F452357

General Info

Members Datasets Scaffolds Average Seq Length
481 177 962 280

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100434643|Ga0070660_1004346431
Length 317
Sequence VETRSNYVLVGAVTVALLAGVLLFIVWLAGLSNKQTKCYDIYFAEGVGGLNKGSNVTFSGVPVGQVSKISLLPNRPEFVWVRIDVEQQTPVLQGTSAQIHGVGFTGVSEIQLTGAERGRPPIQQMGPQGCPVIPATSGGISALLNSAPELIDRIQRLTERLTELLSDKNQNSIADILENIDATTAELRKRAPEMGQTIADIQVAAHNAGLAANNVAALSANANNLVSEQGRPAVENLNKAIVSAQHAADSLDSMITDARPGVQNFSKETLPEANKLVHDLRTLSQSLKSVSDRVNQQGIGGALGPEKLPDYKPGKRK

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.74
Rhizosphere 96.05
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100434643 3300005339 Bacteria 1087
2 JGI24741J21665_1013799 3300001915 Bacteria 1363
3 JGI24752J21851_1001253 3300001976 Bacteria 3446
4 JGI24747J21853_1003083 3300001978 Bacteria 1420
5 JGI24740J21852_10010008 3300001979 Bacteria 3675
6 JGI24740J21852_10016166 3300001979 Bacteria 2702
7 JGI24739J22299_10051650 3300001989 Bacteria 1325
8 JGI24737J22298_10010896 3300001990 Bacteria 2986
9 JGI24737J22298_10046289 3300001990 Bacteria 1327
10 JGI24735J21928_10006760 3300002067 Bacteria 3762
11 JGI24735J21928_10007577 3300002067 Bacteria 3538
12 JGI24735J21928_10016209 3300002067 Bacteria 2317
13 JGI24744J21845_10004448 3300002077 Bacteria 2897
14 rootH1_10121081 3300003323 Bacteria 1538
15 Ga0065712_10128238 3300005290 Bacteria 1581
16 Ga0070658_10002137 3300005327 Bacteria 16586
17 Ga0070658_10025263 3300005327 Bacteria 4762
18 Ga0070658_10028086 3300005327 Bacteria 4516
19 Ga0070658_10047899 3300005327 Bacteria 3460
20 Ga0070658_10087915 3300005327 Bacteria 2558
21 Ga0070658_10239880 3300005327 Bacteria 1536
22 Ga0070683_100074417 3300005329 Bacteria 3172
23 Ga0070683_100466474 3300005329 Bacteria 1205
24 Ga0070670_100011571 3300005331 Bacteria 7542
25 Ga0070670_100022626 3300005331 Bacteria 5409
26 Ga0070670_100026048 3300005331 Bacteria 5033
27 Ga0070677_10004203 3300005333 Bacteria 4688
28 Ga0068869_100046933 3300005334 Bacteria 3117
29 Ga0070680_100125406 3300005336 Bacteria 2145
30 Ga0070680_100247008 3300005336 Bacteria 1508
31 Ga0068868_100288321 3300005338 Bacteria 1391
32 Ga0070660_100002146 3300005339 Bacteria 13612
33 Ga0070660_100002601 3300005339 Bacteria 12391
34 Ga0070660_100003603 3300005339 Bacteria 10695
35 Ga0070660_100057186 3300005339 Bacteria 3020
36 Ga0070660_100075998 3300005339 Bacteria 2630
37 Ga0070660_100078459 3300005339 Bacteria 2589
38 Ga0070660_100090352 3300005339 Bacteria 2414
39 Ga0070660_100237851 3300005339 Bacteria 1483
40 Ga0070660_100315461 3300005339 Bacteria 1283
41 Ga0070660_100331362 3300005339 Bacteria 1251
42 Ga0070661_100008356 3300005344 Bacteria 7151
43 Ga0070661_100011812 3300005344 Bacteria 6094
44 Ga0070661_100016769 3300005344 Bacteria 5186
45 Ga0070661_100036170 3300005344 Bacteria 3590
46 Ga0070661_100060817 3300005344 Bacteria 2771
47 Ga0070661_100090404 3300005344 Bacteria 2267
48 Ga0070661_100119002 3300005344 Bacteria 1977
49 Ga0070692_10027988 3300005345 Bacteria 2798
50 Ga0070669_100120813 3300005353 Bacteria 1999
51 Ga0070669_100152948 3300005353 Bacteria 1787
52 Ga0070675_100060697 3300005354 Bacteria 3122
53 Ga0070671_100013121 3300005355 Bacteria 6676
54 Ga0070671_100013158 3300005355 Bacteria 6666
55 Ga0070671_100015297 3300005355 Bacteria 6196
56 Ga0070671_100042910 3300005355 Bacteria 3761
57 Ga0070674_100007979 3300005356 Bacteria 6271
58 Ga0070673_100001976 3300005364 Bacteria 12373
59 Ga0070673_100057001 3300005364 Bacteria 3085
60 Ga0070673_100085769 3300005364 Bacteria 2564
61 Ga0070673_100210020 3300005364 Bacteria 1681
62 Ga0070673_100225910 3300005364 Bacteria 1622
63 Ga0070659_100009282 3300005366 Bacteria 7221
64 Ga0070659_100030524 3300005366 Bacteria 4171
65 Ga0070659_100038805 3300005366 Bacteria 3716
66 Ga0070659_100078024 3300005366 Bacteria 2642
67 Ga0070659_100125351 3300005366 Bacteria 2083
68 Ga0070667_100003379 3300005367 Bacteria 13608
69 Ga0070714_100011244 3300005435 Bacteria 7095
70 Ga0070714_100013652 3300005435 Bacteria 6514
71 Ga0070713_100144299 3300005436 Bacteria 2111
72 Ga0070663_100010459 3300005455 Bacteria 5783
73 Ga0070663_100031489 3300005455 Bacteria 3645
74 Ga0070663_100111864 3300005455 Bacteria 2053
75 Ga0070663_100136039 3300005455 Bacteria 1871
76 Ga0070678_100003312 3300005456 Bacteria 8958
77 Ga0070678_100161185 3300005456 Bacteria 1817
78 Ga0070662_100002904 3300005457 Bacteria 10646
79 Ga0070662_100124044 3300005457 Bacteria 1983
80 Ga0070662_100129698 3300005457 Bacteria 1942
81 Ga0070662_100161921 3300005457 Bacteria 1750
82 Ga0070662_100268045 3300005457 Bacteria 1378
83 Ga0070681_10010100 3300005458 Bacteria 9304
84 Ga0070681_10052123 3300005458 Bacteria 4081
85 Ga0070681_10068235 3300005458 Bacteria 3523
86 Ga0070681_10162962 3300005458 Bacteria 2153
87 Ga0070679_100003137 3300005530 Bacteria 15111
88 Ga0070679_100031455 3300005530 Bacteria 5242
89 Ga0070684_100025486 3300005535 Bacteria 4972
90 Ga0070684_100177875 3300005535 Bacteria 1934
91 Ga0070684_100179286 3300005535 Bacteria 1926
92 Ga0068853_100004420 3300005539 Bacteria 10879
93 Ga0068853_100038272 3300005539 Bacteria 4084
94 Ga0068853_100051371 3300005539 Bacteria 3548
95 Ga0068853_100242684 3300005539 Bacteria 1652
96 Ga0068853_100589208 3300005539 Bacteria 1055
97 Ga0070672_100009303 3300005543 Bacteria 6769
98 Ga0070672_100016988 3300005543 Bacteria 5224
99 Ga0070672_100093639 3300005543 Bacteria 2428
100 Ga0070693_100203586 3300005547 Bacteria 1287
101 Ga0070665_100016522 3300005548 Bacteria 7400
102 Ga0070665_100019407 3300005548 Bacteria 6821
103 Ga0068855_100000129 3300005563 Bacteria 96519
104 Ga0068855_100016513 3300005563 Bacteria 8879
105 Ga0070664_100001759 3300005564 Bacteria 17347
106 Ga0070664_100010225 3300005564 Bacteria 7609
107 Ga0070664_100025995 3300005564 Bacteria 4853
108 Ga0070664_100273271 3300005564 Bacteria 1523
109 Ga0070664_100291766 3300005564 Bacteria 1473
110 Ga0068857_100002668 3300005577 Bacteria 14647
111 Ga0068857_100011067 3300005577 Bacteria 7849
112 Ga0068856_100012339 3300005614 Bacteria 8275
113 Ga0068856_100020442 3300005614 Bacteria 6430
114 Ga0068856_100093908 3300005614 Bacteria 2986
115 Ga0068856_100140799 3300005614 Bacteria 2419
116 Ga0068856_100166084 3300005614 Bacteria 2218
117 Ga0068856_100270432 3300005614 Bacteria 1715
118 Ga0068856_100405738 3300005614 Bacteria 1382
119 Ga0068852_100003803 3300005616 Bacteria 10592
120 Ga0068852_100038033 3300005616 Bacteria 4041
121 Ga0068852_100069753 3300005616 Bacteria 3082
122 Ga0068852_100076279 3300005616 Bacteria 2959
123 Ga0068852_100115855 3300005616 Bacteria 2444
124 Ga0068852_100200825 3300005616 Bacteria 1887
125 Ga0068852_100403675 3300005616 Bacteria 1345
126 Ga0068852_100457420 3300005616 Bacteria 1265
127 Ga0068859_100025420 3300005617 Bacteria 5940
128 Ga0068859_100078362 3300005617 Bacteria 3344
129 Ga0068864_100009730 3300005618 Bacteria 7930
130 Ga0068864_100275704 3300005618 Bacteria 1568
131 Ga0068866_10017648 3300005718 Bacteria 3213
132 Ga0068863_100004897 3300005841 Bacteria 13196
133 Ga0068863_100023470 3300005841 Bacteria 5889
134 Ga0068858_100015928 3300005842 Bacteria 7064
135 Ga0068858_100032403 3300005842 Bacteria 4853
136 Ga0068862_100313993 3300005844 Bacteria 1445
137 Ga0081539_10013266 3300005985 Bacteria 6224
138 Ga0070717_10217086 3300006028 Bacteria 1680
139 Ga0097621_100014636 3300006237 Bacteria 5878
140 Ga0068871_100069204 3300006358 Bacteria 2898
141 Ga0068871_100091859 3300006358 Bacteria 2531
142 Ga0097620_100025420 3300006931 Bacteria 5940
143 Ga0097620_100078360 3300006931 Bacteria 3344
144 Ga0105240_10362909 3300009093 Bacteria 1640
145 Ga0105240_10401167 3300009093 Bacteria 1544
146 Ga0105245_10033757 3300009098 Bacteria 4535
147 Ga0105241_10442377 3300009174 Bacteria 1148
148 Ga0105242_10162497 3300009176 Bacteria 1956
149 Ga0105248_10056571 3300009177 Bacteria 4401
150 Ga0105248_10168841 3300009177 Bacteria 2466
151 Ga0105248_10186957 3300009177 Bacteria 2334
152 Ga0105248_10694219 3300009177 Bacteria 1148
153 Ga0105237_10008647 3300009545 Bacteria 11002
154 Ga0105237_10173206 3300009545 Bacteria 2158
155 Ga0105238_10124974 3300009551 Bacteria 2552
156 Ga0105246_10304854 3300011119 Bacteria 1288
157 Ga0157373_10028064 3300013100 Bacteria 4061
158 Ga0157373_10045987 3300013100 Bacteria 3115
159 Ga0157373_10086361 3300013100 Bacteria 2211
160 Ga0157373_10118728 3300013100 Bacteria 1859
161 Ga0157373_10156281 3300013100 Bacteria 1604
162 Ga0157371_10000854 3300013102 Bacteria 34812
163 Ga0157371_10035115 3300013102 Bacteria 3594
164 Ga0157371_10133035 3300013102 Bacteria 1770
165 Ga0157371_10181817 3300013102 Bacteria 1504
166 Ga0157370_10021120 3300013104 Bacteria 6492
167 Ga0157370_10033682 3300013104 Bacteria 4994
168 Ga0157370_10088060 3300013104 Bacteria 2916
169 Ga0157370_10220702 3300013104 Bacteria 1756
170 Ga0157369_10013742 3300013105 Bacteria 9150
171 Ga0157369_10067599 3300013105 Bacteria 3841
172 Ga0157369_10087853 3300013105 Bacteria 3319
173 Ga0157369_10162072 3300013105 Bacteria 2360
174 Ga0157369_10162276 3300013105 Bacteria 2359
175 Ga0157369_10491014 3300013105 Bacteria 1270
176 Ga0157374_10007195 3300013296 Bacteria 9478
177 Ga0157374_10224714 3300013296 Bacteria 1843
178 Ga0157378_10020021 3300013297 Bacteria 5883
179 Ga0157378_10206770 3300013297 Bacteria 1859
180 Ga0163162_10011448 3300013306 Bacteria 8650
181 Ga0163162_10018565 3300013306 Bacteria 6815
182 Ga0163162_10114073 3300013306 Bacteria 2801
183 Ga0157372_10004983 3300013307 Bacteria 14110
184 Ga0157372_10201756 3300013307 Bacteria 2304
185 Ga0157372_10285812 3300013307 Bacteria 1918
186 Ga0157372_10378831 3300013307 Bacteria 1649
187 Ga0157375_10017101 3300013308 Bacteria 6536
188 Ga0157375_10019577 3300013308 Bacteria 6160
189 Ga0157375_10109013 3300013308 Bacteria 2864
190 Ga0163163_10041991 3300014325 Bacteria 4476
191 Ga0163163_10257915 3300014325 Bacteria 1794
192 Ga0182008_10050463 3300014497 Bacteria 2065
193 Ga0157379_10007253 3300014968 Bacteria 9592
194 Ga0163161_10003835 3300017792 Bacteria 10539
195 Ga0207697_10007047 3300025315 Bacteria 5034
196 Ga0207656_10047682 3300025321 Bacteria 1843
197 Ga0207656_10065674 3300025321 Bacteria 1602
198 Ga0207682_10004479 3300025893 Bacteria 5829
199 Ga0207642_10015035 3300025899 Bacteria 2874
200 Ga0207647_10025560 3300025904 Bacteria 3877
201 Ga0207647_10027097 3300025904 Bacteria 3740
202 Ga0207647_10064343 3300025904 Bacteria 2229
203 Ga0207647_10080527 3300025904 Bacteria 1953
204 Ga0207705_10000382 3300025909 Bacteria 39603
205 Ga0207705_10003386 3300025909 Bacteria 12126
206 Ga0207705_10003556 3300025909 Bacteria 11863
207 Ga0207705_10031628 3300025909 Bacteria 3779
208 Ga0207705_10040421 3300025909 Bacteria 3345
209 Ga0207705_10054358 3300025909 Bacteria 2886
210 Ga0207705_10207329 3300025909 Bacteria 1486
211 Ga0207654_10315442 3300025911 Bacteria 1067
212 Ga0207707_10051525 3300025912 Bacteria 3584
213 Ga0207707_10149982 3300025912 Bacteria 2039
214 Ga0207707_10227574 3300025912 Bacteria 1623
215 Ga0207671_10181320 3300025914 Bacteria 1639
216 Ga0207671_10212654 3300025914 Bacteria 1513
217 Ga0207660_10120238 3300025917 Bacteria 1988
218 Ga0207660_10238043 3300025917 Bacteria 1433
219 Ga0207657_10002591 3300025919 Bacteria 19567
220 Ga0207657_10003263 3300025919 Bacteria 17364
221 Ga0207657_10005871 3300025919 Bacteria 12790
222 Ga0207657_10006604 3300025919 Bacteria 12008
223 Ga0207657_10008396 3300025919 Bacteria 10484
224 Ga0207657_10015366 3300025919 Bacteria 7419
225 Ga0207657_10025260 3300025919 Bacteria 5481
226 Ga0207657_10061393 3300025919 Bacteria 3223
227 Ga0207657_10153905 3300025919 Bacteria 1871
228 Ga0207657_10236122 3300025919 Bacteria 1461
229 Ga0207657_10314406 3300025919 Bacteria 1239
230 Ga0207649_10007570 3300025920 Bacteria 5904
231 Ga0207649_10022738 3300025920 Bacteria 3623
232 Ga0207649_10033637 3300025920 Bacteria 3065
233 Ga0207649_10071988 3300025920 Bacteria 2210
234 Ga0207649_10127226 3300025920 Bacteria 1726
235 Ga0207649_10132202 3300025920 Bacteria 1697
236 Ga0207652_10007945 3300025921 Bacteria 8514
237 Ga0207652_10020800 3300025921 Bacteria 5408
238 Ga0207681_10009410 3300025923 Bacteria 5970
239 Ga0207681_10181319 3300025923 Unclassified 1604
240 Ga0207694_10000857 3300025924 Bacteria 27073
241 Ga0207650_10015870 3300025925 Bacteria 5255
242 Ga0207650_10119549 3300025925 Bacteria 2049
243 Ga0207659_10059498 3300025926 Bacteria 2747
244 Ga0207687_10115967 3300025927 Bacteria 1996
245 Ga0207700_10093709 3300025928 Bacteria 2377
246 Ga0207664_10104550 3300025929 Bacteria 2345
247 Ga0207644_10049321 3300025931 Bacteria 3013
248 Ga0207644_10053272 3300025931 Bacteria 2911
249 Ga0207644_10059096 3300025931 Bacteria 2772
250 Ga0207644_10067867 3300025931 Bacteria 2600
251 Ga0207690_10029584 3300025932 Bacteria 3485
252 Ga0207690_10029744 3300025932 Bacteria 3476
253 Ga0207690_10049323 3300025932 Bacteria 2806
254 Ga0207690_10106273 3300025932 Bacteria 2014
255 Ga0207690_10187201 3300025932 Bacteria 1563
256 Ga0207706_10061189 3300025933 Bacteria 3316
257 Ga0207706_10203196 3300025933 Bacteria 1738
258 Ga0207686_10051844 3300025934 Bacteria 2558
259 Ga0207670_10342634 3300025936 Bacteria 1182
260 Ga0207669_10010293 3300025937 Bacteria 4498
261 Ga0207704_10029360 3300025938 Bacteria 3065
262 Ga0207691_10019074 3300025940 Bacteria 6494
263 Ga0207691_10030576 3300025940 Bacteria 5031
264 Ga0207691_10037938 3300025940 Bacteria 4460
265 Ga0207691_10075164 3300025940 Bacteria 3046
266 Ga0207691_10081893 3300025940 Bacteria 2900
267 Ga0207711_10012637 3300025941 Bacteria 7012
268 Ga0207711_10041529 3300025941 Bacteria 3917
269 Ga0207661_10085233 3300025944 Bacteria 2618
270 Ga0207679_10033084 3300025945 Bacteria 3636
271 Ga0207679_10061390 3300025945 Bacteria 2798
272 Ga0207679_10187404 3300025945 Bacteria 1717
273 Ga0207679_10263795 3300025945 Bacteria 1470
274 Ga0207667_10000303 3300025949 Bacteria 68209
275 Ga0207667_10019988 3300025949 Bacteria 7459
276 Ga0207667_10075429 3300025949 Bacteria 3502
277 Ga0207667_10326236 3300025949 Bacteria 1567
278 Ga0207668_10217523 3300025972 Bacteria 1532
279 Ga0207640_10123060 3300025981 Bacteria 1862
280 Ga0207658_10040090 3300025986 Bacteria 3383
281 Ga0207658_10090883 3300025986 Bacteria 2367
282 Ga0207658_10096461 3300025986 Bacteria 2306
283 Ga0207677_10193296 3300026023 Bacteria 1611
284 Ga0207703_10034324 3300026035 Bacteria 4025
285 Ga0207639_10000334 3300026041 Bacteria 32648
286 Ga0207639_10054272 3300026041 Bacteria 3062
287 Ga0207639_10106763 3300026041 Bacteria 2273
288 Ga0207639_10132808 3300026041 Bacteria 2063
289 Ga0207639_10225131 3300026041 Bacteria 1622
290 Ga0207678_10002136 3300026067 Bacteria 17908
291 Ga0207678_10071716 3300026067 Bacteria 2970
292 Ga0207678_10121045 3300026067 Bacteria 2233
293 Ga0207678_10320733 3300026067 Bacteria 1333
294 Ga0207702_10179754 3300026078 Bacteria 1947
295 Ga0207702_10184780 3300026078 Bacteria 1922
296 Ga0207702_10194293 3300026078 Bacteria 1877
297 Ga0207702_10518241 3300026078 Bacteria 1164
298 Ga0207641_10039687 3300026088 Bacteria 3938
299 Ga0207641_10398424 3300026088 Bacteria 1321
300 Ga0207648_10024810 3300026089 Bacteria 5348
301 Ga0207676_10007122 3300026095 Bacteria 7922
302 Ga0207676_10024936 3300026095 Bacteria 4433
303 Ga0207674_10002210 3300026116 Bacteria 24650
304 Ga0207674_10007233 3300026116 Bacteria 12953
305 Ga0207674_10050863 3300026116 Bacteria 4231
306 Ga0207674_10074478 3300026116 Bacteria 3407
307 Ga0207674_10103531 3300026116 Bacteria 2826
308 Ga0207683_10002807 3300026121 Bacteria 15211
309 Ga0207683_10033576 3300026121 Bacteria 4457
310 Ga0207698_10003192 3300026142 Bacteria 9840
311 Ga0207698_10003498 3300026142 Bacteria 9469
312 Ga0207698_10007468 3300026142 Bacteria 6847
313 Ga0207698_10016163 3300026142 Bacteria 5022
314 Ga0207698_10049971 3300026142 Bacteria 3187
315 Ga0207698_10079232 3300026142 Bacteria 2641
316 Ga0207698_10095050 3300026142 Bacteria 2452
317 Ga0207698_10227777 3300026142 Bacteria 1690
318 Ga0207698_10342385 3300026142 Bacteria 1409
319 Ga0207698_10477905 3300026142 Unclassified 1208
320 Ga0209974_10003208 3300027876 Bacteria 5914
321 Ga0268265_10269519 3300028380 Bacteria 1518
322 Ga0268264_10393217 3300028381 Bacteria 1330
323 Ga0268264_10478655 3300028381 Bacteria 1211
324 Ga0316183_1027745 3300030742 Bacteria 1547
325 Ga0307408_100041185 3300031548 Bacteria 3274
326 Ga0307408_100303047 3300031548 Bacteria 1339
327 Ga0307405_10012299 3300031731 Bacteria 4523
328 Ga0307405_10081318 3300031731 Bacteria 2117
329 Ga0307405_10087462 3300031731 Bacteria 2054
330 Ga0307413_10203645 3300031824 Bacteria 1431
331 Ga0307413_10219664 3300031824 Bacteria 1387
332 Ga0307410_10016762 3300031852 Bacteria 4380
333 Ga0307410_10100128 3300031852 Bacteria 2075
334 Ga0307410_10400189 3300031852 Bacteria 1109
335 Ga0307406_10163002 3300031901 Bacteria 1605
336 Ga0307407_10073357 3300031903 Bacteria 2044
337 Ga0307412_10018592 3300031911 Bacteria 4186
338 Ga0307412_10179013 3300031911 Bacteria 1593
339 Ga0307412_10198037 3300031911 Bacteria 1523
340 Ga0307412_10226024 3300031911 Bacteria 1438
341 Ga0307409_100001518 3300031995 Bacteria 11491
342 Ga0307409_100080152 3300031995 Bacteria 2633
343 Ga0307409_100090514 3300031995 Bacteria 2505
344 Ga0307409_100131376 3300031995 Bacteria 2140
345 Ga0307416_100420481 3300032002 Bacteria 1380
346 Ga0307414_10010066 3300032004 Bacteria 5464
347 Ga0307414_10261563 3300032004 Bacteria 1444
348 Ga0307414_10491699 3300032004 Bacteria 1084
349 Ga0307411_10030946 3300032005 Bacteria 3287
350 Ga0307415_100050291 3300032126 Bacteria 2823
351 Ga0307415_100065757 3300032126 Bacteria 2528
352 Ga0307415_100085419 3300032126 Bacteria 2267
353 Ga0307415_100107915 3300032126 Bacteria 2058
354 Ga0373935_0217579 3300035692 Bacteria 1326
355 Ga0395899_0000523 3300037312 Bacteria 42229
356 Ga0395899_0000732 3300037312 Bacteria 32768
357 Ga0395899_0007989 3300037312 Bacteria 8149
358 Ga0395899_0029430 3300037312 Bacteria 4130
359 Ga0395899_0051972 3300037312 Bacteria 3039
360 Ga0395899_0097441 3300037312 Bacteria 2126
361 Ga0395899_0106062 3300037312 Bacteria 2023
362 Ga0395899_0171044 3300037312 Bacteria 1530
363 Ga0395899_0236035 3300037312 Bacteria 1260
364 Ga0395900_0000289 3300037418 Bacteria 75525
365 Ga0395900_0001059 3300037418 Bacteria 35203
366 Ga0395900_0025422 3300037418 Bacteria 6062
367 Ga0395900_0035222 3300037418 Bacteria 5156
368 Ga0395900_0064918 3300037418 Bacteria 3750
369 Ga0395900_0100863 3300037418 Bacteria 2965
370 Ga0395900_0121144 3300037418 Bacteria 2684
371 Ga0395900_0125580 3300037418 Bacteria 2631
372 Ga0395900_0156386 3300037418 Bacteria 2328
373 Ga0395900_0228084 3300037418 Bacteria 1874
374 Ga0395900_0282996 3300037418 Unclassified 1649
375 Ga0395900_0286658 3300037418 Bacteria 1637
376 Ga0395900_0529783 3300037418 Unclassified 1125
377 Ga0395898_0000898 3300037466 Bacteria 47961
378 Ga0395898_0020969 3300037466 Bacteria 6630
379 Ga0395898_0090384 3300037466 Bacteria 2946
380 Ga0395898_0174947 3300037466 Bacteria 2052
381 Ga0395898_0206312 3300037466 Bacteria 1875
382 Ga0395898_0492213 3300037466 Bacteria 1166
383 Ga0395905_0002039 3300037471 Bacteria 23073
384 Ga0395905_0008638 3300037471 Bacteria 10033
385 Ga0395905_0014418 3300037471 Bacteria 7548
386 Ga0395905_0015791 3300037471 Bacteria 7173
387 Ga0395905_0018840 3300037471 Bacteria 6546
388 Ga0395905_0044757 3300037471 Bacteria 4152
389 Ga0395905_0071378 3300037471 Bacteria 3255
390 Ga0395905_0071795 3300037471 Bacteria 3245
391 Ga0395905_0072662 3300037471 Bacteria 3225
392 Ga0395905_0073770 3300037471 Bacteria 3199
393 Ga0395905_0080121 3300037471 Bacteria 3060
394 Ga0395905_0084423 3300037471 Bacteria 2975
395 Ga0395905_0126090 3300037471 Bacteria 2407
396 Ga0395905_0183845 3300037471 Bacteria 1962
397 Ga0395905_0333184 3300037471 Bacteria 1408
398 Ga0395905_0462268 3300037471 Bacteria 1167
399 Ga0395901_0000208 3300038443 Bacteria 73874
400 Ga0395901_0000398 3300038443 Bacteria 51885
401 Ga0395901_0000957 3300038443 Bacteria 31439
402 Ga0395901_0030997 3300038443 Bacteria 5512
403 Ga0395901_0040240 3300038443 Bacteria 4841
404 Ga0395901_0058323 3300038443 Bacteria 4015
405 Ga0395901_0087772 3300038443 Bacteria 3252
406 Ga0395901_0089332 3300038443 Bacteria 3224
407 Ga0395901_0092625 3300038443 Bacteria 3163
408 Ga0395901_0167678 3300038443 Bacteria 2305
409 Ga0395901_0344843 3300038443 Bacteria 1538
410 Ga0395901_0349706 3300038443 Bacteria 1525
411 Ga0439448_0029621 3300042005 Bacteria 1733
412 Ga0439432_011885 3300042006 Bacteria 2992
413 Ga0439458_0001421 3300042157 Bacteria 6044
414 Ga0439458_0005373 3300042157 Bacteria 2880
415 Ga0466972_0087355 3300044658 Unclassified 1481
416 Ga0466965_0067668 3300044683 Unclassified 1793
417 Ga0466965_0135812 3300044683 Bacteria 1278
418 Ga0466966_0047245 3300044684 Bacteria 2745
419 Ga0466966_0147941 3300044684 Bacteria 1433
420 Ga0466966_0171746 3300044684 Bacteria 1317
421 Ga0466961_0024637 3300044693 Bacteria 3871
422 Ga0466961_0025245 3300044693 Bacteria 3821
423 Ga0466961_0050234 3300044693 Bacteria 2664
424 Ga0466963_0028888 3300044694 Bacteria 3565
425 Ga0466963_0046047 3300044694 Bacteria 2875
426 Ga0466963_0078847 3300044694 Bacteria 2227
427 Ga0466963_0100806 3300044694 Bacteria 1976
428 Ga0466964_0179718 3300044706 Bacteria 1002
429 Ga0466971_0007339 3300044719 Bacteria 4797
430 Ga0466971_0031399 3300044719 Bacteria 2378
431 Ga0466970_0013077 3300044765 Bacteria 4253
432 Ga0466970_0093403 3300044765 Bacteria 1634
433 Ga0466957_0021109 3300044842 Bacteria 3835
434 Ga0466957_0029688 3300044842 Bacteria 3262
435 Ga0466957_0083570 3300044842 Bacteria 1992
436 Ga0466957_0140129 3300044842 Bacteria 1557
437 Ga0466960_0031377 3300044901 Bacteria 2452
438 Ga0466960_0162897 3300044901 Bacteria 1199
439 Ga0466959_0058854 3300045049 Bacteria 2798
440 Ga0466959_0085033 3300045049 Bacteria 2277
441 Ga0466958_0013368 3300045836 Bacteria 4672
442 Ga0466958_0062801 3300045836 Bacteria 2265
443 Ga0466967_0003190 3300045976 Bacteria 10580
444 Ga0466967_0018002 3300045976 Bacteria 5633
445 Ga0466967_0026275 3300045976 Bacteria 4820
446 Ga0466967_0047417 3300045976 Bacteria 3745
447 Ga0466967_0063033 3300045976 Bacteria 3292
448 Ga0466967_0103729 3300045976 Bacteria 2602
449 Ga0466967_0148545 3300045976 Bacteria 2188
450 Ga0466967_0189914 3300045976 Bacteria 1941
451 Ga0466967_0266420 3300045976 Bacteria 1640
452 Ga0466967_0297763 3300045976 Bacteria 1551
453 Ga0495663_0016658 3300046525 Bacteria 2078
454 Ga0495669_0000090 3300046684 Bacteria 60222
455 Ga0495669_0051178 3300046684 Bacteria 1853
456 Ga0495677_0010705 3300047445 Bacteria 3360
457 Ga0495677_0012642 3300047445 Bacteria 3076
458 Ga0496101_0064789 3300048904 Bacteria 2663
459 Ga0496102_0029424 3300048905 Bacteria 4915
460 Ga0496107_0001820 3300048910 Bacteria 13445
461 Ga0496107_0100628 3300048910 Bacteria 2119
462 Ga0496108_0000483 3300048911 Bacteria 31924
463 Ga0496108_0010144 3300048911 Bacteria 7644
464 Ga0496109_0029684 3300048912 Bacteria 4899
465 Ga0496109_0030628 3300048912 Bacteria 4822
466 Ga0496111_0018983 3300048914 Bacteria 4767
467 Ga0496111_0070569 3300048914 Bacteria 2541
468 Ga0496112_0053175 3300048915 Bacteria 3976
469 Ga0496112_0062435 3300048915 Bacteria 3675
470 Ga0496112_0104223 3300048915 Bacteria 2807
471 Ga0496112_0181636 3300048915 Bacteria 2068
472 Ga0496112_0233766 3300048915 Bacteria 1792
473 Ga0496113_0038862 3300048916 Bacteria 3500
474 Ga0496114_0021360 3300048917 Bacteria 5266
475 Ga0496115_0002248 3300048918 Bacteria 13817
476 Ga0501257_047802 3300049686 Bacteria 1062
477 nmdc:mga0n895_432088_c1 3300050512 Bacteria 1330
478 Ga0495655_0014130 3300053083 Bacteria 1668
479 Ga0466962_0036885 3300061719 Bacteria 2340
480 Ga0466962_0037869 3300061719 Bacteria 2310
481 Ga0466962_0056510 3300061719 Bacteria 1874
482 Ga0070660_100434643
483 JGI24741J21665_1013799
484 JGI24752J21851_1001253
485 JGI24747J21853_1003083
486 JGI24740J21852_10010008
487 JGI24740J21852_10016166
488 JGI24739J22299_10051650
489 JGI24737J22298_10010896
490 JGI24737J22298_10046289
491 JGI24735J21928_10006760
492 JGI24735J21928_10007577
493 JGI24735J21928_10016209
494 JGI24744J21845_10004448
495 rootH1_10121081
496 Ga0065712_10128238
497 Ga0070658_10002137
498 Ga0070658_10025263
499 Ga0070658_10028086
500 Ga0070658_10047899
501 Ga0070658_10087915
502 Ga0070658_10239880
503 Ga0070683_100074417
504 Ga0070683_100466474
505 Ga0070670_100011571
506 Ga0070670_100022626
507 Ga0070670_100026048
508 Ga0070677_10004203
509 Ga0068869_100046933
510 Ga0070680_100125406
511 Ga0070680_100247008
512 Ga0068868_100288321
513 Ga0070660_100002146
514 Ga0070660_100002601
515 Ga0070660_100003603
516 Ga0070660_100057186
517 Ga0070660_100075998
518 Ga0070660_100078459
519 Ga0070660_100090352
520 Ga0070660_100237851
521 Ga0070660_100315461
522 Ga0070660_100331362
523 Ga0070661_100008356
524 Ga0070661_100011812
525 Ga0070661_100016769
526 Ga0070661_100036170
527 Ga0070661_100060817
528 Ga0070661_100090404
529 Ga0070661_100119002
530 Ga0070692_10027988
531 Ga0070669_100120813
532 Ga0070669_100152948
533 Ga0070675_100060697
534 Ga0070671_100013121
535 Ga0070671_100013158
536 Ga0070671_100015297
537 Ga0070671_100042910
538 Ga0070674_100007979
539 Ga0070673_100001976
540 Ga0070673_100057001
541 Ga0070673_100085769
542 Ga0070673_100210020
543 Ga0070673_100225910
544 Ga0070659_100009282
545 Ga0070659_100030524
546 Ga0070659_100038805
547 Ga0070659_100078024
548 Ga0070659_100125351
549 Ga0070667_100003379
550 Ga0070714_100011244
551 Ga0070714_100013652
552 Ga0070713_100144299
553 Ga0070663_100010459
554 Ga0070663_100031489
555 Ga0070663_100111864
556 Ga0070663_100136039
557 Ga0070678_100003312
558 Ga0070678_100161185
559 Ga0070662_100002904
560 Ga0070662_100124044
561 Ga0070662_100129698
562 Ga0070662_100161921
563 Ga0070662_100268045
564 Ga0070681_10010100
565 Ga0070681_10052123
566 Ga0070681_10068235
567 Ga0070681_10162962
568 Ga0070679_100003137
569 Ga0070679_100031455
570 Ga0070684_100025486
571 Ga0070684_100177875
572 Ga0070684_100179286
573 Ga0068853_100004420
574 Ga0068853_100038272
575 Ga0068853_100051371
576 Ga0068853_100242684
577 Ga0068853_100589208
578 Ga0070672_100009303
579 Ga0070672_100016988
580 Ga0070672_100093639
581 Ga0070693_100203586
582 Ga0070665_100016522
583 Ga0070665_100019407
584 Ga0068855_100000129
585 Ga0068855_100016513
586 Ga0070664_100001759
587 Ga0070664_100010225
588 Ga0070664_100025995
589 Ga0070664_100273271
590 Ga0070664_100291766
591 Ga0068857_100002668
592 Ga0068857_100011067
593 Ga0068856_100012339
594 Ga0068856_100020442
595 Ga0068856_100093908
596 Ga0068856_100140799
597 Ga0068856_100166084
598 Ga0068856_100270432
599 Ga0068856_100405738
600 Ga0068852_100003803
601 Ga0068852_100038033
602 Ga0068852_100069753
603 Ga0068852_100076279
604 Ga0068852_100115855
605 Ga0068852_100200825
606 Ga0068852_100403675
607 Ga0068852_100457420
608 Ga0068859_100025420
609 Ga0068859_100078362
610 Ga0068864_100009730
611 Ga0068864_100275704
612 Ga0068866_10017648
613 Ga0068863_100004897
614 Ga0068863_100023470
615 Ga0068858_100015928
616 Ga0068858_100032403
617 Ga0068862_100313993
618 Ga0081539_10013266
619 Ga0070717_10217086
620 Ga0097621_100014636
621 Ga0068871_100069204
622 Ga0068871_100091859
623 Ga0097620_100025420
624 Ga0097620_100078360
625 Ga0105240_10362909
626 Ga0105240_10401167
627 Ga0105245_10033757
628 Ga0105241_10442377
629 Ga0105242_10162497
630 Ga0105248_10056571
631 Ga0105248_10168841
632 Ga0105248_10186957
633 Ga0105248_10694219
634 Ga0105237_10008647
635 Ga0105237_10173206
636 Ga0105238_10124974
637 Ga0105246_10304854
638 Ga0157373_10028064
639 Ga0157373_10045987
640 Ga0157373_10086361
641 Ga0157373_10118728
642 Ga0157373_10156281
643 Ga0157371_10000854
644 Ga0157371_10035115
645 Ga0157371_10133035
646 Ga0157371_10181817
647 Ga0157370_10021120
648 Ga0157370_10033682
649 Ga0157370_10088060
650 Ga0157370_10220702
651 Ga0157369_10013742
652 Ga0157369_10067599
653 Ga0157369_10087853
654 Ga0157369_10162072
655 Ga0157369_10162276
656 Ga0157369_10491014
657 Ga0157374_10007195
658 Ga0157374_10224714
659 Ga0157378_10020021
660 Ga0157378_10206770
661 Ga0163162_10011448
662 Ga0163162_10018565
663 Ga0163162_10114073
664 Ga0157372_10004983
665 Ga0157372_10201756
666 Ga0157372_10285812
667 Ga0157372_10378831
668 Ga0157375_10017101
669 Ga0157375_10019577
670 Ga0157375_10109013
671 Ga0163163_10041991
672 Ga0163163_10257915
673 Ga0182008_10050463
674 Ga0157379_10007253
675 Ga0163161_10003835
676 Ga0207697_10007047
677 Ga0207656_10047682
678 Ga0207656_10065674
679 Ga0207682_10004479
680 Ga0207642_10015035
681 Ga0207647_10025560
682 Ga0207647_10027097
683 Ga0207647_10064343
684 Ga0207647_10080527
685 Ga0207705_10000382
686 Ga0207705_10003386
687 Ga0207705_10003556
688 Ga0207705_10031628
689 Ga0207705_10040421
690 Ga0207705_10054358
691 Ga0207705_10207329
692 Ga0207654_10315442
693 Ga0207707_10051525
694 Ga0207707_10149982
695 Ga0207707_10227574
696 Ga0207671_10181320
697 Ga0207671_10212654
698 Ga0207660_10120238
699 Ga0207660_10238043
700 Ga0207657_10002591
701 Ga0207657_10003263
702 Ga0207657_10005871
703 Ga0207657_10006604
704 Ga0207657_10008396
705 Ga0207657_10015366
706 Ga0207657_10025260
707 Ga0207657_10061393
708 Ga0207657_10153905
709 Ga0207657_10236122
710 Ga0207657_10314406
711 Ga0207649_10007570
712 Ga0207649_10022738
713 Ga0207649_10033637
714 Ga0207649_10071988
715 Ga0207649_10127226
716 Ga0207649_10132202
717 Ga0207652_10007945
718 Ga0207652_10020800
719 Ga0207681_10009410
720 Ga0207681_10181319
721 Ga0207694_10000857
722 Ga0207650_10015870
723 Ga0207650_10119549
724 Ga0207659_10059498
725 Ga0207687_10115967
726 Ga0207700_10093709
727 Ga0207664_10104550
728 Ga0207644_10049321
729 Ga0207644_10053272
730 Ga0207644_10059096
731 Ga0207644_10067867
732 Ga0207690_10029584
733 Ga0207690_10029744
734 Ga0207690_10049323
735 Ga0207690_10106273
736 Ga0207690_10187201
737 Ga0207706_10061189
738 Ga0207706_10203196
739 Ga0207686_10051844
740 Ga0207670_10342634
741 Ga0207669_10010293
742 Ga0207704_10029360
743 Ga0207691_10019074
744 Ga0207691_10030576
745 Ga0207691_10037938
746 Ga0207691_10075164
747 Ga0207691_10081893
748 Ga0207711_10012637
749 Ga0207711_10041529
750 Ga0207661_10085233
751 Ga0207679_10033084
752 Ga0207679_10061390
753 Ga0207679_10187404
754 Ga0207679_10263795
755 Ga0207667_10000303
756 Ga0207667_10019988
757 Ga0207667_10075429
758 Ga0207667_10326236
759 Ga0207668_10217523
760 Ga0207640_10123060
761 Ga0207658_10040090
762 Ga0207658_10090883
763 Ga0207658_10096461
764 Ga0207677_10193296
765 Ga0207703_10034324
766 Ga0207639_10000334
767 Ga0207639_10054272
768 Ga0207639_10106763
769 Ga0207639_10132808
770 Ga0207639_10225131
771 Ga0207678_10002136
772 Ga0207678_10071716
773 Ga0207678_10121045
774 Ga0207678_10320733
775 Ga0207702_10179754
776 Ga0207702_10184780
777 Ga0207702_10194293
778 Ga0207702_10518241
779 Ga0207641_10039687
780 Ga0207641_10398424
781 Ga0207648_10024810
782 Ga0207676_10007122
783 Ga0207676_10024936
784 Ga0207674_10002210
785 Ga0207674_10007233
786 Ga0207674_10050863
787 Ga0207674_10074478
788 Ga0207674_10103531
789 Ga0207683_10002807
790 Ga0207683_10033576
791 Ga0207698_10003192
792 Ga0207698_10003498
793 Ga0207698_10007468
794 Ga0207698_10016163
795 Ga0207698_10049971
796 Ga0207698_10079232
797 Ga0207698_10095050
798 Ga0207698_10227777
799 Ga0207698_10342385
800 Ga0207698_10477905
801 Ga0209974_10003208
802 Ga0268265_10269519
803 Ga0268264_10393217
804 Ga0268264_10478655
805 Ga0316183_1027745
806 Ga0307408_100041185
807 Ga0307408_100303047
808 Ga0307405_10012299
809 Ga0307405_10081318
810 Ga0307405_10087462
811 Ga0307413_10203645
812 Ga0307413_10219664
813 Ga0307410_10016762
814 Ga0307410_10100128
815 Ga0307410_10400189
816 Ga0307406_10163002
817 Ga0307407_10073357
818 Ga0307412_10018592
819 Ga0307412_10179013
820 Ga0307412_10198037
821 Ga0307412_10226024
822 Ga0307409_100001518
823 Ga0307409_100080152
824 Ga0307409_100090514
825 Ga0307409_100131376
826 Ga0307416_100420481
827 Ga0307414_10010066
828 Ga0307414_10261563
829 Ga0307414_10491699
830 Ga0307411_10030946
831 Ga0307415_100050291
832 Ga0307415_100065757
833 Ga0307415_100085419
834 Ga0307415_100107915
835 Ga0373935_0217579
836 Ga0395899_0000523
837 Ga0395899_0000732
838 Ga0395899_0007989
839 Ga0395899_0029430
840 Ga0395899_0051972
841 Ga0395899_0097441
842 Ga0395899_0106062
843 Ga0395899_0171044
844 Ga0395899_0236035
845 Ga0395900_0000289
846 Ga0395900_0001059
847 Ga0395900_0025422
848 Ga0395900_0035222
849 Ga0395900_0064918
850 Ga0395900_0100863
851 Ga0395900_0121144
852 Ga0395900_0125580
853 Ga0395900_0156386
854 Ga0395900_0228084
855 Ga0395900_0282996
856 Ga0395900_0286658
857 Ga0395900_0529783
858 Ga0395898_0000898
859 Ga0395898_0020969
860 Ga0395898_0090384
861 Ga0395898_0174947
862 Ga0395898_0206312
863 Ga0395898_0492213
864 Ga0395905_0002039
865 Ga0395905_0008638
866 Ga0395905_0014418
867 Ga0395905_0015791
868 Ga0395905_0018840
869 Ga0395905_0044757
870 Ga0395905_0071378
871 Ga0395905_0071795
872 Ga0395905_0072662
873 Ga0395905_0073770
874 Ga0395905_0080121
875 Ga0395905_0084423
876 Ga0395905_0126090
877 Ga0395905_0183845
878 Ga0395905_0333184
879 Ga0395905_0462268
880 Ga0395901_0000208
881 Ga0395901_0000398
882 Ga0395901_0000957
883 Ga0395901_0030997
884 Ga0395901_0040240
885 Ga0395901_0058323
886 Ga0395901_0087772
887 Ga0395901_0089332
888 Ga0395901_0092625
889 Ga0395901_0167678
890 Ga0395901_0344843
891 Ga0395901_0349706
892 Ga0439448_0029621
893 Ga0439432_011885
894 Ga0439458_0001421
895 Ga0439458_0005373
896 Ga0466972_0087355
897 Ga0466965_0067668
898 Ga0466965_0135812
899 Ga0466966_0047245
900 Ga0466966_0147941
901 Ga0466966_0171746
902 Ga0466961_0024637
903 Ga0466961_0025245
904 Ga0466961_0050234
905 Ga0466963_0028888
906 Ga0466963_0046047
907 Ga0466963_0078847
908 Ga0466963_0100806
909 Ga0466964_0179718
910 Ga0466971_0007339
911 Ga0466971_0031399
912 Ga0466970_0013077
913 Ga0466970_0093403
914 Ga0466957_0021109
915 Ga0466957_0029688
916 Ga0466957_0083570
917 Ga0466957_0140129
918 Ga0466960_0031377
919 Ga0466960_0162897
920 Ga0466959_0058854
921 Ga0466959_0085033
922 Ga0466958_0013368
923 Ga0466958_0062801
924 Ga0466967_0003190
925 Ga0466967_0018002
926 Ga0466967_0026275
927 Ga0466967_0047417
928 Ga0466967_0063033
929 Ga0466967_0103729
930 Ga0466967_0148545
931 Ga0466967_0189914
932 Ga0466967_0266420
933 Ga0466967_0297763
934 Ga0495663_0016658
935 Ga0495669_0000090
936 Ga0495669_0051178
937 Ga0495677_0010705
938 Ga0495677_0012642
939 Ga0496101_0064789
940 Ga0496102_0029424
941 Ga0496107_0001820
942 Ga0496107_0100628
943 Ga0496108_0000483
944 Ga0496108_0010144
945 Ga0496109_0029684
946 Ga0496109_0030628
947 Ga0496111_0018983
948 Ga0496111_0070569
949 Ga0496112_0053175
950 Ga0496112_0062435
951 Ga0496112_0104223
952 Ga0496112_0181636
953 Ga0496112_0233766
954 Ga0496113_0038862
955 Ga0496114_0021360
956 Ga0496115_0002248
957 Ga0501257_047802
958 nmdc:mga0n895_432088_c1
959 Ga0495655_0014130
960 Ga0466962_0036885
961 Ga0466962_0037869
962 Ga0466962_0056510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02470

MlaD

MlaD protein

35

115

0.88

Map