ga0501071_1322071
884 Ga0501072_1134732
885 Ga0501072_1305357
886 Ga0501073_0035747
887 Ga0501073_0902304
888 Ga0501074_0069597
889 Ga0501074_0375642
890 Ga0501074_0818143
891 Ga0501076_1771300
892 Ga0501077_0272090
893 Ga0501079_0824030
894 Ga0501079_1029932
895 Ga0501080_0075089
896 Ga0501080_0110534
897 Ga0501080_0326459
898 Ga0501080_1080758
899 Ga0501081_0851663
900 Ga0501083_0488999
901 Ga0501083_0701879
902 Ga0501035_0275000
903 Ga0501035_0839349
904 Ga0501035_1244887
905 Ga0501044_0086685
906 Ga0501044_0295723
907 Ga0501044_0695388
908 Ga0501045_0143998
909 Ga0501045_0164703
910 nmdc:mga03683_25182_c1
911 nmdc:mga03683_662320_c1
912 nmdc:mga00v17_171647_c1
913 nmdc:mga0yw44_312894_c1
914 nmdc:mga0yw44_396112_c1
915 nmdc:mga0yw44_556171_c1
916 nmdc:mga0yw44_73451_c1
917 nmdc:mga0k408_55865_c1
918 nmdc:mga06z11_250020_c1
919 nmdc:mga06z11_280159_c1
920 nmdc:mga06z11_449811_c1
921 nmdc:mga04h51_154272_c1
922 nmdc:mga04h51_27774_c1
923 nmdc:mga07m45_133848_c2
924 nmdc:mga05p37_1423108_c1
925 nmdc:mga05p37_197743_c1
926 nmdc:mga05p37_368_c1
927 nmdc:mga05p37_62516_c1
928 nmdc:mga09592_145547_c1
929 nmdc:mga09592_32653_c1
930 nmdc:mga09592_766368_c1
931 nmdc:mga0qj67_17035_c1
932 nmdc:mga0qj67_236882_c1
933 nmdc:mga06r32_318026_c1
934 nmdc:mga06r32_559990_c1
935 nmdc:mga06r32_721452_c1
936 nmdc:mga06r32_931_c1
937 nmdc:mga08y16_107_c1
938 nmdc:mga08y16_176090_c1
939 nmdc:mga08y16_691886_c1
940 nmdc:mga08y16_970498_c1
941 nmdc:mga0n895_107900_c1
942 nmdc:mga0n895_171015_c1
943 nmdc:mga0rr50_68855_c1
944 nmdc:mga0a205_397343_c1
945 nmdc:mga0sz30_262581_c1
946 Ga0495601_0051827
947 Ga0495612_0017045
948 Ga0495595_0005221
949 Ga0495619_0048165
950 Ga0495619_0055680
951 Ga0500641_0002474
952 Ga0500641_0080143
953 Ga0500642_0093683
954 Ga0500568_0072795
955 Ga0500604_0013773
956 Ga0500616_0012622
957 Ga0500616_0159343
958 Ga0501084_0060495
959 Ga0501084_0385667
960 Ga0501084_1145163
961 Ga0501084_1303613
962 Ga0501082_0225938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

23

70

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9451 3 44
7pic-assembly1.cif.gz_C 70s ribosome with p/e-site trna in spectinomycin-treated mycoplasma pneumoniae cells 0.9421 3 51
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9388 3 51
8bh6-assembly1.cif.gz_d mature 30s ribosomal subunit from staphylococcus aureus 0.9382 3 51
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9379 3 51
ID Description Score Start End Superfamily
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9587 3 50 3.10.290.10
af_Q25804_3_135_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.9536 3 48 1.10.1050.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9421 3 45 3.10.290.10
af_C6TBL4_107_182_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9383 3 45 3.10.290.10
af_Q2FY78_1_58_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9349 1 50 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A832NJC5-F1-model_v4 RNA-binding protein 0.9841 1 81 GO:0003723
AF-A0A840IDL3-F1-model_v4 Ribosome-associated heat shock protein Hsp15 0.9779 1 81 GO:0003677
GO:0003727
GO:0034605
GO:0043023
AF-A0A369ADQ3-F1-model_v4 Ribosomal 50S subunit-recycling heat shock protein 0.9758 1 81 GO:0003723
AF-A0A1M5DR10-F1-model_v4 Ribosome-associated heat shock protein Hsp15 0.9757 1 81 GO:0003723
AF-A0A1Y5EZF8-F1-model_v4 Heat shock protein 15 0.9745 2 81 GO:0003677
GO:0003727
GO:0034605
GO:0043023

Map