F452290

General Info

Members Datasets Scaffolds Average Seq Length
480 288 442 205

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0026466|Ga0496121_0026466_4447_5118
Length 223
Sequence MKPVIHIVDDDESFRTATARLLSAFGLKIEAYESGDQFLDRLPTCEPGCVLLDLQMPGLSGPQVQHRLSALAPLIPVVFLTGEGDIKAGVDAMKAGAQDFLEKTSSAAVLMEAIERALAQYERRRAEHEHLQKLRALVASLSAREAEVFGLIIRGHLNKQIAYALGISERTVKVHRHQVMEKLAAKSLAEVVSIAADIGRTATPGDRTISPKGNINRPPTRLE

Samples

Sample ID Description Type Environment
1 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
4 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
5 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
6 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
7 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
8 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
9 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
10 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
11 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
12 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
13 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
14 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
15 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
16 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
17 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
18 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
19 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
20 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
21 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
22 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
23 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
24 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
25 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
26 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
27 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
28 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
29 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
30 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
31 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
32 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
33 2996887358 Rhizobium sp. R711 Isolate Nodule
34 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
35 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
36 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
37 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
38 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
42 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
43 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
205 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
208 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
209 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
258 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
259 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
260 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
263 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
264 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
265 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
266 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
267 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
268 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
269 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
270 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
281 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
282 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
287 8005321885 Rhizobium sp. R72 Isolate Nodule
288 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.08
Metatranscriptomes 0
Isolates 7.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.88
Nodule 5.42
Rhizoplane 2.08
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1001050 3300000532 Bacteria 2543
2 JGI24738J21930_10021743 3300002075 Bacteria 1329
3 JGI24749J21850_1032112 3300002076 Bacteria 756
4 JGI24751J29686_10000105 3300002459 Bacteria 46193
5 JGI25158J39367_1000013 3300002739 Bacteria 48114
6 JGI25158J39367_1001757 3300002739 Bacteria 3699
7 JGI25152J39213_1000013 3300002773 Bacteria 123999
8 JGI25152J39213_1001029 3300002773 Bacteria 13314
9 JGI25152J39213_1005751 3300002773 Bacteria 3534
10 JGI25150J39212_1000888 3300002774 Bacteria 9826
11 JGI25150J39212_1009391 3300002774 Bacteria 1865
12 JGI25159J45721_1000096 3300002987 Bacteria 41782
13 JGI25159J45721_1000150 3300002987 Bacteria 32467
14 JGI25151J46595_10046356 3300003187 Bacteria 1524
15 JGI25406J46586_10001336 3300003203 Bacteria 11607
16 JGI25153J46596_10000274 3300003215 Bacteria 40645
17 JGI25153J46596_10000921 3300003215 Bacteria 17846
18 JGI25153J46596_10005635 3300003215 Bacteria 6540
19 JGI25153J46596_10006785 3300003215 Bacteria 5735
20 JGI25160J50197_1000070 3300003354 Bacteria 110748
21 JGI25160J50197_1036782 3300003354 Bacteria 1181
22 JGI25161J50226_1000026 3300003374 Bacteria 146134
23 Ga0055526_1000399 3300003771 Bacteria 35090
24 Ga0055526_1018835 3300003771 Bacteria 2550
25 Ga0055524_1002617 3300003775 Bacteria 9156
26 Ga0055524_1007449 3300003775 Bacteria 4644
27 Ga0055524_1013393 3300003775 Bacteria 3092
28 Ga0055524_1031051 3300003775 Bacteria 1544
29 Ga0055528_1002785 3300003790 Bacteria 9157
30 Ga0055528_1004215 3300003790 Bacteria 6973
31 Ga0055528_1008230 3300003790 Bacteria 4504
32 Ga0055528_1022857 3300003790 Bacteria 1930
33 Ga0055540_1001297 3300003792 Bacteria 15123
34 Ga0055543_1000042 3300004625 Bacteria 117438
35 Ga0065165_1000512 3300005262 Bacteria 59678
36 Ga0065714_10193893 3300005288 Bacteria 918
37 Ga0065704_10195253 3300005289 Bacteria 1171
38 Ga0065712_10013303 3300005290 Bacteria 2472
39 Ga0065712_10016348 3300005290 Bacteria 2163
40 Ga0065712_10071206 3300005290 Bacteria 5398
41 Ga0065715_10003193 3300005293 Bacteria 7800
42 Ga0065715_10090932 3300005293 Bacteria 6301
43 Ga0065707_10447692 3300005295 Bacteria 803
44 Ga0070670_100000084 3300005331 Bacteria 90455
45 Ga0070670_100726244 3300005331 Bacteria 894
46 Ga0068869_100728508 3300005334 Bacteria 848
47 Ga0070682_100008161 3300005337 Bacteria 5905
48 Ga0070689_100000672 3300005340 Bacteria 20694
49 Ga0070689_100140680 3300005340 Bacteria 1941
50 Ga0070661_101029468 3300005344 Bacteria 684
51 Ga0070692_10158096 3300005345 Bacteria 1296
52 Ga0070669_100405958 3300005353 Bacteria 1115
53 Ga0070669_100434519 3300005353 Bacteria 1079
54 Ga0070671_100275234 3300005355 Bacteria 1431
55 Ga0070667_100769433 3300005367 Bacteria 893
56 Ga0070701_10186517 3300005438 Bacteria 1218
57 Ga0070705_100172479 3300005440 Bacteria 1457
58 Ga0070700_100000022 3300005441 Bacteria 130126
59 Ga0070700_100016229 3300005441 Unclassified 4240
60 Ga0070700_100016363 3300005441 Bacteria 4224
61 Ga0070700_100308432 3300005441 Bacteria 1158
62 Ga0070694_100044272 3300005444 Bacteria 2978
63 Ga0070694_100072173 3300005444 Bacteria 2381
64 Ga0070694_100762071 3300005444 Bacteria 791
65 Ga0070663_100235297 3300005455 Bacteria 1444
66 Ga0070662_100029570 3300005457 Bacteria 3825
67 Ga0070681_10044376 3300005458 Bacteria 4449
68 Ga0070681_10112059 3300005458 Bacteria 2668
69 Ga0068867_100206519 3300005459 Bacteria 1575
70 Ga0070706_100000030 3300005467 Bacteria 153754
71 Ga0070706_100754498 3300005467 Bacteria 901
72 Ga0070707_100031050 3300005468 Bacteria 5088
73 Ga0070698_100007778 3300005471 Bacteria 11601
74 Ga0070698_100533212 3300005471 Bacteria 1112
75 Ga0070699_100008566 3300005518 Bacteria 8861
76 Ga0070699_100018657 3300005518 Bacteria 5957
77 Ga0070699_100952551 3300005518 Bacteria 787
78 Ga0070697_100225597 3300005536 Bacteria 1597
79 Ga0068853_100021415 3300005539 Bacteria 5390
80 Ga0070695_100035721 3300005545 Unclassified 3123
81 Ga0070695_100277753 3300005545 Bacteria 1229
82 Ga0070696_100253502 3300005546 Bacteria 1332
83 Ga0070696_100351295 3300005546 Bacteria 1142
84 Ga0070693_100195204 3300005547 Bacteria 1311
85 Ga0070693_100522853 3300005547 Bacteria 845
86 Ga0070704_100102928 3300005549 Bacteria 2156
87 Ga0070664_100120423 3300005564 Bacteria 2297
88 Ga0070664_100441312 3300005564 Bacteria 1194
89 Ga0070664_100547701 3300005564 Bacteria 1070
90 Ga0068857_100179364 3300005577 Bacteria 1927
91 Ga0068857_100185382 3300005577 Bacteria 1894
92 Ga0068857_100454521 3300005577 Bacteria 1198
93 Ga0070702_100004999 3300005615 Bacteria 6122
94 Ga0070702_100009407 3300005615 Unclassified 4780
95 Ga0070702_100430672 3300005615 Bacteria 952
96 Ga0068852_100872768 3300005616 Bacteria 916
97 Ga0068859_100003692 3300005617 Bacteria 15603
98 Ga0068859_100019600 3300005617 Bacteria 6795
99 Ga0068859_100075322 3300005617 Bacteria 3415
100 Ga0068859_100100953 3300005617 Bacteria 2941
101 Ga0068859_100107539 3300005617 Bacteria 2849
102 Ga0068859_100142113 3300005617 Bacteria 2474
103 Ga0068859_100242595 3300005617 Bacteria 1891
104 Ga0068859_100274909 3300005617 Bacteria 1777
105 Ga0068859_100561619 3300005617 Bacteria 1235
106 Ga0068859_100679245 3300005617 Bacteria 1121
107 Ga0068864_100000966 3300005618 Bacteria 24106
108 Ga0068864_100002707 3300005618 Bacteria 14591
109 Ga0068864_100094613 3300005618 Bacteria 2641
110 Ga0068864_100203021 3300005618 Bacteria 1822
111 Ga0068864_100374276 3300005618 Bacteria 1348
112 Ga0068864_100388060 3300005618 Bacteria 1325
113 Ga0068866_10190186 3300005718 Bacteria 1219
114 Ga0068861_100009423 3300005719 Bacteria 6740
115 Ga0068861_100209658 3300005719 Bacteria 1640
116 Ga0068870_10129588 3300005840 Bacteria 1464
117 Ga0068863_100031974 3300005841 Bacteria 5018
118 Ga0068863_100224193 3300005841 Bacteria 1812
119 Ga0068863_100967879 3300005841 Bacteria 853
120 Ga0068858_100184148 3300005842 Bacteria 1972
121 Ga0068860_100013632 3300005843 Bacteria 7967
122 Ga0068860_100068948 3300005843 Bacteria 3361
123 Ga0068860_100120489 3300005843 Bacteria 2512
124 Ga0068860_100340564 3300005843 Bacteria 1474
125 Ga0068860_100703007 3300005843 Bacteria 1021
126 Ga0068862_100034441 3300005844 Bacteria 4285
127 Ga0068862_100109215 3300005844 Bacteria 2426
128 Ga0081539_10000318 3300005985 Bacteria 107294
129 Ga0081539_10021226 3300005985 Bacteria 4348
130 Ga0075365_10015262 3300006038 Bacteria 4642
131 Ga0075363_100057226 3300006048 Bacteria 2092
132 Ga0075363_100335552 3300006048 Bacteria 881
133 Ga0075364_10346615 3300006051 Bacteria 1012
134 Ga0070716_100020196 3300006173 Bacteria 3494
135 Ga0075362_10011651 3300006177 Bacteria 3470
136 Ga0075367_10039964 3300006178 Bacteria 2738
137 Ga0075367_10061582 3300006178 Bacteria 2240
138 Ga0075369_10038271 3300006186 Bacteria 2046
139 Ga0097621_100011732 3300006237 Bacteria 6471
140 Ga0097621_100217420 3300006237 Bacteria 1664
141 Ga0075370_10226283 3300006353 Bacteria 1106
142 Ga0068871_100012564 3300006358 Bacteria 6251
143 Ga0075431_100363202 3300006847 Bacteria 1454
144 Ga0075433_10019739 3300006852 Bacteria 5623
145 Ga0075433_10020458 3300006852 Bacteria 5533
146 Ga0075434_100034951 3300006871 Bacteria 4967
147 Ga0075434_100332626 3300006871 Bacteria 1539
148 Ga0068865_100439040 3300006881 Bacteria 1077
149 Ga0075436_100013287 3300006914 Bacteria 5640
150 Ga0097620_100003692 3300006931 Bacteria 15603
151 Ga0097620_100019600 3300006931 Bacteria 6795
152 Ga0097620_100075322 3300006931 Bacteria 3415
153 Ga0097620_100100953 3300006931 Bacteria 2941
154 Ga0097620_100107545 3300006931 Bacteria 2849
155 Ga0097620_100142123 3300006931 Bacteria 2474
156 Ga0097620_100242584 3300006931 Bacteria 1891
157 Ga0097620_100274920 3300006931 Bacteria 1777
158 Ga0097620_100561611 3300006931 Bacteria 1235
159 Ga0097620_100679279 3300006931 Bacteria 1121
160 Ga0105251_10062811 3300009011 Bacteria 1743
161 Ga0105250_10068697 3300009092 Bacteria 1430
162 Ga0105240_10584086 3300009093 Bacteria 1232
163 Ga0111539_10081241 3300009094 Bacteria 3813
164 Ga0105247_10000485 3300009101 Bacteria 33190
165 Ga0105247_10262205 3300009101 Bacteria 1185
166 Ga0105247_10301296 3300009101 Bacteria 1112
167 Ga0114129_11227645 3300009147 Bacteria 932
168 Ga0105243_10013673 3300009148 Bacteria 6141
169 Ga0105241_10299385 3300009174 Bacteria 1380
170 Ga0105241_10695547 3300009174 Bacteria 928
171 Ga0105242_10196181 3300009176 Bacteria 1790
172 Ga0105248_10000655 3300009177 Bacteria 39350
173 Ga0105248_10032288 3300009177 Bacteria 5853
174 Ga0105248_10068465 3300009177 Bacteria 3985
175 Ga0105248_10108093 3300009177 Unclassified 3137
176 Ga0105248_10173200 3300009177 Bacteria 2433
177 Ga0105248_10215313 3300009177 Bacteria 2164
178 Ga0105248_10328782 3300009177 Bacteria 1722
179 Ga0105248_10399801 3300009177 Bacteria 1547
180 Ga0105237_10040656 3300009545 Bacteria 4689
181 Ga0105237_10253342 3300009545 Unclassified 1762
182 Ga0105237_10746921 3300009545 Bacteria 985
183 Ga0105249_10171950 3300009553 Bacteria 2102
184 Ga0105249_10476866 3300009553 Bacteria 1290
185 Ga0105249_11657769 3300009553 Bacteria 712
186 Ga0123342_1015230 3300009766 Bacteria 7069
187 Ga0105246_10049940 3300011119 Bacteria 2867
188 Ga0105246_10626363 3300011119 Bacteria 933
189 Ga0157373_10004405 3300013100 Bacteria 10607
190 Ga0157373_10078432 3300013100 Bacteria 2329
191 Ga0157378_10726078 3300013297 Bacteria 1014
192 Ga0163162_10048624 3300013306 Unclassified 4250
193 Ga0163162_10143881 3300013306 Bacteria 2499
194 Ga0157375_10064948 3300013308 Bacteria 3636
195 Ga0157375_10212012 3300013308 Bacteria 2094
196 Ga0157375_10391810 3300013308 Bacteria 1556
197 Ga0157375_10780612 3300013308 Bacteria 1105
198 Ga0163163_10000087 3300014325 Bacteria 101689
199 Ga0157380_10315501 3300014326 Bacteria 1447
200 Ga0182008_10158708 3300014497 Bacteria 1137
201 Ga0157377_10048684 3300014745 Bacteria 2380
202 Ga0157379_10089860 3300014968 Unclassified 2755
203 Ga0157379_10219638 3300014968 Bacteria 1722
204 Ga0157379_10729514 3300014968 Bacteria 932
205 Ga0182005_1014567 3300015265 Bacteria 2200
206 Ga0209436_100036 3300025208 Bacteria 78433
207 Ga0207425_1000558 3300025245 Bacteria 22120
208 Ga0207425_1016745 3300025245 Bacteria 1623
209 Ga0209129_1000092 3300025258 Bacteria 173874
210 Ga0209129_1001292 3300025258 Bacteria 14279
211 Ga0209129_1004600 3300025258 Bacteria 5293
212 Ga0209129_1008730 3300025258 Bacteria 2776
213 Ga0209673_1000987 3300025273 Bacteria 34806
214 Ga0209673_1001517 3300025273 Bacteria 21321
215 Ga0209673_1002574 3300025273 Bacteria 12298
216 Ga0209673_1018136 3300025273 Bacteria 2571
217 Ga0209130_1000073 3300025284 Bacteria 174439
218 Ga0209025_1019238 3300025294 Bacteria 3808
219 Ga0209564_1000168 3300025295 Bacteria 158368
220 Ga0209564_1007059 3300025295 Bacteria 5880
221 Ga0209564_1008973 3300025295 Bacteria 4841
222 Ga0209564_1029348 3300025295 Bacteria 1733
223 Ga0209564_1062617 3300025295 Bacteria 822
224 Ga0209758_1000201 3300025297 Bacteria 132855
225 Ga0209758_1000478 3300025297 Bacteria 66097
226 Ga0209758_1003012 3300025297 Bacteria 16111
227 Ga0209758_1003382 3300025297 Bacteria 14599
228 Ga0209758_1011037 3300025297 Bacteria 5293
229 Ga0209256_1000453 3300025299 Bacteria 62097
230 Ga0209256_1002173 3300025299 Bacteria 16844
231 Ga0209256_1003114 3300025299 Bacteria 12132
232 Ga0209256_1009233 3300025299 Bacteria 4364
233 Ga0209256_1010362 3300025299 Bacteria 3919
234 Ga0209256_1016960 3300025299 Bacteria 2449
235 Ga0207426_1000140 3300025302 Bacteria 195664
236 Ga0207426_1007207 3300025302 Bacteria 4689
237 Ga0209051_1000922 3300025303 Bacteria 29178
238 Ga0209051_1007691 3300025303 Bacteria 5848
239 Ga0209257_1003613 3300025304 Bacteria 13032
240 Ga0207710_10002475 3300025900 Bacteria 8552
241 Ga0207647_10061373 3300025904 Unclassified 2295
242 Ga0207643_10000702 3300025908 Bacteria 20863
243 Ga0207643_10007230 3300025908 Bacteria 5960
244 Ga0207684_10000089 3300025910 Bacteria 172593
245 Ga0207707_10093590 3300025912 Bacteria 2625
246 Ga0207707_10350806 3300025912 Bacteria 1271
247 Ga0207671_10228572 3300025914 Bacteria 1459
248 Ga0207660_10097790 3300025917 Bacteria 2188
249 Ga0207660_10599941 3300025917 Bacteria 897
250 Ga0207662_10424973 3300025918 Bacteria 905
251 Ga0207646_10134859 3300025922 Bacteria 2223
252 Ga0207681_10497074 3300025923 Bacteria 998
253 Ga0207694_10024981 3300025924 Bacteria 4540
254 Ga0207694_10035404 3300025924 Unclassified 3830
255 Ga0207650_10000017 3300025925 Bacteria 354674
256 Ga0207650_10210660 3300025925 Bacteria 1560
257 Ga0207650_10469346 3300025925 Bacteria 1049
258 Ga0207650_10594027 3300025925 Bacteria 930
259 Ga0207687_10340491 3300025927 Bacteria 1219
260 Ga0207644_10687441 3300025931 Bacteria 853
261 Ga0207706_10037793 3300025933 Bacteria 4285
262 Ga0207709_10005093 3300025935 Bacteria 7502
263 Ga0207670_10000363 3300025936 Bacteria 26417
264 Ga0207665_10023779 3300025939 Bacteria 4035
265 Ga0207691_10529779 3300025940 Bacteria 999
266 Ga0207711_10002379 3300025941 Bacteria 16838
267 Ga0207711_10067632 3300025941 Unclassified 3093
268 Ga0207711_10432621 3300025941 Bacteria 1224
269 Ga0207711_10508826 3300025941 Bacteria 1122
270 Ga0207689_10029366 3300025942 Bacteria 4593
271 Ga0207689_10063656 3300025942 Bacteria 3034
272 Ga0207679_10069677 3300025945 Bacteria 2647
273 Ga0207679_10199912 3300025945 Bacteria 1669
274 Ga0207679_10544671 3300025945 Bacteria 1040
275 Ga0207651_10510102 3300025960 Bacteria 1041
276 Ga0207651_10847169 3300025960 Bacteria 812
277 Ga0207712_10012346 3300025961 Bacteria 5458
278 Ga0207712_10621369 3300025961 Bacteria 937
279 Ga0207703_10223704 3300026035 Bacteria 1684
280 Ga0207703_10512248 3300026035 Bacteria 1127
281 Ga0207703_10550196 3300026035 Bacteria 1088
282 Ga0207639_10096990 3300026041 Unclassified 2373
283 Ga0207639_10289455 3300026041 Bacteria 1444
284 Ga0207639_10718359 3300026041 Bacteria 928
285 Ga0207708_10000040 3300026075 Bacteria 130242
286 Ga0207708_10013055 3300026075 Bacteria 6199
287 Ga0207708_10029094 3300026075 Bacteria 4185
288 Ga0207708_10337770 3300026075 Bacteria 1233
289 Ga0207641_10011098 3300026088 Bacteria 7390
290 Ga0207641_10145739 3300026088 Bacteria 2141
291 Ga0207641_10588339 3300026088 Bacteria 1088
292 Ga0207648_10085242 3300026089 Bacteria 2756
293 Ga0207648_10102557 3300026089 Bacteria 2508
294 Ga0207648_10104969 3300026089 Bacteria 2478
295 Ga0207648_10189164 3300026089 Bacteria 1824
296 Ga0207676_10001172 3300026095 Bacteria 19681
297 Ga0207676_10030410 3300026095 Bacteria 4054
298 Ga0207676_10257910 3300026095 Bacteria 1573
299 Ga0207676_10442453 3300026095 Bacteria 1224
300 Ga0207674_10086550 3300026116 Bacteria 3128
301 Ga0207674_10094374 3300026116 Bacteria 2978
302 Ga0207674_10363313 3300026116 Bacteria 1399
303 Ga0207674_10419267 3300026116 Bacteria 1293
304 Ga0207674_10490530 3300026116 Bacteria 1187
305 Ga0207674_10542585 3300026116 Bacteria 1123
306 Ga0207674_10586971 3300026116 Bacteria 1076
307 Ga0207674_11259009 3300026116 Bacteria 709
308 Ga0207675_100054897 3300026118 Bacteria 3716
309 Ga0207428_10034189 3300027907 Bacteria 4168
310 Ga0207428_10127427 3300027907 Bacteria 1949
311 Ga0268266_10315321 3300028379 Bacteria 1462
312 Ga0268265_10232675 3300028380 Bacteria 1621
313 Ga0268264_10027444 3300028381 Bacteria 4652
314 Ga0268264_10110904 3300028381 Bacteria 2403
315 Ga0268264_10119907 3300028381 Bacteria 2317
316 Ga0268264_10162257 3300028381 Bacteria 2014
317 Ga0268264_10776253 3300028381 Bacteria 956
318 Ga0268264_10806367 3300028381 Bacteria 938
319 Ga0307408_100083344 3300031548 Bacteria 2395
320 Ga0307410_10047541 3300031852 Bacteria 2868
321 Ga0307406_10034704 3300031901 Unclassified 3096
322 Ga0307406_10042208 3300031901 Bacteria 2847
323 Ga0307407_10026914 3300031903 Unclassified 3053
324 Ga0307412_10141974 3300031911 Bacteria 1760
325 Ga0307412_10470322 3300031911 Unclassified 1040
326 Ga0307416_100027314 3300032002 Bacteria 4224
327 Ga0307414_10008139 3300032004 Bacteria 5926
328 Ga0307411_10023928 3300032005 Bacteria 3630
329 Ga0373940_0070640 3300035088 Bacteria 1016
330 Ga0373951_0001507 3300035091 Bacteria 6086
331 Ga0373951_0027446 3300035091 Bacteria 1330
332 Ga0373942_0017569 3300035207 Bacteria 1765
333 Ga0373931_0109880 3300035691 Bacteria 1563
334 Ga0395900_0249272 3300037418 Bacteria 1778
335 Ga0395898_0064428 3300037466 Bacteria 3555
336 Ga0395898_0146641 3300037466 Bacteria 2259
337 Ga0395901_0128406 3300038443 Bacteria 2665
338 Ga0242419_000450 3300038698 Bacteria 2224
339 Ga0439465_0002462 3300041413 Bacteria 6049
340 Ga0451833_0751857 3300041491 Bacteria 1585
341 Ga0451835_1015531 3300041492 Bacteria 1075
342 Ga0451839_0708773 3300041496 Bacteria 1838
343 Ga0451841_0488093 3300041498 Bacteria 918
344 Ga0451845_0694552 3300041501 Bacteria 1044
345 Ga0451847_0783174 3300041503 Bacteria 1146
346 Ga0451849_0137645 3300041505 Bacteria 2419
347 Ga0451853_0158421 3300041512 Bacteria 2475
348 Ga0439455_0000863 3300042012 Bacteria 4657
349 Ga0439458_0004499 3300042157 Bacteria 3195
350 Ga0453683_0077146 3300044673 Bacteria 2087
351 Ga0451576_0195679 3300045051 Bacteria 2112
352 Ga0451576_0407537 3300045051 Bacteria 1426
353 Ga0495603_0370176 3300046455 Bacteria 822
354 Ga0495605_0081064 3300046474 Bacteria 1518
355 Ga0495607_0187171 3300046501 Bacteria 1034
356 Ga0495583_0001269 3300046506 Bacteria 26443
357 Ga0495606_0118655 3300046507 Bacteria 1586
358 Ga0495610_0006663 3300046512 Bacteria 7872
359 Ga0495610_0040666 3300046512 Bacteria 2341
360 Ga0495620_0033178 3300046515 Bacteria 2346
361 Ga0495620_0051034 3300046515 Bacteria 1762
362 Ga0495632_0037823 3300046519 Bacteria 2446
363 Ga0495643_0002519 3300046522 Bacteria 14375
364 Ga0495643_0005826 3300046522 Bacteria 8244
365 Ga0495648_0017065 3300046524 Bacteria 5207
366 Ga0495648_0127196 3300046524 Bacteria 1360
367 Ga0495654_0091773 3300046530 Bacteria 1408
368 Ga0495633_0028010 3300046558 Bacteria 2748
369 Ga0495633_0164703 3300046558 Bacteria 1022
370 Ga0495656_0004528 3300046615 Bacteria 4763
371 Ga0495625_0009254 3300046660 Bacteria 8266
372 Ga0495625_0035832 3300046660 Bacteria 3653
373 Ga0495661_0050330 3300046665 Bacteria 2523
374 Ga0495661_0284242 3300046665 Unclassified 833
375 Ga0495588_0020825 3300046674 Bacteria 3227
376 Ga0495670_0177776 3300046691 Bacteria 1123
377 Ga0495649_0116251 3300046694 Bacteria 1416
378 Ga0495589_0097800 3300046794 Bacteria 1422
379 Ga0495660_0012788 3300046810 Bacteria 4869
380 Ga0495636_0162968 3300047318 Bacteria 1005
381 Ga0495672_0222950 3300047320 Bacteria 930
382 Ga0495687_003201 3300047443 Bacteria 12134
383 Ga0495686_0123218 3300047472 Bacteria 1543
384 Ga0496101_0231730 3300048904 Bacteria 1436
385 Ga0496104_0007015 3300048907 Bacteria 9934
386 Ga0496105_0014149 3300048908 Bacteria 6348
387 Ga0496106_0000502 3300048909 Bacteria 27728
388 Ga0496107_0912603 3300048910 Bacteria 640
389 Ga0496111_0318091 3300048914 Bacteria 1153
390 Ga0496111_0364971 3300048914 Bacteria 1069
391 Ga0496112_0216699 3300048915 Bacteria 1871
392 Ga0496112_0263398 3300048915 Bacteria 1673
393 Ga0496113_0368606 3300048916 Bacteria 1153
394 Ga0496116_0040023 3300048919 Bacteria 3232
395 Ga0496116_0097132 3300048919 Bacteria 1772
396 Ga0496117_0149028 3300048920 Bacteria 1388
397 Ga0496117_0231478 3300048920 Bacteria 1021
398 Ga0496119_0076464 3300048922 Bacteria 1942
399 Ga0496121_0026466 3300048924 Bacteria 5464
400 Ga0496122_0032658 3300048925 Bacteria 4299
401 Ga0496122_0055874 3300048925 Bacteria 2949
402 Ga0496123_0035998 3300048926 Bacteria 3518
403 Ga0496124_0002913 3300048927 Bacteria 21577
404 Ga0496124_0031042 3300048927 Bacteria 4733
405 Ga0496125_0073153 3300048928 Bacteria 2667
406 Ga0496125_0116955 3300048928 Bacteria 1913
407 Ga0496126_0454436 3300048929 Bacteria 1030
408 Ga0501292_012473 3300049515 Bacteria 1297
409 Ga0501298_010359 3300049521 Bacteria 1603
410 Ga0501298_020930 3300049521 Bacteria 1222
411 Ga0501214_003003 3300049659 Bacteria 1463
412 Ga0501216_004140 3300049660 Bacteria 2143
413 Ga0501217_000720 3300049661 Bacteria 5701
414 Ga0501224_002755 3300049664 Unclassified 2422
415 Ga0501227_001412 3300049665 Bacteria 5375
416 Ga0501235_011348 3300049669 Bacteria 1953
417 Ga0501257_004353 3300049686 Bacteria 3089
418 Ga0501259_004615 3300049688 Bacteria 2188
419 Ga0501225_0030566 3300049705 Bacteria 1481
420 Ga0501229_005042 3300049706 Unclassified 1613
421 Ga0501234_000670 3300049707 Bacteria 5290
422 Ga0501273_009853 3300049770 Bacteria 1166
423 nmdc:mga06z11_19785_c1 3300050494 Bacteria 3102
424 nmdc:mga06z11_38630_c1 3300050494 Bacteria 2372
425 nmdc:mga07m45_219479_c1 3300050496 Bacteria 1106
426 nmdc:mga05p37_476736_c1 3300050507 Bacteria 1438
427 nmdc:mga06r32_1083572_c1 3300050510 Unclassified 751
428 nmdc:mga06r32_361057_c1 3300050510 Bacteria 1436
429 nmdc:mga08y16_112811_c1 3300050511 Bacteria 2830
430 nmdc:mga08y16_83900_c1 3300050511 Bacteria 3321
431 nmdc:mga0n895_298384_c1 3300050512 Bacteria 1633
432 nmdc:mga0n895_572710_c1 3300050512 Bacteria 1134
433 nmdc:mga0rr50_974736_c1 3300050513 Bacteria 722
434 nmdc:mga08x19_78583_c1 3300050514 Bacteria 2163
435 nmdc:mga0a205_223559_c1 3300050515 Unclassified 1768
436 nmdc:mga0a205_259746_c1 3300050515 Bacteria 1615
437 Ga0500578_0024063 3300053086 Bacteria 3912
438 Ga0500569_002908 3300053109 Bacteria 3431
439 Ga0500577_0242960 3300053142 Bacteria 782
440 Ga0500616_0008580 3300053153 Bacteria 6328
441 Ga0500622_0000104 3300053156 Bacteria 85867
442 Ga0530510_0160620 3300061734 Bacteria 1662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0002913 Ga0496124_0002913_2505_3062 169
2 3300046474 Ga0495605_0081064 Ga0495605_0081064_481_1113 171
3 3300048920 Ga0496117_0231478 Ga0496117_0231478_456_1010 178
4 3300046665 Ga0495661_0284242 Ga0495661_0284242_215_787 179
5 3300006178 Ga0075367_10061582 Ga0075367_100615823 184
6 3300050494 nmdc:mga06z11_38630_c1 nmdc:mga06z11_38630_c1_1090_1719 184
7 3300041491 Ga0451833_0751857 Ga0451833_0751857_813_1445 187
8 3300041492 Ga0451835_1015531 Ga0451835_1015531_303_935 187
9 3300041498 Ga0451841_0488093 Ga0451841_0488093_146_778 187
10 3300041501 Ga0451845_0694552 Ga0451845_0694552_322_954 187
11 3300041505 Ga0451849_0137645 Ga0451849_0137645_626_1258 187
12 3300041512 Ga0451853_0158421 Ga0451853_0158421_135_767 187
13 3300046524 Ga0495648_0017065 Ga0495648_0017065_1867_2553 187
14 3300046691 Ga0495670_0177776 Ga0495670_0177776_417_1049 187
15 3300005455 Ga0070663_100235297 Ga0070663_1002352972 188
16 3300009011 Ga0105251_10062811 Ga0105251_100628112 188
17 3300009092 Ga0105250_10068697 Ga0105250_100686972 188
18 3300009177 Ga0105248_10068465 Ga0105248_100684652 188
19 3300009553 Ga0105249_10171950 Ga0105249_101719503 188
20 3300025299 Ga0209256_1016960 Ga0209256_10169602 188
21 3300048904 Ga0496101_0231730 Ga0496101_0231730_733_1386 188
22 3300048907 Ga0496104_0007015 Ga0496104_0007015_4600_5253 188
23 3300048908 Ga0496105_0014149 Ga0496105_0014149_1224_1877 188
24 3300048914 Ga0496111_0318091 Ga0496111_0318091_98_751 188
25 3300048922 Ga0496119_0076464 Ga0496119_0076464_1068_1721 188
26 3300048927 Ga0496124_0031042 Ga0496124_0031042_307_960 188
27 3300002773 JGI25152J39213_1001029 JGI25152J39213_10010294 190
28 3300025245 Ga0207425_1016745 Ga0207425_10167452 190
29 3300025258 Ga0209129_1001292 Ga0209129_10012922 190
30 3300025273 Ga0209673_1018136 Ga0209673_10181363 190
31 3300025294 Ga0209025_1019238 Ga0209025_10192383 190
32 3300025295 Ga0209564_1029348 Ga0209564_10293481 190
33 3300048919 Ga0496116_0040023 Ga0496116_0040023_992_1645 190
34 3300048925 Ga0496122_0055874 Ga0496122_0055874_1731_2384 190
35 3300048926 Ga0496123_0035998 Ga0496123_0035998_992_1645 190
36 3300048928 Ga0496125_0116955 Ga0496125_0116955_693_1346 190
37 3300048929 Ga0496126_0454436 Ga0496126_0454436_278_931 190
38 3300025297 Ga0209758_1003382 Ga0209758_10033829 192
39 3300003203 JGI25406J46586_10001336 JGI25406J46586_1000133610 195
40 3300005293 Ga0065715_10090932 Ga0065715_100909325 195
41 3300005337 Ga0070682_100008161 Ga0070682_1000081615 195
42 3300005441 Ga0070700_100016229 Ga0070700_1000162295 195
43 3300005545 Ga0070695_100035721 Ga0070695_1000357214 195
44 3300005843 Ga0068860_100120489 Ga0068860_1001204894 195
45 3300005843 Ga0068860_100703007 Ga0068860_1007030072 195
46 iso_pu_bacteria 2510461076 2510899771 195
47 iso_pu_bacteria 2510461076 2510900367 195
48 iso_pu_bacteria 2510917028 2511183117 195
49 iso_pu_bacteria 2513237085 2513576566 195
50 iso_pu_bacteria 2513237138 2513869009 195
51 iso_pu_bacteria 2513237144 2513913832 195
52 iso_pu_bacteria 2515154116 2515659897 195
53 iso_pu_bacteria 2515154134 2515742314 195
54 iso_pu_bacteria 2516653085 2517080896 195
55 iso_pu_bacteria 2534681796 2535518171 195
56 iso_pu_bacteria 2582581294 2585203401 195
57 iso_pu_bacteria 2582581299 2585230811 195
58 iso_pu_bacteria 2582581867 2585401075 195
59 iso_pu_bacteria 2585427526 2585524547 195
60 iso_pu_bacteria 2585427590 2585822047 195
61 iso_pu_bacteria 2643221643 2644239760 195
62 iso_pu_bacteria 2643221643 2644239996 195
63 iso_pu_bacteria 2838686498 2838692134 195
64 iso_pu_bacteria 2838729681 2838734643 195
65 iso_pu_bacteria 2838742623 2838747825 195
66 iso_pu_bacteria 2841851746 2841853590 195
67 iso_pu_bacteria 2842156927 2842161327 195
68 iso_pu_bacteria 2842163707 2842167442 195
69 iso_pu_bacteria 2842180545 2842186280 195
70 iso_pu_bacteria 2842243621 2842246257 195
71 iso_pu_bacteria 2842257432 2842260882 195
72 iso_pu_bacteria 2842271015 2842276173 195
73 iso_pu_bacteria 2842304105 2842310260 195
74 iso_pu_bacteria 2844454524 2844461251 195
75 iso_pu_bacteria 2919100787 2919103320 195
76 iso_pu_bacteria 2923556063 2923561358 195
77 iso_pu_bacteria 2933570622 2933576701 195
78 iso_pu_bacteria 2935901341 2935905641 195
79 iso_pu_bacteria 2996887358 2996887575 195
80 iso_pu_bacteria 8005307578 8005313231 195
81 iso_pu_bacteria 8005321885 8005322102 195
82 iso_pu_bacteria 8005542996 8005549055 195
83 3300005340 Ga0070689_100140680 Ga0070689_1001406802 196
84 3300005459 Ga0068867_100206519 Ga0068867_1002065191 196
85 3300005539 Ga0068853_100021415 Ga0068853_1000214153 196
86 3300005545 Ga0070695_100277753 Ga0070695_1002777532 196
87 3300005615 Ga0070702_100009407 Ga0070702_1000094073 196
88 3300005617 Ga0068859_100242595 Ga0068859_1002425952 196
89 3300005617 Ga0068859_100561619 Ga0068859_1005616191 196
90 3300005618 Ga0068864_100374276 Ga0068864_1003742762 196
91 3300005718 Ga0068866_10190186 Ga0068866_101901861 196
92 3300005985 Ga0081539_10021226 Ga0081539_100212264 196
93 3300006237 Ga0097621_100011732 Ga0097621_1000117324 196
94 3300006358 Ga0068871_100012564 Ga0068871_1000125646 196
95 3300006931 Ga0097620_100242584 Ga0097620_1002425842 196
96 3300006931 Ga0097620_100561611 Ga0097620_1005616112 196
97 3300009177 Ga0105248_10215313 Ga0105248_102153132 196
98 3300009177 Ga0105248_10399801 Ga0105248_103998012 196
99 3300025904 Ga0207647_10061373 Ga0207647_100613732 196
100 3300025924 Ga0207694_10035404 Ga0207694_100354043 196
101 3300025931 Ga0207644_10687441 Ga0207644_106874412 196
102 3300026075 Ga0207708_10013055 Ga0207708_100130558 196
103 3300035088 Ga0373940_0070640 Ga0373940_0070640_24_626 196
104 3300035207 Ga0373942_0017569 Ga0373942_0017569_561_1163 196
105 3300035691 Ga0373931_0109880 Ga0373931_0109880_506_1117 196
106 3300045051 Ga0451576_0407537 Ga0451576_0407537_818_1411 196
107 3300048914 Ga0496111_0364971 Ga0496111_0364971_429_1037 196
108 3300048916 Ga0496113_0368606 Ga0496113_0368606_345_947 196
109 iso_pu_bacteria 2939669807 2939673087 197
110 3300006173 Ga0070716_100020196 Ga0070716_1000201962 198
111 3300025939 Ga0207665_10023779 Ga0207665_100237794 198
112 3300002075 JGI24738J21930_10021743 JGI24738J21930_100217432 199
113 3300002739 JGI25158J39367_1000013 JGI25158J39367_10000139 199
114 3300002739 JGI25158J39367_1001757 JGI25158J39367_10017572 199
115 3300002773 JGI25152J39213_1000013 JGI25152J39213_100001364 199
116 3300002773 JGI25152J39213_1005751 JGI25152J39213_10057514 199
117 3300002774 JGI25150J39212_1000888 JGI25150J39212_10008888 199
118 3300002774 JGI25150J39212_1009391 JGI25150J39212_10093912 199
119 3300002987 JGI25159J45721_1000096 JGI25159J45721_100009628 199
120 3300002987 JGI25159J45721_1000150 JGI25159J45721_100015015 199
121 3300003187 JGI25151J46595_10046356 JGI25151J46595_100463561 199
122 3300003215 JGI25153J46596_10000274 JGI25153J46596_100002744 199
123 3300003215 JGI25153J46596_10000921 JGI25153J46596_100009219 199
124 3300003215 JGI25153J46596_10005635 JGI25153J46596_100056352 199
125 3300003215 JGI25153J46596_10006785 JGI25153J46596_100067855 199
126 3300003354 JGI25160J50197_1000070 JGI25160J50197_100007039 199
127 3300003354 JGI25160J50197_1036782 JGI25160J50197_10367822 199
128 3300003374 JGI25161J50226_1000026 JGI25161J50226_1000026161 199
129 3300003771 Ga0055526_1000399 Ga0055526_100039912 199
130 3300003771 Ga0055526_1018835 Ga0055526_10188352 199
131 3300003775 Ga0055524_1002617 Ga0055524_10026175 199
132 3300003775 Ga0055524_1007449 Ga0055524_10074492 199
133 3300003775 Ga0055524_1013393 Ga0055524_10133934 199
134 3300003775 Ga0055524_1031051 Ga0055524_10310513 199
135 3300003790 Ga0055528_1002785 Ga0055528_10027855 199
136 3300003790 Ga0055528_1004215 Ga0055528_10042154 199
137 3300003790 Ga0055528_1008230 Ga0055528_10082305 199
138 3300003790 Ga0055528_1022857 Ga0055528_10228572 199
139 3300003792 Ga0055540_1001297 Ga0055540_100129710 199
140 3300004625 Ga0055543_1000042 Ga0055543_100004294 199
141 3300005262 Ga0065165_1000512 Ga0065165_10005124 199
142 3300005564 Ga0070664_100120423 Ga0070664_1001204232 199
143 3300006038 Ga0075365_10015262 Ga0075365_100152623 199
144 3300006048 Ga0075363_100057226 Ga0075363_1000572264 199
145 3300006048 Ga0075363_100335552 Ga0075363_1003355522 199
146 3300006051 Ga0075364_10346615 Ga0075364_103466152 199
147 3300006177 Ga0075362_10011651 Ga0075362_100116515 199
148 3300006178 Ga0075367_10039964 Ga0075367_100399642 199
149 3300006186 Ga0075369_10038271 Ga0075369_100382712 199
150 3300006353 Ga0075370_10226283 Ga0075370_102262832 199
151 3300009545 Ga0105237_10253342 Ga0105237_102533422 199
152 3300009766 Ga0123342_1015230 Ga0123342_10152305 199
153 3300025208 Ga0209436_100036 Ga0209436_10003691 199
154 3300025245 Ga0207425_1000558 Ga0207425_100055816 199
155 3300025258 Ga0209129_1000092 Ga0209129_1000092126 199
156 3300025258 Ga0209129_1004600 Ga0209129_10046004 199
157 3300025258 Ga0209129_1008730 Ga0209129_10087302 199
158 3300025273 Ga0209673_1000987 Ga0209673_10009875 199
159 3300025273 Ga0209673_1001517 Ga0209673_100151715 199
160 3300025273 Ga0209673_1002574 Ga0209673_10025745 199
161 3300025284 Ga0209130_1000073 Ga0209130_100007394 199
162 3300025295 Ga0209564_1000168 Ga0209564_100016841 199
163 3300025295 Ga0209564_1007059 Ga0209564_10070593 199
164 3300025295 Ga0209564_1008973 Ga0209564_10089732 199
165 3300025295 Ga0209564_1062617 Ga0209564_10626172 199
166 3300025297 Ga0209758_1000201 Ga0209758_100020177 199
167 3300025297 Ga0209758_1000478 Ga0209758_100047856 199
168 3300025297 Ga0209758_1003012 Ga0209758_100301214 199
169 3300025297 Ga0209758_1011037 Ga0209758_10110374 199
170 3300025299 Ga0209256_1002173 Ga0209256_100217312 199
171 3300025299 Ga0209256_1003114 Ga0209256_10031148 199
172 3300025299 Ga0209256_1009233 Ga0209256_10092335 199
173 3300025299 Ga0209256_1010362 Ga0209256_10103622 199
174 3300025302 Ga0207426_1000140 Ga0207426_1000140157 199
175 3300025302 Ga0207426_1007207 Ga0207426_10072073 199
176 3300025303 Ga0209051_1000922 Ga0209051_10009227 199
177 3300025303 Ga0209051_1007691 Ga0209051_10076914 199
178 3300025304 Ga0209257_1003613 Ga0209257_10036138 199
179 3300026041 Ga0207639_10718359 Ga0207639_107183591 199
180 3300028379 Ga0268266_10315321 Ga0268266_103153212 199
181 3300041413 Ga0439465_0002462 Ga0439465_0002462_2917_3561 199
182 3300041496 Ga0451839_0708773 Ga0451839_0708773_701_1333 199
183 3300041503 Ga0451847_0783174 Ga0451847_0783174_374_1006 199
184 3300046455 Ga0495603_0370176 Ga0495603_0370176_42_674 199
185 3300046501 Ga0495607_0187171 Ga0495607_0187171_376_1008 199
186 3300046506 Ga0495583_0001269 Ga0495583_0001269_250_882 199
187 3300046507 Ga0495606_0118655 Ga0495606_0118655_800_1432 199
188 3300046512 Ga0495610_0006663 Ga0495610_0006663_2049_2681 199
189 3300046512 Ga0495610_0040666 Ga0495610_0040666_672_1289 199
190 3300046515 Ga0495620_0033178 Ga0495620_0033178_629_1261 199
191 3300046515 Ga0495620_0051034 Ga0495620_0051034_112_744 199
192 3300046519 Ga0495632_0037823 Ga0495632_0037823_1058_1690 199
193 3300046522 Ga0495643_0002519 Ga0495643_0002519_1202_1819 199
194 3300046522 Ga0495643_0005826 Ga0495643_0005826_5669_6301 199
195 3300046524 Ga0495648_0127196 Ga0495648_0127196_229_846 199
196 3300046530 Ga0495654_0091773 Ga0495654_0091773_39_671 199
197 3300046558 Ga0495633_0028010 Ga0495633_0028010_1728_2363 199
198 3300046558 Ga0495633_0164703 Ga0495633_0164703_27_659 199
199 3300046615 Ga0495656_0004528 Ga0495656_0004528_2278_2910 199
200 3300046660 Ga0495625_0009254 Ga0495625_0009254_2131_2763 199
201 3300046660 Ga0495625_0035832 Ga0495625_0035832_2467_3099 199
202 3300046665 Ga0495661_0050330 Ga0495661_0050330_818_1450 199
203 3300046674 Ga0495588_0020825 Ga0495588_0020825_34_666 199
204 3300046694 Ga0495649_0116251 Ga0495649_0116251_690_1307 199
205 3300046794 Ga0495589_0097800 Ga0495589_0097800_652_1287 199
206 3300046810 Ga0495660_0012788 Ga0495660_0012788_2239_2871 199
207 3300047318 Ga0495636_0162968 Ga0495636_0162968_179_811 199
208 3300047443 Ga0495687_003201 Ga0495687_003201_2594_3223 199
209 3300047472 Ga0495686_0123218 Ga0495686_0123218_149_781 199
210 3300048909 Ga0496106_0000502 Ga0496106_0000502_24605_25222 199
211 3300048919 Ga0496116_0097132 Ga0496116_0097132_834_1451 199
212 3300048920 Ga0496117_0149028 Ga0496117_0149028_176_793 199
213 3300048924 Ga0496121_0026466 Ga0496121_0026466_4447_5118 199
214 3300048925 Ga0496122_0032658 Ga0496122_0032658_2642_3259 199
215 3300048928 Ga0496125_0073153 Ga0496125_0073153_1905_2522 199
216 3300050494 nmdc:mga06z11_19785_c1 nmdc:mga06z11_19785_c1_1148_1780 199
217 3300050496 nmdc:mga07m45_219479_c1 nmdc:mga07m45_219479_c1_158_775 199
218 3300053086 Ga0500578_0024063 Ga0500578_0024063_1994_2626 199
219 3300053109 Ga0500569_002908 Ga0500569_002908_1994_2626 199
220 3300053142 Ga0500577_0242960 Ga0500577_0242960_129_761 199
221 3300053153 Ga0500616_0008580 Ga0500616_0008580_3889_4521 199
222 3300053156 Ga0500622_0000104 Ga0500622_0000104_82401_83018 199
223 3300005290 Ga0065712_10071206 Ga0065712_100712065 200
224 3300005293 Ga0065715_10003193 Ga0065715_100031937 200
225 3300005334 Ga0068869_100728508 Ga0068869_1007285081 200
226 3300005438 Ga0070701_10186517 Ga0070701_101865172 200
227 3300005441 Ga0070700_100000022 Ga0070700_100000022100 200
228 3300005441 Ga0070700_100308432 Ga0070700_1003084322 200
229 3300005444 Ga0070694_100044272 Ga0070694_1000442721 200
230 3300005615 Ga0070702_100004999 Ga0070702_1000049993 200
231 3300005617 Ga0068859_100003692 Ga0068859_10000369212 200
232 3300005617 Ga0068859_100019600 Ga0068859_1000196003 200
233 3300005841 Ga0068863_100967879 Ga0068863_1009678791 200
234 3300005842 Ga0068858_100184148 Ga0068858_1001841481 200
235 3300005843 Ga0068860_100013632 Ga0068860_1000136325 200
236 3300006847 Ga0075431_100363202 Ga0075431_1003632022 200
237 3300006931 Ga0097620_100003692 Ga0097620_10000369212 200
238 3300006931 Ga0097620_100019600 Ga0097620_1000196004 200
239 3300009101 Ga0105247_10000485 Ga0105247_100004852 200
240 3300009101 Ga0105247_10301296 Ga0105247_103012962 200
241 3300009177 Ga0105248_10000655 Ga0105248_1000065510 200
242 3300014497 Ga0182008_10158708 Ga0182008_101587082 200
243 3300014968 Ga0157379_10219638 Ga0157379_102196382 200
244 3300015265 Ga0182005_1014567 Ga0182005_10145673 200
245 3300025900 Ga0207710_10002475 Ga0207710_100024755 200
246 3300025940 Ga0207691_10529779 Ga0207691_105297792 200
247 3300025941 Ga0207711_10002379 Ga0207711_100023794 200
248 3300025942 Ga0207689_10063656 Ga0207689_100636563 200
249 3300025960 Ga0207651_10847169 Ga0207651_108471692 200
250 3300026035 Ga0207703_10223704 Ga0207703_102237042 200
251 3300026041 Ga0207639_10096990 Ga0207639_100969901 200
252 3300026041 Ga0207639_10289455 Ga0207639_102894553 200
253 3300026075 Ga0207708_10000040 Ga0207708_1000004095 200
254 3300026088 Ga0207641_10145739 Ga0207641_101457391 200
255 3300026088 Ga0207641_10588339 Ga0207641_105883392 200
256 3300026095 Ga0207676_10257910 Ga0207676_102579102 200
257 3300026095 Ga0207676_10442453 Ga0207676_104424531 200
258 3300026116 Ga0207674_10586971 Ga0207674_105869711 200
259 3300028381 Ga0268264_10027444 Ga0268264_100274444 200
260 3300028381 Ga0268264_10110904 Ga0268264_101109041 200
261 3300028381 Ga0268264_10776253 Ga0268264_107762532 200
262 3300031548 Ga0307408_100083344 Ga0307408_1000833442 200
263 3300031852 Ga0307410_10047541 Ga0307410_100475412 200
264 3300031901 Ga0307406_10034704 Ga0307406_100347043 200
265 3300031901 Ga0307406_10042208 Ga0307406_100422083 200
266 3300031903 Ga0307407_10026914 Ga0307407_100269142 200
267 3300031911 Ga0307412_10141974 Ga0307412_101419742 200
268 3300032002 Ga0307416_100027314 Ga0307416_1000273141 200
269 3300032004 Ga0307414_10008139 Ga0307414_100081394 200
270 3300032005 Ga0307411_10023928 Ga0307411_100239283 200
271 3300035091 Ga0373951_0027446 Ga0373951_0027446_685_1296 200
272 3300049515 Ga0501292_012473 Ga0501292_012473_292_903 200
273 3300049521 Ga0501298_010359 Ga0501298_010359_235_846 200
274 3300049659 Ga0501214_003003 Ga0501214_003003_121_732 200
275 3300049660 Ga0501216_004140 Ga0501216_004140_1271_1882 200
276 3300049661 Ga0501217_000720 Ga0501217_000720_4537_5148 200
277 3300049664 Ga0501224_002755 Ga0501224_002755_1543_2163 200
278 3300049665 Ga0501227_001412 Ga0501227_001412_4621_5241 200
279 3300049669 Ga0501235_011348 Ga0501235_011348_80_691 200
280 3300049686 Ga0501257_004353 Ga0501257_004353_1135_1746 200
281 3300049688 Ga0501259_004615 Ga0501259_004615_1498_2109 200
282 3300049705 Ga0501225_0030566 Ga0501225_0030566_162_773 200
283 3300049706 Ga0501229_005042 Ga0501229_005042_370_990 200
284 3300049707 Ga0501234_000670 Ga0501234_000670_3107_3718 200
285 3300050510 nmdc:mga06r32_361057_c1 nmdc:mga06r32_361057_c1_725_1333 200
286 3300005288 Ga0065714_10193893 Ga0065714_101938931 201
287 3300005290 Ga0065712_10016348 Ga0065712_100163481 201
288 3300005518 Ga0070699_100008566 Ga0070699_1000085665 201
289 3300005617 Ga0068859_100075322 Ga0068859_1000753223 201
290 3300006931 Ga0097620_100075322 Ga0097620_1000753223 201
291 3300009093 Ga0105240_10584086 Ga0105240_105840861 201
292 3300009101 Ga0105247_10262205 Ga0105247_102622052 201
293 3300009174 Ga0105241_10299385 Ga0105241_102993851 201
294 3300009177 Ga0105248_10328782 Ga0105248_103287822 201
295 3300013100 Ga0157373_10078432 Ga0157373_100784322 201
296 3300013306 Ga0163162_10143881 Ga0163162_101438812 201
297 3300013308 Ga0157375_10391810 Ga0157375_103918102 201
298 3300025299 Ga0209256_1000453 Ga0209256_10004534 201
299 3300025914 Ga0207671_10228572 Ga0207671_102285722 201
300 3300025927 Ga0207687_10340491 Ga0207687_103404911 201
301 3300026035 Ga0207703_10512248 Ga0207703_105122481 201
302 3300042012 Ga0439455_0000863 Ga0439455_0000863_2437_3057 201
303 3300042157 Ga0439458_0004499 Ga0439458_0004499_504_1124 201
304 3300050507 nmdc:mga05p37_476736_c1 nmdc:mga05p37_476736_c1_362_982 201
305 3300000532 CNAas_1001050 CNAas_10010501 202
306 3300002076 JGI24749J21850_1032112 JGI24749J21850_10321121 202
307 3300002459 JGI24751J29686_10000105 JGI24751J29686_1000010528 202
308 3300005289 Ga0065704_10195253 Ga0065704_101952531 202
309 3300005290 Ga0065712_10013303 Ga0065712_100133032 202
310 3300005295 Ga0065707_10447692 Ga0065707_104476921 202
311 3300005331 Ga0070670_100000084 Ga0070670_10000008430 202
312 3300005331 Ga0070670_100726244 Ga0070670_1007262442 202
313 3300005340 Ga0070689_100000672 Ga0070689_10000067211 202
314 3300005344 Ga0070661_101029468 Ga0070661_1010294681 202
315 3300005345 Ga0070692_10158096 Ga0070692_101580962 202
316 3300005353 Ga0070669_100405958 Ga0070669_1004059582 202
317 3300005353 Ga0070669_100434519 Ga0070669_1004345192 202
318 3300005355 Ga0070671_100275234 Ga0070671_1002752342 202
319 3300005367 Ga0070667_100769433 Ga0070667_1007694331 202
320 3300005440 Ga0070705_100172479 Ga0070705_1001724792 202
321 3300005441 Ga0070700_100016363 Ga0070700_1000163632 202
322 3300005444 Ga0070694_100072173 Ga0070694_1000721732 202
323 3300005444 Ga0070694_100762071 Ga0070694_1007620711 202
324 3300005457 Ga0070662_100029570 Ga0070662_1000295705 202
325 3300005458 Ga0070681_10044376 Ga0070681_100443764 202
326 3300005458 Ga0070681_10112059 Ga0070681_101120592 202
327 3300005467 Ga0070706_100000030 Ga0070706_100000030123 202
328 3300005467 Ga0070706_100754498 Ga0070706_1007544982 202
329 3300005468 Ga0070707_100031050 Ga0070707_1000310503 202
330 3300005471 Ga0070698_100007778 Ga0070698_1000077784 202
331 3300005471 Ga0070698_100533212 Ga0070698_1005332122 202
332 3300005518 Ga0070699_100018657 Ga0070699_1000186573 202
333 3300005518 Ga0070699_100952551 Ga0070699_1009525511 202
334 3300005536 Ga0070697_100225597 Ga0070697_1002255971 202
335 3300005546 Ga0070696_100253502 Ga0070696_1002535021 202
336 3300005546 Ga0070696_100351295 Ga0070696_1003512951 202
337 3300005547 Ga0070693_100195204 Ga0070693_1001952042 202
338 3300005547 Ga0070693_100522853 Ga0070693_1005228531 202
339 3300005549 Ga0070704_100102928 Ga0070704_1001029281 202
340 3300005564 Ga0070664_100441312 Ga0070664_1004413122 202
341 3300005564 Ga0070664_100547701 Ga0070664_1005477012 202
342 3300005577 Ga0068857_100179364 Ga0068857_1001793642 202
343 3300005577 Ga0068857_100185382 Ga0068857_1001853823 202
344 3300005577 Ga0068857_100454521 Ga0068857_1004545212 202
345 3300005615 Ga0070702_100430672 Ga0070702_1004306721 202
346 3300005616 Ga0068852_100872768 Ga0068852_1008727682 202
347 3300005617 Ga0068859_100100953 Ga0068859_1001009531 202
348 3300005617 Ga0068859_100107539 Ga0068859_1001075393 202
349 3300005617 Ga0068859_100142113 Ga0068859_1001421133 202
350 3300005617 Ga0068859_100274909 Ga0068859_1002749091 202
351 3300005617 Ga0068859_100679245 Ga0068859_1006792452 202
352 3300005618 Ga0068864_100000966 Ga0068864_10000096620 202
353 3300005618 Ga0068864_100002707 Ga0068864_10000270710 202
354 3300005618 Ga0068864_100094613 Ga0068864_1000946134 202
355 3300005618 Ga0068864_100203021 Ga0068864_1002030213 202
356 3300005618 Ga0068864_100388060 Ga0068864_1003880602 202
357 3300005719 Ga0068861_100009423 Ga0068861_1000094233 202
358 3300005719 Ga0068861_100209658 Ga0068861_1002096581 202
359 3300005840 Ga0068870_10129588 Ga0068870_101295882 202
360 3300005841 Ga0068863_100031974 Ga0068863_1000319747 202
361 3300005841 Ga0068863_100224193 Ga0068863_1002241932 202
362 3300005843 Ga0068860_100068948 Ga0068860_1000689483 202
363 3300005843 Ga0068860_100340564 Ga0068860_1003405641 202
364 3300005844 Ga0068862_100034441 Ga0068862_1000344414 202
365 3300005844 Ga0068862_100109215 Ga0068862_1001092152 202
366 3300005985 Ga0081539_10000318 Ga0081539_1000031861 202
367 3300006237 Ga0097621_100217420 Ga0097621_1002174202 202
368 3300006852 Ga0075433_10019739 Ga0075433_100197393 202
369 3300006852 Ga0075433_10020458 Ga0075433_100204584 202
370 3300006871 Ga0075434_100034951 Ga0075434_1000349512 202
371 3300006871 Ga0075434_100332626 Ga0075434_1003326261 202
372 3300006881 Ga0068865_100439040 Ga0068865_1004390402 202
373 3300006914 Ga0075436_100013287 Ga0075436_1000132875 202
374 3300006931 Ga0097620_100100953 Ga0097620_1001009531 202
375 3300006931 Ga0097620_100107545 Ga0097620_1001075453 202
376 3300006931 Ga0097620_100142123 Ga0097620_1001421233 202
377 3300006931 Ga0097620_100274920 Ga0097620_1002749201 202
378 3300006931 Ga0097620_100679279 Ga0097620_1006792792 202
379 3300009094 Ga0111539_10081241 Ga0111539_100812413 202
380 3300009147 Ga0114129_11227645 Ga0114129_112276451 202
381 3300009148 Ga0105243_10013673 Ga0105243_100136731 202
382 3300009174 Ga0105241_10695547 Ga0105241_106955472 202
383 3300009176 Ga0105242_10196181 Ga0105242_101961812 202
384 3300009177 Ga0105248_10032288 Ga0105248_100322886 202
385 3300009177 Ga0105248_10108093 Ga0105248_101080931 202
386 3300009177 Ga0105248_10173200 Ga0105248_101732002 202
387 3300009545 Ga0105237_10040656 Ga0105237_100406565 202
388 3300009545 Ga0105237_10746921 Ga0105237_107469211 202
389 3300009553 Ga0105249_10476866 Ga0105249_104768662 202
390 3300009553 Ga0105249_11657769 Ga0105249_116577691 202
391 3300011119 Ga0105246_10049940 Ga0105246_100499402 202
392 3300011119 Ga0105246_10626363 Ga0105246_106263631 202
393 3300013100 Ga0157373_10004405 Ga0157373_100044059 202
394 3300013297 Ga0157378_10726078 Ga0157378_107260782 202
395 3300013306 Ga0163162_10048624 Ga0163162_100486245 202
396 3300013308 Ga0157375_10064948 Ga0157375_100649482 202
397 3300013308 Ga0157375_10212012 Ga0157375_102120122 202
398 3300013308 Ga0157375_10780612 Ga0157375_107806121 202
399 3300014325 Ga0163163_10000087 Ga0163163_100000877 202
400 3300014326 Ga0157380_10315501 Ga0157380_103155012 202
401 3300014745 Ga0157377_10048684 Ga0157377_100486842 202
402 3300014968 Ga0157379_10089860 Ga0157379_100898602 202
403 3300014968 Ga0157379_10729514 Ga0157379_107295142 202
404 3300025908 Ga0207643_10000702 Ga0207643_1000070216 202
405 3300025908 Ga0207643_10007230 Ga0207643_100072302 202
406 3300025910 Ga0207684_10000089 Ga0207684_100000891 202
407 3300025912 Ga0207707_10093590 Ga0207707_100935902 202
408 3300025912 Ga0207707_10350806 Ga0207707_103508062 202
409 3300025917 Ga0207660_10097790 Ga0207660_100977902 202
410 3300025917 Ga0207660_10599941 Ga0207660_105999411 202
411 3300025918 Ga0207662_10424973 Ga0207662_104249732 202
412 3300025922 Ga0207646_10134859 Ga0207646_101348592 202
413 3300025923 Ga0207681_10497074 Ga0207681_104970741 202
414 3300025924 Ga0207694_10024981 Ga0207694_100249813 202
415 3300025925 Ga0207650_10000017 Ga0207650_10000017130 202
416 3300025925 Ga0207650_10210660 Ga0207650_102106602 202
417 3300025925 Ga0207650_10469346 Ga0207650_104693461 202
418 3300025925 Ga0207650_10594027 Ga0207650_105940271 202
419 3300025933 Ga0207706_10037793 Ga0207706_100377935 202
420 3300025935 Ga0207709_10005093 Ga0207709_100050935 202
421 3300025936 Ga0207670_10000363 Ga0207670_1000036310 202
422 3300025941 Ga0207711_10067632 Ga0207711_100676324 202
423 3300025941 Ga0207711_10432621 Ga0207711_104326212 202
424 3300025941 Ga0207711_10508826 Ga0207711_105088261 202
425 3300025942 Ga0207689_10029366 Ga0207689_100293662 202
426 3300025945 Ga0207679_10069677 Ga0207679_100696771 202
427 3300025945 Ga0207679_10199912 Ga0207679_101999121 202
428 3300025945 Ga0207679_10544671 Ga0207679_105446711 202
429 3300025960 Ga0207651_10510102 Ga0207651_105101021 202
430 3300025961 Ga0207712_10012346 Ga0207712_100123464 202
431 3300025961 Ga0207712_10621369 Ga0207712_106213692 202
432 3300026035 Ga0207703_10550196 Ga0207703_105501962 202
433 3300026075 Ga0207708_10029094 Ga0207708_100290942 202
434 3300026075 Ga0207708_10337770 Ga0207708_103377702 202
435 3300026088 Ga0207641_10011098 Ga0207641_100110983 202
436 3300026089 Ga0207648_10085242 Ga0207648_100852422 202
437 3300026089 Ga0207648_10102557 Ga0207648_101025573 202
438 3300026089 Ga0207648_10104969 Ga0207648_101049692 202
439 3300026089 Ga0207648_10189164 Ga0207648_101891641 202
440 3300026095 Ga0207676_10001172 Ga0207676_1000117218 202
441 3300026095 Ga0207676_10030410 Ga0207676_100304104 202
442 3300026116 Ga0207674_10086550 Ga0207674_100865504 202
443 3300026116 Ga0207674_10094374 Ga0207674_100943743 202
444 3300026116 Ga0207674_10363313 Ga0207674_103633132 202
445 3300026116 Ga0207674_10419267 Ga0207674_104192672 202
446 3300026116 Ga0207674_10490530 Ga0207674_104905301 202
447 3300026116 Ga0207674_10542585 Ga0207674_105425852 202
448 3300026116 Ga0207674_11259009 Ga0207674_112590091 202
449 3300026118 Ga0207675_100054897 Ga0207675_1000548973 202
450 3300027907 Ga0207428_10034189 Ga0207428_100341895 202
451 3300027907 Ga0207428_10127427 Ga0207428_101274273 202
452 3300028380 Ga0268265_10232675 Ga0268265_102326753 202
453 3300028381 Ga0268264_10119907 Ga0268264_101199073 202
454 3300028381 Ga0268264_10162257 Ga0268264_101622572 202
455 3300028381 Ga0268264_10806367 Ga0268264_108063672 202
456 3300031911 Ga0307412_10470322 Ga0307412_104703221 202
457 3300035091 Ga0373951_0001507 Ga0373951_0001507_2620_3234 202
458 3300037418 Ga0395900_0249272 Ga0395900_0249272_681_1307 202
459 3300037466 Ga0395898_0064428 Ga0395898_0064428_1186_1875 202
460 3300037466 Ga0395898_0146641 Ga0395898_0146641_797_1423 202
461 3300038443 Ga0395901_0128406 Ga0395901_0128406_2022_2639 202
462 3300038698 Ga0242419_000450 Ga0242419_000450_826_1452 202
463 3300044673 Ga0453683_0077146 Ga0453683_0077146_224_835 202
464 3300045051 Ga0451576_0195679 Ga0451576_0195679_1136_1753 202
465 3300047320 Ga0495672_0222950 Ga0495672_0222950_150_773 202
466 3300048910 Ga0496107_0912603 Ga0496107_0912603_15_629 202
467 3300048915 Ga0496112_0216699 Ga0496112_0216699_1209_1844 202
468 3300048915 Ga0496112_0263398 Ga0496112_0263398_1040_1654 202
469 3300049521 Ga0501298_020930 Ga0501298_020930_208_822 202
470 3300049770 Ga0501273_009853 Ga0501273_009853_171_785 202
471 3300050510 nmdc:mga06r32_1083572_c1 nmdc:mga06r32_1083572_c1_77_694 202
472 3300050511 nmdc:mga08y16_112811_c1 nmdc:mga08y16_112811_c1_1617_2231 202
473 3300050511 nmdc:mga08y16_83900_c1 nmdc:mga08y16_83900_c1_1637_2332 202
474 3300050512 nmdc:mga0n895_298384_c1 nmdc:mga0n895_298384_c1_990_1607 202
475 3300050512 nmdc:mga0n895_572710_c1 nmdc:mga0n895_572710_c1_240_863 202
476 3300050513 nmdc:mga0rr50_974736_c1 nmdc:mga0rr50_974736_c1_52_663 202
477 3300050514 nmdc:mga08x19_78583_c1 nmdc:mga08x19_78583_c1_1353_1988 202
478 3300050515 nmdc:mga0a205_223559_c1 nmdc:mga0a205_223559_c1_1054_1677 202
479 3300050515 nmdc:mga0a205_259746_c1 nmdc:mga0a205_259746_c1_119_736 202
480 3300061734 Ga0530510_0160620 Ga0530510_0160620_428_1069 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

5

115

0.99

PF00196

GerE

Bacterial regulatory proteins, luxR family

139

195

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

131

183

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9554 140 200
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9549 140 200
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9528 140 200
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9507 140 200
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.948 142 200
ID Description Score Start End Superfamily
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9927 143 200 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9901 143 200 1.10.10.10
1a04B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9689 142 200 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9647 143 202 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.96 143 200 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A158GYH7-F1-model_v4 Two component LuxR family transcriptional regulator 0.9805 5 202 GO:0000160
GO:0003677
GO:0006355
AF-A0A7W8S770-F1-model_v4 FixJ family two-component response regulator 0.9803 5 201 GO:0000160
GO:0006355
AF-A0A7Y6N0V8-F1-model_v4 Response regulator transcription factor 0.9789 3 202 GO:0000160
GO:0006355
AF-A2WIL1-F1-model_v4 deleted 0.9781 2 202
AF-A0A7Y8UHM9-F1-model_v4 deleted 0.9772 6 202

Feature Viewer

pLDDT pTM Quality
89.44 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map