F452344

General Info

Members Datasets Scaffolds Average Seq Length
481 389 962 141

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1025224|JGI25160J50197_10252243
Length 164
Sequence VAEGGRDPIKSNELVRNMTYHIHGALLASLSAAALLLSPVDSFARPGGAAPHGVSAGPSGAMARAPIGPGARFHRRSSPFVYWPGGGGFYDGAGYSQPFVDAGQPVTTDVRYTYTYDVPWDWSHRFPPNVVPSDRPYVPSCPTEQVRVPGRGGSEHTVNIMRCY

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
123 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
220 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
226 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
229 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
232 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
236 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
237 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
240 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
241 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
243 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
244 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
245 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
246 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
247 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
248 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
249 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
250 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
251 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
252 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
253 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
254 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
255 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
256 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
257 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
258 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
259 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
260 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
261 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
262 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
263 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
264 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
265 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
266 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
267 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
268 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
269 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
270 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
271 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
272 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
273 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
274 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
275 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
276 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
277 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
278 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
279 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
280 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
281 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
282 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
283 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
284 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
285 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
286 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
287 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
288 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
289 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
290 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
291 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
292 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
293 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
294 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
295 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
296 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
297 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
298 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
299 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
300 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
301 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
302 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
303 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
304 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
305 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
306 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
307 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
308 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
309 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
310 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
311 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
312 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
313 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
314 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
315 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
316 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
317 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
318 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
319 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
320 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
321 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
322 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
323 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
324 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
325 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
326 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
327 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
328 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
329 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
330 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
331 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
332 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
333 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
334 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
335 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
336 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
337 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
338 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
339 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
340 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
341 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
342 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
343 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
344 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
345 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
346 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
347 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
348 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
349 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
350 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
351 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
352 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
353 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
354 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
355 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
356 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
357 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
358 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
359 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
360 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
361 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
362 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
363 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
364 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
365 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
366 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
367 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
368 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
369 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
370 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
371 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
372 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
373 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
374 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
375 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
376 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
377 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
378 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
379 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
380 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
381 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
382 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
383 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
384 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
385 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
386 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
387 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
388 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
389 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.02
Metatranscriptomes 0.21
Isolates 30.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.01
Nodule 21.83
Rhizoplane 3.33
Rhizosphere 44.28
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1025224 3300003354 Bacteria 1668
2 RicEn_C9518 2010549000 Bacteria 1404
3 JGI25153J46596_10001348 3300003215 Bacteria 14698
4 JGI25153J46596_10009440 3300003215 Bacteria 4531
5 JGI25153J46596_10024835 3300003215 Bacteria 2153
6 rootH1_10153166 3300003323 Bacteria 1121
7 JGI25161J50226_1011479 3300003374 Bacteria 1111
8 Ga0055526_1052389 3300003771 Bacteria 921
9 Ga0055531_10017327 3300003794 Bacteria 3049
10 Ga0055543_1002556 3300004625 Bacteria 5930
11 Ga0065165_1001307 3300005262 Bacteria 27822
12 Ga0065165_1002964 3300005262 Bacteria 12913
13 Ga0065165_1026947 3300005262 Bacteria 1881
14 Ga0070683_100255947 3300005329 Bacteria 1665
15 Ga0070666_10078648 3300005335 Bacteria 2252
16 Ga0070660_100114823 3300005339 Bacteria 2145
17 Ga0070661_100320960 3300005344 Bacteria 1210
18 Ga0070671_100018504 3300005355 Bacteria 5660
19 Ga0070674_100689568 3300005356 Bacteria 872
20 Ga0070659_100129944 3300005366 Bacteria 2045
21 Ga0070659_100617521 3300005366 Bacteria 933
22 Ga0070659_100707057 3300005366 Bacteria 872
23 Ga0070709_10006123 3300005434 Bacteria 6544
24 Ga0070713_100045895 3300005436 Bacteria 3583
25 Ga0070710_10002140 3300005437 Bacteria 9367
26 Ga0070663_100113822 3300005455 Bacteria 2037
27 Ga0068867_100126427 3300005459 Bacteria 1982
28 Ga0070684_100026429 3300005535 Bacteria 4890
29 Ga0068853_100268674 3300005539 Bacteria 1570
30 Ga0070665_100708683 3300005548 Bacteria 1019
31 Ga0070664_100914809 3300005564 Bacteria 823
32 Ga0068857_101043871 3300005577 Bacteria 788
33 Ga0068854_100209809 3300005578 Bacteria 1536
34 Ga0068856_100097246 3300005614 Bacteria 2933
35 Ga0068856_100199604 3300005614 Bacteria 2015
36 Ga0068852_100091779 3300005616 Bacteria 2718
37 Ga0068852_100318556 3300005616 Bacteria 1510
38 Ga0068858_100862421 3300005842 Bacteria 885
39 Ga0081540_1108205 3300005983 Bacteria 1182
40 Ga0070717_10007455 3300006028 Bacteria 8129
41 Ga0075365_10009759 3300006038 Bacteria 5546
42 Ga0075365_10208919 3300006038 Bacteria 1368
43 Ga0075365_10414154 3300006038 Bacteria 951
44 Ga0075368_10038060 3300006042 Bacteria 1882
45 Ga0075364_10024907 3300006051 Bacteria 3804
46 Ga0070715_10002301 3300006163 Bacteria 5825
47 Ga0070716_100038061 3300006173 Bacteria 2661
48 Ga0070716_100549073 3300006173 Bacteria 861
49 Ga0070712_100006749 3300006175 Bacteria 7137
50 Ga0070712_100255292 3300006175 Bacteria 1403
51 Ga0075362_10329292 3300006177 Bacteria 762
52 Ga0075362_10333893 3300006177 Bacteria 757
53 Ga0075366_10008997 3300006195 Bacteria 5569
54 Ga0075366_10094214 3300006195 Bacteria 1795
55 Ga0075370_10106503 3300006353 Bacteria 1626
56 Ga0068865_101524267 3300006881 Bacteria 599
57 Ga0099795_10018737 3300007788 Bacteria 2229
58 Ga0105240_10133696 3300009093 Bacteria 2972
59 Ga0105240_10375539 3300009093 Bacteria 1606
60 Ga0105240_10820105 3300009093 Bacteria 1006
61 Ga0105245_10439033 3300009098 Bacteria 1312
62 Ga0105247_10103227 3300009101 Bacteria 1825
63 Ga0105243_11523317 3300009148 Bacteria 693
64 Ga0105241_10075397 3300009174 Bacteria 2628
65 Ga0105241_10140247 3300009174 Bacteria 1967
66 Ga0105241_10396042 3300009174 Bacteria 1210
67 Ga0105242_10755723 3300009176 Bacteria 958
68 Ga0105242_11117486 3300009176 Bacteria 803
69 Ga0105237_10001286 3300009545 Bacteria 33400
70 Ga0105237_10027577 3300009545 Bacteria 5794
71 Ga0105238_10170745 3300009551 Bacteria 2150
72 Ga0105249_10900405 3300009553 Bacteria 952
73 Ga0105239_10031201 3300010375 Bacteria 5862
74 Ga0105239_10031496 3300010375 Bacteria 5831
75 Ga0105239_10045785 3300010375 Bacteria 4794
76 Ga0105246_10078956 3300011119 Bacteria 2339
77 Ga0157369_12405409 3300013105 Bacteria 534
78 Ga0157374_10010318 3300013296 Bacteria 8034
79 Ga0157374_10584245 3300013296 Bacteria 1126
80 Ga0157378_10189744 3300013297 Bacteria 1938
81 Ga0163162_10689980 3300013306 Bacteria 1143
82 Ga0163162_11539581 3300013306 Bacteria 758
83 Ga0163163_10041823 3300014325 Bacteria 4484
84 Ga0157380_11889755 3300014326 Bacteria 657
85 Ga0182008_10490182 3300014497 Bacteria 674
86 Ga0157377_10626763 3300014745 Bacteria 771
87 Ga0157379_10187769 3300014968 Bacteria 1868
88 Ga0157376_10248265 3300014969 Bacteria 1661
89 Ga0182006_1074881 3300015261 Bacteria 1247
90 Ga0163161_10402705 3300017792 Bacteria 1097
91 Ga0207425_1089722 3300025245 Bacteria 503
92 Ga0209148_1000354 3300025254 Bacteria 59155
93 Ga0209233_1026844 3300025261 Bacteria 1402
94 Ga0209233_1030087 3300025261 Bacteria 1283
95 Ga0209564_1033187 3300025295 Bacteria 1540
96 Ga0209758_1000164 3300025297 Bacteria 151759
97 Ga0209758_1000216 3300025297 Bacteria 125352
98 Ga0209758_1005195 3300025297 Bacteria 10227
99 Ga0209758_1024996 3300025297 Bacteria 2638
100 Ga0209758_1034307 3300025297 Bacteria 2022
101 Ga0209758_1136511 3300025297 Bacteria 641
102 Ga0209256_1003991 3300025299 Bacteria 9675
103 Ga0209256_1056722 3300025299 Bacteria 926
104 Ga0207426_1000580 3300025302 Bacteria 48953
105 Ga0207426_1006600 3300025302 Bacteria 5002
106 Ga0207426_1029990 3300025302 Bacteria 1788
107 Ga0209257_1001462 3300025304 Bacteria 27887
108 Ga0207692_10001180 3300025898 Bacteria 9674
109 Ga0207680_10538627 3300025903 Bacteria 833
110 Ga0207647_10011289 3300025904 Bacteria 6270
111 Ga0207647_10328111 3300025904 Bacteria 868
112 Ga0207685_10121391 3300025905 Bacteria 1148
113 Ga0207699_10004912 3300025906 Bacteria 6397
114 Ga0207645_10380958 3300025907 Bacteria 947
115 Ga0207705_10123807 3300025909 Bacteria 1920
116 Ga0207654_10065552 3300025911 Bacteria 2139
117 Ga0207654_10088200 3300025911 Bacteria 1884
118 Ga0207695_10000342 3300025913 Bacteria 108393
119 Ga0207695_10311983 3300025913 Bacteria 1463
120 Ga0207671_10003865 3300025914 Bacteria 14649
121 Ga0207671_10011658 3300025914 Bacteria 7131
122 Ga0207693_10001050 3300025915 Bacteria 24700
123 Ga0207693_10089745 3300025915 Bacteria 2409
124 Ga0207663_10000235 3300025916 Bacteria 24574
125 Ga0207657_10191869 3300025919 Bacteria 1648
126 Ga0207649_10380154 3300025920 Bacteria 1052
127 Ga0207694_11036561 3300025924 Bacteria 694
128 Ga0207700_10011527 3300025928 Bacteria 5643
129 Ga0207644_10232144 3300025931 Bacteria 1466
130 Ga0207690_10350084 3300025932 Bacteria 1168
131 Ga0207690_10518721 3300025932 Bacteria 966
132 Ga0207690_11002487 3300025932 Bacteria 695
133 Ga0207706_10361260 3300025933 Bacteria 1261
134 Ga0207709_10162879 3300025935 Bacteria 1557
135 Ga0207665_10000311 3300025939 Bacteria 33740
136 Ga0207665_10055607 3300025939 Bacteria 2671
137 Ga0207661_10007625 3300025944 Bacteria 7697
138 Ga0207679_10532922 3300025945 Bacteria 1052
139 Ga0207679_11452581 3300025945 Bacteria 629
140 Ga0207667_10180672 3300025949 Bacteria 2167
141 Ga0207651_10327980 3300025960 Bacteria 1282
142 Ga0207703_11280691 3300026035 Bacteria 705
143 Ga0207639_10380666 3300026041 Bacteria 1267
144 Ga0207639_10672379 3300026041 Bacteria 959
145 Ga0207678_10054664 3300026067 Bacteria 3439
146 Ga0207702_10328752 3300026078 Bacteria 1457
147 Ga0207641_10530357 3300026088 Bacteria 1146
148 Ga0207648_10125938 3300026089 Bacteria 2254
149 Ga0207674_10276213 3300026116 Bacteria 1628
150 Ga0207698_10096607 3300026142 Bacteria 2435
151 Ga0207698_10260604 3300026142 Bacteria 1592
152 Ga0207698_11020257 3300026142 Bacteria 838
153 Ga0307517_10000476 3300028786 Bacteria 68696
154 Ga0307515_10063492 3300028794 Bacteria 5186
155 Ga0307513_10363149 3300031456 Bacteria 1192
156 Ga0307508_10272914 3300031616 Bacteria 1285
157 Ga0307508_10332102 3300031616 Bacteria 1112
158 Ga0265314_10119680 3300031711 Bacteria 1660
159 Ga0373954_0192735 3300035118 Bacteria 1001
160 Ga0395899_0699563 3300037312 Bacteria 636
161 Ga0395899_0834726 3300037312 Bacteria 567
162 Ga0395900_0000488 3300037418 Bacteria 56179
163 Ga0395900_0799890 3300037418 Bacteria 871
164 Ga0395898_0035229 3300037466 Bacteria 4980
165 Ga0395898_0386295 3300037466 Bacteria 1335
166 Ga0395905_0072729 3300037471 Bacteria 3223
167 Ga0395905_0117057 3300037471 Bacteria 2504
168 Ga0395905_0120521 3300037471 Bacteria 2466
169 Ga0395905_0160393 3300037471 Bacteria 2114
170 Ga0436364_1529710 3300037853 Bacteria 958
171 Ga0395901_0368470 3300038443 Bacteria 1480
172 Ga0439465_0294132 3300041413 Bacteria 607
173 Ga0451793_1313555 3300041452 Bacteria 960
174 Ga0451833_1425521 3300041491 Unclassified 839
175 Ga0451833_1456993 3300041491 Bacteria 1183
176 Ga0451849_0209777 3300041505 Bacteria 1073
177 Ga0451853_3834789 3300041512 Bacteria 699
178 Ga0466969_0098541 3300044656 Bacteria 1378
179 Ga0466972_0000149 3300044658 Bacteria 56799
180 Ga0466965_0082548 3300044683 Bacteria 1626
181 Ga0466966_0000112 3300044684 Bacteria 50307
182 Ga0466961_0000082 3300044693 Bacteria 59328
183 Ga0466963_0102716 3300044694 Bacteria 1958
184 Ga0466964_0015092 3300044706 Bacteria 2942
185 Ga0466964_0172097 3300044706 Bacteria 1020
186 Ga0466968_0177312 3300044735 Bacteria 990
187 Ga0466970_0124338 3300044765 Bacteria 1414
188 Ga0466960_0016956 3300044901 Bacteria 3168
189 Ga0466959_0016769 3300045049 Bacteria 5360
190 Ga0495592_0143038 3300046454 Bacteria 1661
191 Ga0495629_0001526 3300046459 Bacteria 18210
192 Ga0495638_0037407 3300046460 Bacteria 3087
193 Ga0495651_0012618 3300046462 Bacteria 6521
194 Ga0495653_0052497 3300046463 Bacteria 3124
195 Ga0495650_0094952 3300046471 Bacteria 1128
196 Ga0495605_0220578 3300046474 Bacteria 819
197 Ga0495605_0405920 3300046474 Bacteria 566
198 Ga0495664_0042622 3300046477 Bacteria 2688
199 Ga0495664_0342009 3300046477 Bacteria 901
200 Ga0495585_0383512 3300046492 Bacteria 679
201 Ga0495607_0107251 3300046501 Bacteria 1486
202 Ga0495583_0233887 3300046506 Bacteria 740
203 Ga0495583_0297191 3300046506 Bacteria 642
204 Ga0495606_0239390 3300046507 Bacteria 1013
205 Ga0495606_0370961 3300046507 Bacteria 753
206 Ga0495608_0131689 3300046511 Bacteria 1600
207 Ga0495610_0183296 3300046512 Bacteria 869
208 Ga0495616_0152160 3300046513 Bacteria 1046
209 Ga0495628_0227714 3300046516 Bacteria 1398
210 Ga0495643_0062868 3300046522 Bacteria 1964
211 Ga0495648_0023711 3300046524 Bacteria 4194
212 Ga0495648_0241750 3300046524 Bacteria 877
213 Ga0495652_0094357 3300046529 Bacteria 2440
214 Ga0495587_0026670 3300046536 Bacteria 3522
215 Ga0495609_0172542 3300046538 Bacteria 913
216 Ga0495597_0074719 3300046542 Bacteria 1455
217 Ga0495645_0028032 3300046543 Bacteria 4092
218 Ga0495645_0075900 3300046543 Bacteria 2419
219 Ga0495622_0027024 3300046557 Bacteria 2678
220 Ga0495667_0032995 3300046559 Bacteria 3465
221 Ga0495668_0103535 3300046616 Bacteria 1557
222 Ga0495668_0271644 3300046616 Bacteria 929
223 Ga0495668_0618032 3300046616 Bacteria 599
224 Ga0495634_0030928 3300046642 Bacteria 3691
225 Ga0495634_0208690 3300046642 Bacteria 1210
226 Ga0495625_0259063 3300046660 Bacteria 1126
227 Ga0495625_0462202 3300046660 Bacteria 782
228 Ga0495635_0005943 3300046663 Bacteria 8515
229 Ga0495661_0405908 3300046665 Bacteria 662
230 Ga0495657_0017222 3300046675 Bacteria 5249
231 Ga0495657_0041743 3300046675 Bacteria 3137
232 Ga0495599_0006412 3300046678 Bacteria 7099
233 Ga0495623_0028036 3300046679 Bacteria 3625
234 Ga0495613_0078192 3300046689 Bacteria 2407
235 Ga0495613_0255038 3300046689 Bacteria 1223
236 Ga0495624_0256903 3300046690 Bacteria 1056
237 Ga0495649_0004412 3300046694 Bacteria 9195
238 Ga0495600_0007624 3300046809 Bacteria 6630
239 Ga0495600_0029114 3300046809 Bacteria 3575
240 Ga0495660_0272613 3300046810 Bacteria 777
241 Ga0495604_0053848 3300047317 Bacteria 3107
242 Ga0495674_0022083 3300047319 Bacteria 5874
243 Ga0495672_0049740 3300047320 Bacteria 2479
244 Ga0495676_0017114 3300047321 Bacteria 6414
245 Ga0495676_0342817 3300047321 Bacteria 1000
246 Ga0495680_0004791 3300047322 Bacteria 12843
247 Ga0495683_0106383 3300047323 Bacteria 1344
248 Ga0495683_0109795 3300047323 Bacteria 1318
249 Ga0495675_0025239 3300047444 Bacteria 3789
250 Ga0495673_0088371 3300047469 Bacteria 1270
251 Ga0495684_0578907 3300047471 Bacteria 760
252 Ga0495593_0474649 3300047673 Bacteria 626
253 Ga0495602_0010075 3300048088 Bacteria 9810
254 Ga0495626_0035288 3300048091 Bacteria 2388
255 Ga0495626_0249879 3300048091 Bacteria 712
256 Ga0496101_0803188 3300048904 Bacteria 742
257 Ga0496102_0012884 3300048905 Bacteria 7238
258 Ga0496102_0267712 3300048905 Bacteria 1611
259 Ga0496103_0203097 3300048906 Bacteria 1274
260 Ga0496104_0058187 3300048907 Bacteria 3658
261 Ga0496104_0302932 3300048907 Bacteria 1510
262 Ga0496105_0707638 3300048908 Bacteria 773
263 Ga0496108_0047007 3300048911 Bacteria 3607
264 Ga0496108_1112471 3300048911 Bacteria 671
265 Ga0496109_0291263 3300048912 Bacteria 1539
266 Ga0496110_0009234 3300048913 Bacteria 7970
267 Ga0496112_0500028 3300048915 Bacteria 1151
268 Ga0496113_0029907 3300048916 Bacteria 3938
269 Ga0496114_0073481 3300048917 Bacteria 2878
270 Ga0496114_0821967 3300048917 Bacteria 808
271 Ga0496118_0096177 3300048921 Bacteria 2019
272 Ga0496118_0119089 3300048921 Bacteria 1727
273 Ga0496119_0024691 3300048922 Bacteria 4220
274 Ga0496119_0059906 3300048922 Bacteria 2283
275 Ga0496119_0150738 3300048922 Bacteria 1246
276 Ga0496119_0236991 3300048922 Bacteria 926
277 Ga0496120_0043818 3300048923 Bacteria 2604
278 Ga0496120_0240313 3300048923 Bacteria 855
279 Ga0496121_0044500 3300048924 Bacteria 3828
280 Ga0496122_0125863 3300048925 Bacteria 1640
281 Ga0496123_0255499 3300048926 Bacteria 862
282 Ga0496124_0146718 3300048927 Bacteria 1856
283 Ga0496124_0664921 3300048927 Bacteria 666
284 Ga0496125_0128971 3300048928 Bacteria 1785
285 Ga0496125_0177720 3300048928 Bacteria 1422
286 Ga0496126_0043210 3300048929 Bacteria 4158
287 Ga0496126_0158676 3300048929 Bacteria 1934
288 Ga0495682_0053234 3300049460 Bacteria 1470
289 Ga0495682_0113908 3300049460 Bacteria 969
290 nmdc:mga03683_283239_c1 3300050489 Bacteria 775
291 nmdc:mga03n38_2092_c1 3300050490 Bacteria 6049
292 nmdc:mga00v17_30361_c1 3300050491 Bacteria 3180
293 nmdc:mga0yw44_1060531_c1 3300050492 Bacteria 548
294 nmdc:mga0yw44_26825_c1 3300050492 Bacteria 3294
295 nmdc:mga0yw44_341872_c1 3300050492 Bacteria 1007
296 nmdc:mga06z11_27833_c1 3300050494 Bacteria 2706
297 nmdc:mga06z11_303613_c1 3300050494 Bacteria 949
298 nmdc:mga04h51_395764_c1 3300050495 Bacteria 578
299 nmdc:mga07m45_411866_c1 3300050496 Bacteria 784
300 nmdc:mga0sz30_196202_c1 3300050516 Bacteria 896
301 nmdc:mga0sz30_327089_c1 3300050516 Bacteria 685
302 Ga0495601_0033204 3300053077 Bacteria 3215
303 Ga0495612_0017447 3300053078 Bacteria 2875
304 Ga0495655_0016983 3300053083 Bacteria 1578
305 Ga0495655_0047181 3300053083 Bacteria 1126
306 Ga0495619_0100853 3300053085 Bacteria 1965
307 Ga0500578_0566577 3300053086 Bacteria 629
308 Ga0500644_0116882 3300053088 Bacteria 1035
309 Ga0500646_0315289 3300053090 Bacteria 564
310 Ga0500647_0014674 3300053091 Bacteria 3567
311 Ga0500651_0149190 3300053093 Bacteria 1405
312 Ga0500566_0143710 3300053094 Bacteria 1263
313 Ga0500640_182907 3300053095 Bacteria 756
314 Ga0500557_000001 3300053105 Bacteria 241298
315 Ga0500562_045030 3300053108 Bacteria 1175
316 Ga0500572_109773 3300053111 Bacteria 887
317 Ga0500621_198098 3300053126 Bacteria 714
318 Ga0500559_0023662 3300053136 Bacteria 2608
319 Ga0500559_0306465 3300053136 Bacteria 745
320 Ga0500577_0010099 3300053142 Bacteria 2766
321 Ga0500590_145765 3300053148 Bacteria 1075
322 Ga0500590_165591 3300053148 Bacteria 979
323 Ga0500616_0013187 3300053153 Bacteria 4810
324 Ga0500638_112244 3300053162 Bacteria 1257
325 Ga0500636_0000116 3300053177 Bacteria 41607
326 Ga0500636_0296363 3300053177 Bacteria 799
327 Ga0500637_0467457 3300053178 Bacteria 635
328 Ga0500625_006844 3300053729 Bacteria 4898
329 Ga0500645_061105 3300053730 Bacteria 1090
330 Ga0500645_070498 3300053730 Bacteria 1003
331 Ga0500656_013722 3300053732 Bacteria 931
332 Ga0500552_083175 3300053733 Bacteria 590
333 Ga0587083_0147207 3300059505 Bacteria 633
334 2507509684 2507262055 Bacteria 8048963
335 2508543700 2508501009 Bacteria 7784016
336 2508698517 2508501042 Bacteria 8719808
337 2511398032 2511231028 Bacteria 8046582
338 2513628281 2513237092 Bacteria 8341956
339 2513641942 2513237094 Bacteria 8789602
340 2513646255 2513237095 Bacteria 8976980
341 2513706850 2513237102 Bacteria 7703324
342 2513875764 2513237139 Bacteria 8737671
343 2514016200 2513237161 Bacteria 8871253
344 2517103620 2517093001 Bacteria 9002274
345 2524442211 2524023205 Bacteria 8918781
346 2524464543 2524023210 Bacteria 9029266
347 2528855500 2528768022 Bacteria 10457665
348 2617349185 2617270735 Bacteria 9163226
349 2745079502 2744054633 Bacteria 8678936
350 2793060344 2791355196 Bacteria 7323613
351 2805917724 2802429603 Bacteria 8777136
352 2818241407 2816332527 Bacteria 8933356
353 2824610188 2824609381 Bacteria 8672835
354 2824623798 2824617872 Bacteria 8814715
355 2824627788 2824626560 Bacteria 8813858
356 2824639324 2824635225 Bacteria 8785348
357 2824646895 2824644064 Bacteria 8743947
358 2824656171 2824653114 Bacteria 8493680
359 2824672767 2824671348 Bacteria 8369588
360 2824693417 2824687955 Bacteria 8360029
361 2824698383 2824696289 Bacteria 8335049
362 2824720757 2824714736 Bacteria 8717648
363 2824730893 2824723954 Bacteria 8758240
364 2824735986 2824732956 Bacteria 7810675
365 2824746842 2824746037 Bacteria 7911610
366 2824773938 2824773399 Bacteria 8360218
367 2838130622 2838122688 Bacteria 8803140
368 2841941146 2841941048 Bacteria 8688029
369 2841957304 2841949485 Bacteria 8680857
370 2841962336 2841957949 Bacteria 8652217
371 2841967298 2841966195 Bacteria 8673214
372 2841979304 2841974524 Bacteria 8931498
373 2841989781 2841983080 Bacteria 8395090
374 2842038717 2842038055 Bacteria 8002051
375 2842048338 2842045827 Bacteria 8006841
376 2844318105 2844315083 Bacteria 8138177
377 2847934916 2847930680 Bacteria 9342022
378 2847945491 2847939898 Bacteria 8606328
379 2849080322 2849076700 Bacteria 7039503
380 2857510316 2857509624 Bacteria 7472071
381 2874595227 2874590934 Bacteria 8299676
382 2874613162 2874612657 Bacteria 8252029
383 2874620810 2874620515 Bacteria 8290088
384 2874636555 2874628541 Bacteria 8630250
385 2874651069 2874645413 Bacteria 8214782
386 2876775163 2876771140 Bacteria 8287509
387 2876823978 2876818435 Bacteria 8274608
388 2879080606 2879074833 Bacteria 8279565
389 2879086307 2879083081 Bacteria 8587928
390 2879109427 2879099564 Bacteria 10442239
391 2879134808 2879127579 Bacteria 8294491
392 2879149119 2879142872 Bacteria 8267021
393 2881366309 2881364244 Bacteria 7710352
394 2881672942 2881665667 Bacteria 8175609
395 2885372900 2885366525 Bacteria 8326213
396 2885389297 2885383462 Bacteria 9473874
397 2885416659 2885409591 Bacteria 9235467
398 2888382917 2888378607 Bacteria 9652610
399 2888394883 2888388044 Bacteria 7304136
400 2888423380 2888419890 Bacteria 7857137
401 2903733509 2903727486 Bacteria 8281579
402 2903776047 2903768456 Bacteria 9749579
403 2904666835 2904666416 Bacteria 8226587
404 2904716755 2904711408 Bacteria 9771557
405 2906608360 2906602504 Bacteria 8295279
406 2906628182 2906626472 Bacteria 8826946
407 2906649822 2906643746 Bacteria 8722424
408 2908779019 2908775508 Bacteria 8092255
409 2922395322 2922393267 Bacteria 8285685
410 2929615817 2929615660 Bacteria 9193770
411 2929630430 2929624759 Bacteria 9339455
412 2932792073 2932784394 Bacteria 9704911
413 2932796201 2932794094 Bacteria 7915132
414 2932804496 2932801729 Bacteria 7987968
415 2932814060 2932809354 Bacteria 9135765
416 2932819452 2932818245 Bacteria 9955613
417 2933578897 2933577622 Bacteria 9116884
418 2935611457 2935608549 Bacteria 8203142
419 2935618631 2935616580 Bacteria 9032984
420 2935657075 2935656913 Bacteria 8965014
421 2935765423 2935760218 Bacteria 9817913
422 2935776299 2935769743 Bacteria 7878163
423 2935784177 2935777560 Bacteria 8077691
424 2935790288 2935785616 Bacteria 7962367
425 2935798871 2935793552 Bacteria 8012592
426 2935805374 2935801545 Bacteria 9301974
427 2935820934 2935819856 Bacteria 8261050
428 2935850806 2935847175 Bacteria 8228321
429 2935856996 2935855204 Bacteria 9035059
430 2935890643 2935883170 Bacteria 7964738
431 2935913826 2935908558 Bacteria 8568796
432 2935920184 2935916978 Bacteria 9113783
433 2935930523 2935926038 Bacteria 8601059
434 2935939504 2935934488 Bacteria 8602579
435 2935946453 2935942939 Bacteria 8599779
436 2935955708 2935951376 Bacteria 8602333
437 2935964602 2935959822 Bacteria 7869783
438 2935972582 2935967501 Bacteria 8603075
439 2935989025 2935984226 Bacteria 8302647
440 2935997715 2935992306 Bacteria 9802711
441 2936011753 2936011229 Bacteria 8801034
442 2936020348 2936019824 Bacteria 8804134
443 2936029042 2936028420 Bacteria 8965941
444 2936047071 2936046547 Bacteria 8903709
445 2936061302 2936055302 Bacteria 8785755
446 2941535994 2941531003 Bacteria 7653939
447 3005489863 3005483717 Bacteria 7877331
448 3005507807 3005506211 Bacteria 6943378
449 3005590389 3005587118 Bacteria 7794411
450 3005598158 3005594810 Bacteria 8716512
451 3005713833 3005710791 Bacteria 7622528
452 3005721344 3005718088 Bacteria 8283608
453 8016530694 8016522445 Bacteria 8156687
454 8016535980 8016530956 Bacteria 8155261
455 8016540260 8016539877 Bacteria 8155419
456 8016552972 8016548790 Bacteria 8155074
457 8016561348 8016557553 Bacteria 8154380
458 8016574325 8016566248 Bacteria 8158151
459 8016578425 8016575299 Bacteria 8154085
460 8016591372 8016583857 Bacteria 10421953
461 8016599205 8016595262 Bacteria 8149947
462 8016611841 8016603502 Bacteria 8731218
463 8016621966 8016613128 Bacteria 8794220
464 8016627889 8016622563 Bacteria 7999408
465 8016632198 8016630954 Bacteria 9217207
466 8019535706 8019530166 Bacteria 8155624
467 8019555000 8019547302 Bacteria 7996444
468 8019581365 8019576017 Bacteria 10049540
469 8019588991 8019586578 Bacteria 10212056
470 8019602242 8019597564 Bacteria 10041141
471 8019616320 8019608314 Bacteria 10042931
472 8019626971 8019619141 Bacteria 9218857
473 8019644127 8019638758 Bacteria 9062356
474 8019657109 8019648815 Bacteria 10014479
475 8019663380 8019659431 Bacteria 8577854
476 8019672995 8019668869 Bacteria 8791617
477 8019683148 8019678201 Bacteria 8863603
478 8019688839 8019687851 Bacteria 8712826
479 8055747464 8055742211 Bacteria 9226248
480 8056685417 8056681323 Bacteria 8472857
481 8056972459 8056967851 Bacteria 9038162
482 JGI25160J50197_1025224
483 RicEn_C9518
484 JGI25153J46596_10001348
485 JGI25153J46596_10009440
486 JGI25153J46596_10024835
487 rootH1_10153166
488 JGI25161J50226_1011479
489 Ga0055526_1052389
490 Ga0055531_10017327
491 Ga0055543_1002556
492 Ga0065165_1001307
493 Ga0065165_1002964
494 Ga0065165_1026947
495 Ga0070683_100255947
496 Ga0070666_10078648
497 Ga0070660_100114823
498 Ga0070661_100320960
499 Ga0070671_100018504
500 Ga0070674_100689568
501 Ga0070659_100129944
502 Ga0070659_100617521
503 Ga0070659_100707057
504 Ga0070709_10006123
505 Ga0070713_100045895
506 Ga0070710_10002140
507 Ga0070663_100113822
508 Ga0068867_100126427
509 Ga0070684_100026429
510 Ga0068853_100268674
511 Ga0070665_100708683
512 Ga0070664_100914809
513 Ga0068857_101043871
514 Ga0068854_100209809
515 Ga0068856_100097246
516 Ga0068856_100199604
517 Ga0068852_100091779
518 Ga0068852_100318556
519 Ga0068858_100862421
520 Ga0081540_1108205
521 Ga0070717_10007455
522 Ga0075365_10009759
523 Ga0075365_10208919
524 Ga0075365_10414154
525 Ga0075368_10038060
526 Ga0075364_10024907
527 Ga0070715_10002301
528 Ga0070716_100038061
529 Ga0070716_100549073
530 Ga0070712_100006749
531 Ga0070712_100255292
532 Ga0075362_10329292
533 Ga0075362_10333893
534 Ga0075366_10008997
535 Ga0075366_10094214
536 Ga0075370_10106503
537 Ga0068865_101524267
538 Ga0099795_10018737
539 Ga0105240_10133696
540 Ga0105240_10375539
541 Ga0105240_10820105
542 Ga0105245_10439033
543 Ga0105247_10103227
544 Ga0105243_11523317
545 Ga0105241_10075397
546 Ga0105241_10140247
547 Ga0105241_10396042
548 Ga0105242_10755723
549 Ga0105242_11117486
550 Ga0105237_10001286
551 Ga0105237_10027577
552 Ga0105238_10170745
553 Ga0105249_10900405
554 Ga0105239_10031201
555 Ga0105239_10031496
556 Ga0105239_10045785
557 Ga0105246_10078956
558 Ga0157369_12405409
559 Ga0157374_10010318
560 Ga0157374_10584245
561 Ga0157378_10189744
562 Ga0163162_10689980
563 Ga0163162_11539581
564 Ga0163163_10041823
565 Ga0157380_11889755
566 Ga0182008_10490182
567 Ga0157377_10626763
568 Ga0157379_10187769
569 Ga0157376_10248265
570 Ga0182006_1074881
571 Ga0163161_10402705
572 Ga0207425_1089722
573 Ga0209148_1000354
574 Ga0209233_1026844
575 Ga0209233_1030087
576 Ga0209564_1033187
577 Ga0209758_1000164
578 Ga0209758_1000216
579 Ga0209758_1005195
580 Ga0209758_1024996
581 Ga0209758_1034307
582 Ga0209758_1136511
583 Ga0209256_1003991
584 Ga0209256_1056722
585 Ga0207426_1000580
586 Ga0207426_1006600
587 Ga0207426_1029990
588 Ga0209257_1001462
589 Ga0207692_10001180
590 Ga0207680_10538627
591 Ga0207647_10011289
592 Ga0207647_10328111
593 Ga0207685_10121391
594 Ga0207699_10004912
595 Ga0207645_10380958
596 Ga0207705_10123807
597 Ga0207654_10065552
598 Ga0207654_10088200
599 Ga0207695_10000342
600 Ga0207695_10311983
601 Ga0207671_10003865
602 Ga0207671_10011658
603 Ga0207693_10001050
604 Ga0207693_10089745
605 Ga0207663_10000235
606 Ga0207657_10191869
607 Ga0207649_10380154
608 Ga0207694_11036561
609 Ga0207700_10011527
610 Ga0207644_10232144
611 Ga0207690_10350084
612 Ga0207690_10518721
613 Ga0207690_11002487
614 Ga0207706_10361260
615 Ga0207709_10162879
616 Ga0207665_10000311
617 Ga0207665_10055607
618 Ga0207661_10007625
619 Ga0207679_10532922
620 Ga0207679_11452581
621 Ga0207667_10180672
622 Ga0207651_10327980
623 Ga0207703_11280691
624 Ga0207639_10380666
625 Ga0207639_10672379
626 Ga0207678_10054664
627 Ga0207702_10328752
628 Ga0207641_10530357
629 Ga0207648_10125938
630 Ga0207674_10276213
631 Ga0207698_10096607
632 Ga0207698_10260604
633 Ga0207698_11020257
634 Ga0307517_10000476
635 Ga0307515_10063492
636 Ga0307513_10363149
637 Ga0307508_10272914
638 Ga0307508_10332102
639 Ga0265314_10119680
640 Ga0373954_0192735
641 Ga0395899_0699563
642 Ga0395899_0834726
643 Ga0395900_0000488
644 Ga0395900_0799890
645 Ga0395898_0035229
646 Ga0395898_0386295
647 Ga0395905_0072729
648 Ga0395905_0117057
649 Ga0395905_0120521
650 Ga0395905_0160393
651 Ga0436364_1529710
652 Ga0395901_0368470
653 Ga0439465_0294132
654 Ga0451793_1313555
655 Ga0451833_1425521
656 Ga0451833_1456993
657 Ga0451849_0209777
658 Ga0451853_3834789
659 Ga0466969_0098541
660 Ga0466972_0000149
661 Ga0466965_0082548
662 Ga0466966_0000112
663 Ga0466961_0000082
664 Ga0466963_0102716
665 Ga0466964_0015092
666 Ga0466964_0172097
667 Ga0466968_0177312
668 Ga0466970_0124338
669 Ga0466960_0016956
670 Ga0466959_0016769
671 Ga0495592_0143038
672 Ga0495629_0001526
673 Ga0495638_0037407
674 Ga0495651_0012618
675 Ga0495653_0052497
676 Ga0495650_0094952
677 Ga0495605_0220578
678 Ga0495605_0405920
679 Ga0495664_0042622
680 Ga0495664_0342009
681 Ga0495585_0383512
682 Ga0495607_0107251
683 Ga0495583_0233887
684 Ga0495583_0297191
685 Ga0495606_0239390
686 Ga0495606_0370961
687 Ga0495608_0131689
688 Ga0495610_0183296
689 Ga0495616_0152160
690 Ga0495628_0227714
691 Ga0495643_0062868
692 Ga0495648_0023711
693 Ga0495648_0241750
694 Ga0495652_0094357
695 Ga0495587_0026670
696 Ga0495609_0172542
697 Ga0495597_0074719
698 Ga0495645_0028032
699 Ga0495645_0075900
700 Ga0495622_0027024
701 Ga0495667_0032995
702 Ga0495668_0103535
703 Ga0495668_0271644
704 Ga0495668_0618032
705 Ga0495634_0030928
706 Ga0495634_0208690
707 Ga0495625_0259063
708 Ga0495625_0462202
709 Ga0495635_0005943
710 Ga0495661_0405908
711 Ga0495657_0017222
712 Ga0495657_0041743
713 Ga0495599_0006412
714 Ga0495623_0028036
715 Ga0495613_0078192
716 Ga0495613_0255038
717 Ga0495624_0256903
718 Ga0495649_0004412
719 Ga0495600_0007624
720 Ga0495600_0029114
721 Ga0495660_0272613
722 Ga0495604_0053848
723 Ga0495674_0022083
724 Ga0495672_0049740
725 Ga0495676_0017114
726 Ga0495676_0342817
727 Ga0495680_0004791
728 Ga0495683_0106383
729 Ga0495683_0109795
730 Ga0495675_0025239
731 Ga0495673_0088371
732 Ga0495684_0578907
733 Ga0495593_0474649
734 Ga0495602_0010075
735 Ga0495626_0035288
736 Ga0495626_0249879
737 Ga0496101_0803188
738 Ga0496102_0012884
739 Ga0496102_0267712
740 Ga0496103_0203097
741 Ga0496104_0058187
742 Ga0496104_0302932
743 Ga0496105_0707638
744 Ga0496108_0047007
745 Ga0496108_1112471
746 Ga0496109_0291263
747 Ga0496110_0009234
748 Ga0496112_0500028
749 Ga0496113_0029907
750 Ga0496114_0073481
751 Ga0496114_0821967
752 Ga0496118_0096177
753 Ga0496118_0119089
754 Ga0496119_0024691
755 Ga0496119_0059906
756 Ga0496119_0150738
757 Ga0496119_0236991
758 Ga0496120_0043818
759 Ga0496120_0240313
760 Ga0496121_0044500
761 Ga0496122_0125863
762 Ga0496123_0255499
763 Ga0496124_0146718
764 Ga0496124_0664921
765 Ga0496125_0128971
766 Ga0496125_0177720
767 Ga0496126_0043210
768 Ga0496126_0158676
769 Ga0495682_0053234
770 Ga0495682_0113908
771 nmdc:mga03683_283239_c1
772 nmdc:mga03n38_2092_c1
773 nmdc:mga00v17_30361_c1
774 nmdc:mga0yw44_1060531_c1
775 nmdc:mga0yw44_26825_c1
776 nmdc:mga0yw44_341872_c1
777 nmdc:mga06z11_27833_c1
778 nmdc:mga06z11_303613_c1
779 nmdc:mga04h51_395764_c1
780 nmdc:mga07m45_411866_c1
781 nmdc:mga0sz30_196202_c1
782 nmdc:mga0sz30_327089_c1
783 Ga0495601_0033204
784 Ga0495612_0017447
785 Ga0495655_0016983
786 Ga0495655_0047181
787 Ga0495619_0100853
788 Ga0500578_0566577
789 Ga0500644_0116882
790 Ga0500646_0315289
791 Ga0500647_0014674
792 Ga0500651_0149190
793 Ga0500566_0143710
794 Ga0500640_182907
795 Ga0500557_000001
796 Ga0500562_045030
797 Ga0500572_109773
798 Ga0500621_198098
799 Ga0500559_0023662
800 Ga0500559_0306465
801 Ga0500577_0010099
802 Ga0500590_145765
803 Ga0500590_165591
804 Ga0500616_0013187
805 Ga0500638_112244
806 Ga0500636_0000116
807 Ga0500636_0296363
808 Ga0500637_0467457
809 Ga0500625_006844
810 Ga0500645_061105
811 Ga0500645_070498
812 Ga0500656_013722
813 Ga0500552_083175
814 Ga0587083_0147207
815 2507509684
816 2508543700
817 2508698517
818 2511398032
819 2513628281
820 2513641942
821 2513646255
822 2513706850
823 2513875764
824 2514016200
825 2517103620
826 2524442211
827 2524464543
828 2528855500
829 2617349185
830 2745079502
831 2793060344
832 2805917724
833 2818241407
834 2824610188
835 2824623798
836 2824627788
837 2824639324
838 2824646895
839 2824656171
840 2824672767
841 2824693417
842 2824698383
843 2824720757
844 2824730893
845 2824735986
846 2824746842
847 2824773938
848 2838130622
849 2841941146
850 2841957304
851 2841962336
852 2841967298
853 2841979304
854 2841989781
855 2842038717
856 2842048338
857 2844318105
858 2847934916
859 2847945491
860 2849080322
861 2857510316
862 2874595227
863 2874613162
864 2874620810
865 2874636555
866 2874651069
867 2876775163
868 2876823978
869 2879080606
870 2879086307
871 2879109427
872 2879134808
873 2879149119
874 2881366309
875 2881672942
876 2885372900
877 2885389297
878 2885416659
879 2888382917
880 2888394883
881 2888423380
882 2903733509
883 2903776047
884 2904666835
885 2904716755
886 2906608360
887 2906628182
888 2906649822
889 2908779019
890 2922395322
891 2929615817
892 2929630430
893 2932792073
894 2932796201
895 2932804496
896 2932814060
897 2932819452
898 2933578897
899 2935611457
900 2935618631
901 2935657075
902 2935765423
903 2935776299
904 2935784177
905 2935790288
906 2935798871
907 2935805374
908 2935820934
909 2935850806
910 2935856996
911 2935890643
912 2935913826
913 2935920184
914 2935930523
915 2935939504
916 2935946453
917 2935955708
918 2935964602
919 2935972582
920 2935989025
921 2935997715
922 2936011753
923 2936020348
924 2936029042
925 2936047071
926 2936061302
927 2941535994
928 3005489863
929 3005507807
930 3005590389
931 3005598158
932 3005713833
933 3005721344
934 8016530694
935 8016535980
936 8016540260
937 8016552972
938 8016561348
939 8016574325
940 8016578425
941 8016591372
942 8016599205
943 8016611841
944 8016621966
945 8016627889
946 8016632198
947 8019535706
948 8019555000
949 8019581365
950 8019588991
951 8019602242
952 8019616320
953 8019626971
954 8019644127
955 8019657109
956 8019663380
957 8019672995
958 8019683148
959 8019688839
960 8055747464
961 8056685417
962 8056972459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map