F452283

General Info

Members Datasets Scaffolds Average Seq Length
480 253 960 495

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0040772|Ga0496102_0040772_1508_3061
Length 517
Sequence LTLISDSRIWPAIAKNAKIDGLTHTKYIGAIDQGTTSTRFLVFDGAGKIVASAQKEHRQIYPQAGWVEHDAEEIWQRTREVIEQALAQSGVKAAELAGIGITNQRETTVVWERKTGKPLGNAIVWQDMRVAVDAARYAREVGNDFFRHRTGLPLSTYFSALKLRWILENIAGARRQAEAGEIHFGTIDTFLVWKLTGLHITDATNASRTQLMNLTTLQWDAELLRAFAIPEQILPRIASSSEIYGHVADGSLKGVPVAGVLGDQQAALVGQTCFKTGEAKNTYGTGCFLLMNTGERPVESKHGMLTTVAYKFGKEPPRYALEGSVAIGGALVQWLRDNLGLIGSSPEIEQLAGTVGDNGGIYIVPAFSGLYAPYWKESARGVIVGLTRFSNRGHIARAALEAVAFQVREVVEAMEQDSGIALAVLRADGGMVANHLLMQFQADILDRPVVLPAIHETTSLGAAYAAGLAVGFFKSVDDLCKHWSAKKTWKPAMDDATRERLYRQWKKAVARSFDWVE

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
250 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
251 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
252 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
253 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 1.67
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 5.62
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0040772 3300048905 Bacteria 4202
2 Ga0055536_1005576 3300003781 Bacteria 6105
3 Ga0065165_1000861 3300005262 Bacteria 39684
4 Ga0070683_100000023 3300005329 Bacteria 178721
5 Ga0070683_100002487 3300005329 Bacteria 14670
6 Ga0070683_100102629 3300005329 Bacteria 2694
7 Ga0070683_100168340 3300005329 Bacteria 2079
8 Ga0070670_100002755 3300005331 Bacteria 14517
9 Ga0068869_100041115 3300005334 Bacteria 3309
10 Ga0068868_100005397 3300005338 Bacteria 8983
11 Ga0070660_100182265 3300005339 Bacteria 1699
12 Ga0070689_100048205 3300005340 Bacteria 3285
13 Ga0070687_100072029 3300005343 Bacteria 1859
14 Ga0070661_100014783 3300005344 Bacteria 5503
15 Ga0070661_100018976 3300005344 Bacteria 4897
16 Ga0070692_10056286 3300005345 Bacteria 2059
17 Ga0070669_100033452 3300005353 Bacteria 3718
18 Ga0070669_100088441 3300005353 Bacteria 2319
19 Ga0070675_100000534 3300005354 Bacteria 26016
20 Ga0070673_100081075 3300005364 Bacteria 2631
21 Ga0070688_100031361 3300005365 Bacteria 3197
22 Ga0070709_10004170 3300005434 Bacteria 7789
23 Ga0070709_10048780 3300005434 Unclassified 2644
24 Ga0070709_10057510 3300005434 Bacteria 2463
25 Ga0070714_100002293 3300005435 Bacteria 14073
26 Ga0070714_100017569 3300005435 Bacteria 5797
27 Ga0070714_100047523 3300005435 Bacteria 3646
28 Ga0070714_100285843 3300005435 Bacteria 1533
29 Ga0070713_100012400 3300005436 Bacteria 6250
30 Ga0070713_100046316 3300005436 Bacteria 3568
31 Ga0070713_100050423 3300005436 Bacteria 3439
32 Ga0070713_100081652 3300005436 Bacteria 2759
33 Ga0070713_100114403 3300005436 Bacteria 2357
34 Ga0070710_10020162 3300005437 Bacteria 3455
35 Ga0070710_10025974 3300005437 Bacteria 3107
36 Ga0070711_100011680 3300005439 Bacteria 5459
37 Ga0070711_100011880 3300005439 Bacteria 5418
38 Ga0070711_100023025 3300005439 Bacteria 4045
39 Ga0070711_100064663 3300005439 Bacteria 2556
40 Ga0070705_100108003 3300005440 Bacteria 1772
41 Ga0070694_100003262 3300005444 Bacteria 9687
42 Ga0070694_100004415 3300005444 Bacteria 8457
43 Ga0070708_100003823 3300005445 Bacteria 11816
44 Ga0070708_100008248 3300005445 Bacteria 8364
45 Ga0070708_100011718 3300005445 Bacteria 7137
46 Ga0070708_100026928 3300005445 Bacteria 4927
47 Ga0070708_100045079 3300005445 Bacteria 3883
48 Ga0070708_100047828 3300005445 Bacteria 3779
49 Ga0070663_100007514 3300005455 Bacteria 6637
50 Ga0070678_100109784 3300005456 Bacteria 2156
51 Ga0070662_100006127 3300005457 Bacteria 7733
52 Ga0070681_10007844 3300005458 Bacteria 10438
53 Ga0070681_10095202 3300005458 Bacteria 2926
54 Ga0068867_100083246 3300005459 Bacteria 2415
55 Ga0068867_100120988 3300005459 Bacteria 2023
56 Ga0070685_10028034 3300005466 Bacteria 3117
57 Ga0070706_100001270 3300005467 Bacteria 26946
58 Ga0070706_100012451 3300005467 Bacteria 7880
59 Ga0070706_100017162 3300005467 Bacteria 6687
60 Ga0070706_100018487 3300005467 Bacteria 6426
61 Ga0070706_100064685 3300005467 Bacteria 3381
62 Ga0070706_100113754 3300005467 Bacteria 2520
63 Ga0070706_100200781 3300005467 Bacteria 1863
64 Ga0070707_100018036 3300005468 Bacteria 6639
65 Ga0070707_100025625 3300005468 Bacteria 5597
66 Ga0070698_100009258 3300005471 Bacteria 10566
67 Ga0070698_100011453 3300005471 Bacteria 9411
68 Ga0070698_100055179 3300005471 Bacteria 4031
69 Ga0070699_100002435 3300005518 Bacteria 16699
70 Ga0070699_100006069 3300005518 Bacteria 10563
71 Ga0070699_100064282 3300005518 Bacteria 3183
72 Ga0070679_100005094 3300005530 Bacteria 12140
73 Ga0070679_100015828 3300005530 Bacteria 7256
74 Ga0070679_100145759 3300005530 Bacteria 2346
75 Ga0070679_100273295 3300005530 Bacteria 1643
76 Ga0070684_100000116 3300005535 Bacteria 51769
77 Ga0070684_100013183 3300005535 Bacteria 6655
78 Ga0070684_100082555 3300005535 Bacteria 2845
79 Ga0070697_100000214 3300005536 Bacteria 47447
80 Ga0070697_100005713 3300005536 Bacteria 9584
81 Ga0070697_100007475 3300005536 Bacteria 8504
82 Ga0070697_100013140 3300005536 Bacteria 6491
83 Ga0070697_100021147 3300005536 Bacteria 5154
84 Ga0070697_100050916 3300005536 Bacteria 3364
85 Ga0068853_100089249 3300005539 Bacteria 2707
86 Ga0070686_100028267 3300005544 Bacteria 3399
87 Ga0070695_100015152 3300005545 Bacteria 4653
88 Ga0070696_100010146 3300005546 Bacteria 6305
89 Ga0070696_100026966 3300005546 Bacteria 3912
90 Ga0070696_100064826 3300005546 Bacteria 2560
91 Ga0070693_100000253 3300005547 Bacteria 24885
92 Ga0070665_100001312 3300005548 Bacteria 29695
93 Ga0070665_100007075 3300005548 Bacteria 11400
94 Ga0070665_100078422 3300005548 Bacteria 3309
95 Ga0070704_100000070 3300005549 Bacteria 33970
96 Ga0068855_100044829 3300005563 Bacteria 5232
97 Ga0068855_100070162 3300005563 Bacteria 4077
98 Ga0068855_100108921 3300005563 Bacteria 3181
99 Ga0070664_100067968 3300005564 Bacteria 3046
100 Ga0070664_100082278 3300005564 Bacteria 2776
101 Ga0068857_100051414 3300005577 Bacteria 3656
102 Ga0068854_100021982 3300005578 Bacteria 4337
103 Ga0070702_100017067 3300005615 Bacteria 3737
104 Ga0068852_100064040 3300005616 Bacteria 3203
105 Ga0068859_100040547 3300005617 Bacteria 4673
106 Ga0068864_100053662 3300005618 Bacteria 3478
107 Ga0068861_100002063 3300005719 Bacteria 13035
108 Ga0068870_10020004 3300005840 Bacteria 3254
109 Ga0068863_100000764 3300005841 Bacteria 32258
110 Ga0068863_100176453 3300005841 Bacteria 2051
111 Ga0068863_100216824 3300005841 Unclassified 1843
112 Ga0068858_100010967 3300005842 Bacteria 8564
113 Ga0068858_100069892 3300005842 Bacteria 3255
114 Ga0068860_100015433 3300005843 Bacteria 7464
115 Ga0068860_100075650 3300005843 Unclassified 3202
116 Ga0068860_100087977 3300005843 Bacteria 2957
117 Ga0068862_100107473 3300005844 Bacteria 2446
118 Ga0081540_1018833 3300005983 Bacteria 4219
119 Ga0070717_10002640 3300006028 Bacteria 12625
120 Ga0070717_10006541 3300006028 Bacteria 8579
121 Ga0070717_10018614 3300006028 Bacteria 5428
122 Ga0070716_100000221 3300006173 Bacteria 22802
123 Ga0070716_100001016 3300006173 Bacteria 12286
124 Ga0070716_100001398 3300006173 Bacteria 10712
125 Ga0070716_100039864 3300006173 Bacteria 2609
126 Ga0070712_100000175 3300006175 Bacteria 35455
127 Ga0070712_100021313 3300006175 Bacteria 4255
128 Ga0070712_100068577 3300006175 Bacteria 2528
129 Ga0070712_100083965 3300006175 Bacteria 2314
130 Ga0097621_100005958 3300006237 Bacteria 8615
131 Ga0097621_100035041 3300006237 Bacteria 4008
132 Ga0097621_100081373 3300006237 Bacteria 2695
133 Ga0068871_100091790 3300006358 Bacteria 2532
134 Ga0068871_100133795 3300006358 Bacteria 2104
135 Ga0075431_100008502 3300006847 Bacteria 10278
136 Ga0075431_100112007 3300006847 Bacteria 2816
137 Ga0075433_10017086 3300006852 Bacteria 6000
138 Ga0075433_10073419 3300006852 Bacteria 3009
139 Ga0075434_100014860 3300006871 Bacteria 7447
140 Ga0075434_100038879 3300006871 Bacteria 4714
141 Ga0068865_100020707 3300006881 Bacteria 4269
142 Ga0075436_100007096 3300006914 Bacteria 7669
143 Ga0075436_100014486 3300006914 Bacteria 5402
144 Ga0075436_100015790 3300006914 Bacteria 5171
145 Ga0075436_100127436 3300006914 Bacteria 1784
146 Ga0097620_100040547 3300006931 Bacteria 4673
147 Ga0075435_100014963 3300007076 Bacteria 5819
148 Ga0075435_100034572 3300007076 Bacteria 4006
149 Ga0099794_10002558 3300007265 Bacteria 6740
150 Ga0099794_10006359 3300007265 Bacteria 4779
151 Ga0099794_10006541 3300007265 Bacteria 4730
152 Ga0099795_10003741 3300007788 Bacteria 3816
153 Ga0099795_10015344 3300007788 Bacteria 2397
154 Ga0105240_10002509 3300009093 Bacteria 29492
155 Ga0105240_10055027 3300009093 Bacteria 4983
156 Ga0105240_10191030 3300009093 Bacteria 2408
157 Ga0111539_10014647 3300009094 Bacteria 9784
158 Ga0111539_10022515 3300009094 Bacteria 7742
159 Ga0105245_10008688 3300009098 Bacteria 8858
160 Ga0105245_10012813 3300009098 Bacteria 7305
161 Ga0105245_10037175 3300009098 Bacteria 4328
162 Ga0105245_10100037 3300009098 Bacteria 2682
163 Ga0114129_10020391 3300009147 Bacteria 9429
164 Ga0114129_10027475 3300009147 Bacteria 8055
165 Ga0114129_10180564 3300009147 Bacteria 2872
166 Ga0105243_10006216 3300009148 Bacteria 9233
167 Ga0105243_10038661 3300009148 Unclassified 3716
168 Ga0105241_10086332 3300009174 Bacteria 2467
169 Ga0105242_10121821 3300009176 Bacteria 2239
170 Ga0105248_10017574 3300009177 Bacteria 7888
171 Ga0105248_10109844 3300009177 Bacteria 3109
172 Ga0105248_10134814 3300009177 Bacteria 2786
173 Ga0105248_10245721 3300009177 Bacteria 2014
174 Ga0105237_10004212 3300009545 Bacteria 16745
175 Ga0105237_10019824 3300009545 Bacteria 6944
176 Ga0105237_10050625 3300009545 Bacteria 4174
177 Ga0105238_10039389 3300009551 Bacteria 4792
178 Ga0105238_10091297 3300009551 Bacteria 3033
179 Ga0105249_10166080 3300009553 Bacteria 2137
180 Ga0105239_10051080 3300010375 Bacteria 4533
181 Ga0105239_10182903 3300010375 Bacteria 2345
182 Ga0105239_10239590 3300010375 Bacteria 2036
183 Ga0105246_10009434 3300011119 Bacteria 6014
184 Ga0157373_10054086 3300013100 Bacteria 2853
185 Ga0157373_10105777 3300013100 Bacteria 1979
186 Ga0157370_10016077 3300013104 Bacteria 7585
187 Ga0157369_10039529 3300013105 Bacteria 5155
188 Ga0157369_10115711 3300013105 Bacteria 2848
189 Ga0157374_10000262 3300013296 Bacteria 48624
190 Ga0157374_10000480 3300013296 Bacteria 36285
191 Ga0157374_10015893 3300013296 Bacteria 6612
192 Ga0157378_10000081 3300013297 Bacteria 88506
193 Ga0157378_10001031 3300013297 Bacteria 25443
194 Ga0157378_10024532 3300013297 Bacteria 5308
195 Ga0163162_10005088 3300013306 Bacteria 12669
196 Ga0163162_10011257 3300013306 Bacteria 8722
197 Ga0163162_10051553 3300013306 Bacteria 4130
198 Ga0163162_10122138 3300013306 Bacteria 2709
199 Ga0157372_10001653 3300013307 Bacteria 24191
200 Ga0157375_10002088 3300013308 Bacteria 17267
201 Ga0157375_10146152 3300013308 Bacteria 2495
202 Ga0163163_10005873 3300014325 Bacteria 10677
203 Ga0163163_10020209 3300014325 Bacteria 6267
204 Ga0163163_10112133 3300014325 Bacteria 2756
205 Ga0157377_10009080 3300014745 Bacteria 4871
206 Ga0157379_10004886 3300014968 Bacteria 11511
207 Ga0157379_10238627 3300014968 Bacteria 1649
208 Ga0157376_10000050 3300014969 Bacteria 104192
209 Ga0157376_10000058 3300014969 Bacteria 97710
210 Ga0157376_10000647 3300014969 Bacteria 22536
211 Ga0213873_10008412 3300021358 Bacteria 2106
212 Ga0213872_10003152 3300021361 Bacteria 9257
213 Ga0213872_10018631 3300021361 Bacteria 3200
214 Ga0213872_10041083 3300021361 Bacteria 2110
215 Ga0213874_10000967 3300021377 Bacteria 5871
216 Ga0213875_10012346 3300021388 Bacteria 4225
217 Ga0224572_1000042 3300024225 Bacteria 7633
218 Ga0228598_1000110 3300024227 Bacteria 13697
219 Ga0209676_1000363 3300025292 Bacteria 85613
220 Ga0207692_10019019 3300025898 Bacteria 3096
221 Ga0207692_10042057 3300025898 Bacteria 2266
222 Ga0207642_10016429 3300025899 Bacteria 2788
223 Ga0207680_10037557 3300025903 Bacteria 2797
224 Ga0207685_10016793 3300025905 Bacteria 2350
225 Ga0207699_10001517 3300025906 Bacteria 11021
226 Ga0207699_10005536 3300025906 Bacteria 6056
227 Ga0207699_10022630 3300025906 Bacteria 3409
228 Ga0207699_10034492 3300025906 Bacteria 2871
229 Ga0207699_10060986 3300025906 Bacteria 2267
230 Ga0207645_10008683 3300025907 Bacteria 7076
231 Ga0207643_10028908 3300025908 Bacteria 3081
232 Ga0207684_10000307 3300025910 Bacteria 69402
233 Ga0207684_10018831 3300025910 Bacteria 5906
234 Ga0207684_10053181 3300025910 Bacteria 3438
235 Ga0207654_10004210 3300025911 Bacteria 7261
236 Ga0207707_10023020 3300025912 Bacteria 5450
237 Ga0207707_10047482 3300025912 Bacteria 3739
238 Ga0207707_10084871 3300025912 Bacteria 2766
239 Ga0207695_10008610 3300025913 Bacteria 12746
240 Ga0207695_10020253 3300025913 Bacteria 7624
241 Ga0207695_10172479 3300025913 Bacteria 2088
242 Ga0207693_10000013 3300025915 Bacteria 154365
243 Ga0207693_10015462 3300025915 Bacteria 6121
244 Ga0207693_10035596 3300025915 Bacteria 3924
245 Ga0207693_10100673 3300025915 Bacteria 2266
246 Ga0207663_10007273 3300025916 Bacteria 5731
247 Ga0207663_10022872 3300025916 Bacteria 3579
248 Ga0207662_10019212 3300025918 Bacteria 3885
249 Ga0207657_10010615 3300025919 Bacteria 9179
250 Ga0207652_10011133 3300025921 Bacteria 7250
251 Ga0207652_10105194 3300025921 Bacteria 2497
252 Ga0207652_10116838 3300025921 Bacteria 2370
253 Ga0207652_10119690 3300025921 Bacteria 2342
254 Ga0207646_10000473 3300025922 Bacteria 53710
255 Ga0207646_10007765 3300025922 Bacteria 10856
256 Ga0207646_10077396 3300025922 Bacteria 2973
257 Ga0207646_10171954 3300025922 Bacteria 1956
258 Ga0207681_10044345 3300025923 Bacteria 2980
259 Ga0207659_10000860 3300025926 Bacteria 18028
260 Ga0207659_10046316 3300025926 Bacteria 3070
261 Ga0207687_10001896 3300025927 Bacteria 14378
262 Ga0207687_10005920 3300025927 Bacteria 8088
263 Ga0207700_10053280 3300025928 Bacteria 3030
264 Ga0207700_10080525 3300025928 Bacteria 2540
265 Ga0207700_10174087 3300025928 Bacteria 1797
266 Ga0207664_10031890 3300025929 Bacteria 4035
267 Ga0207664_10057756 3300025929 Bacteria 3085
268 Ga0207664_10064442 3300025929 Bacteria 2931
269 Ga0207664_10085909 3300025929 Bacteria 2569
270 Ga0207644_10101431 3300025931 Bacteria 2163
271 Ga0207706_10003535 3300025933 Bacteria 14924
272 Ga0207670_10019958 3300025936 Bacteria 4106
273 Ga0207704_10004044 3300025938 Bacteria 6680
274 Ga0207665_10000156 3300025939 Bacteria 46270
275 Ga0207665_10000267 3300025939 Bacteria 36262
276 Ga0207665_10001266 3300025939 Bacteria 17044
277 Ga0207665_10004917 3300025939 Bacteria 8908
278 Ga0207665_10021234 3300025939 Bacteria 4269
279 Ga0207665_10034042 3300025939 Bacteria 3380
280 Ga0207665_10070937 3300025939 Bacteria 2378
281 Ga0207665_10085611 3300025939 Bacteria 2176
282 Ga0207691_10202806 3300025940 Bacteria 1726
283 Ga0207711_10006797 3300025941 Bacteria 9612
284 Ga0207689_10057649 3300025942 Bacteria 3195
285 Ga0207689_10175105 3300025942 Bacteria 1769
286 Ga0207661_10000027 3300025944 Bacteria 178873
287 Ga0207661_10041108 3300025944 Bacteria 3638
288 Ga0207661_10163749 3300025944 Bacteria 1931
289 Ga0207679_10013167 3300025945 Bacteria 5418
290 Ga0207667_10045045 3300025949 Bacteria 4672
291 Ga0207651_10022905 3300025960 Bacteria 3831
292 Ga0207651_10096210 3300025960 Bacteria 2183
293 Ga0207677_10042035 3300026023 Bacteria 3027
294 Ga0207703_10057742 3300026035 Bacteria 3165
295 Ga0207678_10000405 3300026067 Bacteria 39009
296 Ga0207702_10022508 3300026078 Bacteria 5224
297 Ga0207641_10005322 3300026088 Bacteria 10989
298 Ga0207641_10040348 3300026088 Bacteria 3908
299 Ga0207641_10098954 3300026088 Unclassified 2565
300 Ga0207641_10248054 3300026088 Bacteria 1662
301 Ga0207676_10029430 3300026095 Bacteria 4112
302 Ga0207674_10004680 3300026116 Bacteria 16426
303 Ga0207674_10070402 3300026116 Bacteria 3517
304 Ga0207675_100084987 3300026118 Bacteria 2969
305 Ga0207683_10059839 3300026121 Bacteria 3346
306 Ga0209588_1003361 3300027671 Bacteria 4433
307 Ga0209588_1004853 3300027671 Bacteria 3822
308 Ga0209588_1005088 3300027671 Bacteria 3745
309 Ga0265354_1000390 3300028016 Bacteria 7706
310 Ga0265354_1001007 3300028016 Bacteria 4395
311 Ga0268266_10000227 3300028379 Bacteria 97786
312 Ga0268266_10033070 3300028379 Bacteria 4397
313 Ga0268265_10045460 3300028380 Bacteria 3276
314 Ga0268264_10013257 3300028381 Bacteria 6785
315 Ga0268264_10013315 3300028381 Bacteria 6771
316 Ga0265318_10006620 3300028577 Bacteria 5318
317 Ga0265338_10025493 3300028800 Bacteria 5998
318 Ga0265762_1000725 3300030760 Bacteria 5850
319 Ga0265762_1002540 3300030760 Bacteria 3290
320 Ga0265770_1001159 3300030878 Bacteria 3650
321 Ga0265770_1006099 3300030878 Bacteria 1671
322 Ga0265765_1001243 3300030879 Bacteria 2315
323 Ga0265760_10005953 3300031090 Bacteria 3484
324 Ga0265760_10011348 3300031090 Bacteria 2545
325 Ga0265760_10012158 3300031090 Bacteria 2459
326 Ga0265339_10067744 3300031249 Bacteria 1909
327 Ga0265331_10005182 3300031250 Bacteria 7919
328 Ga0265331_10006734 3300031250 Bacteria 6737
329 Ga0265331_10062614 3300031250 Bacteria 1754
330 Ga0265316_10003023 3300031344 Bacteria 17186
331 Ga0265316_10010847 3300031344 Bacteria 8274
332 Ga0265316_10019727 3300031344 Bacteria 5758
333 Ga0265316_10048998 3300031344 Bacteria 3330
334 Ga0307405_10001628 3300031731 Bacteria 9548
335 Ga0307416_100063844 3300032002 Bacteria 3018
336 Ga0373926_0005527 3300035083 Bacteria 4170
337 Ga0373945_0001309 3300035116 Bacteria 7551
338 Ga0373954_0000878 3300035118 Bacteria 11685
339 Ga0373954_0027323 3300035118 Bacteria 2618
340 Ga0373956_0003945 3300035119 Bacteria 5959
341 Ga0373956_0019795 3300035119 Bacteria 2857
342 Ga0373956_0040933 3300035119 Bacteria 2057
343 Ga0373943_0002503 3300035170 Bacteria 8350
344 Ga0373943_0042456 3300035170 Bacteria 2204
345 Ga0373955_0016002 3300035172 Bacteria 3684
346 Ga0373924_0000016 3300035410 Bacteria 43046
347 Ga0373931_0016841 3300035691 Bacteria 3605
348 Ga0373935_0038778 3300035692 Bacteria 2984
349 Ga0373935_0136925 3300035692 Bacteria 1650
350 Ga0373927_0003819 3300035695 Bacteria 10691
351 Ga0373927_0114226 3300035695 Bacteria 1760
352 Ga0373933_0003465 3300035724 Bacteria 8783
353 Ga0373933_0049819 3300035724 Bacteria 2498
354 Ga0373947_0009100 3300035725 Bacteria 5707
355 Ga0373947_0014172 3300035725 Bacteria 4571
356 Ga0373947_0014200 3300035725 Bacteria 4567
357 Ga0373937_0000266 3300036401 Bacteria 50315
358 Ga0373937_0000397 3300036401 Bacteria 40594
359 Ga0373937_0000562 3300036401 Bacteria 32919
360 Ga0373937_0004124 3300036401 Bacteria 12328
361 Ga0373937_0011482 3300036401 Bacteria 7776
362 Ga0373937_0013870 3300036401 Bacteria 7104
363 Ga0373937_0050272 3300036401 Bacteria 3818
364 Ga0316582_0013329 3300036647 Bacteria 4623
365 Ga0316584_0018462 3300036712 Bacteria 5033
366 Ga0373925_0002239 3300037068 Bacteria 15682
367 Ga0373925_0008191 3300037068 Bacteria 7606
368 Ga0373925_0037999 3300037068 Bacteria 3556
369 Ga0316581_0012922 3300037588 Bacteria 2360
370 Ga0436364_0712212 3300037853 Bacteria 7214
371 Ga0436360_0380383 3300039438 Bacteria 11032
372 Ga0436361_0321415 3300039447 Bacteria 3713
373 Ga0436361_0937214 3300039447 Bacteria 8756
374 Ga0436363_0562392 3300039450 Bacteria 11721
375 Ga0436362_1144378 3300039453 Bacteria 11423
376 Ga0450914_000181 3300042118 Bacteria 2304
377 Ga0466963_0048671 3300044694 Bacteria 2802
378 Ga0453684_0048873 3300044712 Bacteria 5585
379 Ga0466957_0024768 3300044842 Bacteria 3553
380 Ga0466959_0009247 3300045049 Bacteria 7004
381 Ga0451576_0087853 3300045051 Bacteria 3233
382 Ga0451576_0214360 3300045051 Bacteria 2011
383 Ga0495592_0062290 3300046454 Bacteria 2739
384 Ga0495629_0035468 3300046459 Bacteria 3524
385 Ga0495651_0037616 3300046462 Bacteria 3768
386 Ga0495651_0049396 3300046462 Bacteria 3247
387 Ga0495651_0097150 3300046462 Bacteria 2200
388 Ga0495580_0002529 3300046472 Bacteria 15945
389 Ga0495580_0003499 3300046472 Bacteria 13360
390 Ga0495580_0004286 3300046472 Bacteria 11997
391 Ga0495580_0005446 3300046472 Bacteria 10518
392 Ga0495580_0066159 3300046472 Bacteria 2531
393 Ga0495580_0108149 3300046472 Bacteria 1931
394 Ga0495580_0139538 3300046472 Bacteria 1680
395 Ga0495582_0002957 3300046473 Bacteria 9517
396 Ga0495582_0004699 3300046473 Bacteria 7679
397 Ga0495582_0017526 3300046473 Bacteria 3918
398 Ga0495639_0058803 3300046475 Bacteria 1759
399 Ga0495584_0020295 3300046491 Bacteria 3377
400 Ga0495583_0000248 3300046506 Bacteria 89173
401 Ga0495666_0019711 3300046526 Bacteria 3345
402 Ga0495642_0007585 3300046528 Bacteria 4157
403 Ga0495652_0125769 3300046529 Bacteria 2037
404 Ga0495665_0011025 3300046531 Bacteria 4890
405 Ga0495665_0023596 3300046531 Bacteria 3304
406 Ga0495640_0054471 3300046533 Bacteria 2739
407 Ga0495586_0029366 3300046535 Bacteria 2942
408 Ga0495587_0000430 3300046536 Bacteria 29427
409 Ga0495587_0001959 3300046536 Bacteria 13725
410 Ga0495587_0014637 3300046536 Bacteria 4914
411 Ga0495634_0058486 3300046642 Bacteria 2569
412 Ga0495659_0047359 3300046664 Bacteria 1555
413 Ga0495661_0006197 3300046665 Bacteria 8420
414 Ga0495647_0008183 3300046681 Bacteria 3514
415 Ga0495658_0037231 3300046683 Bacteria 2688
416 Ga0495649_0033735 3300046694 Bacteria 2817
417 Ga0495581_0036158 3300047315 Bacteria 2857
418 Ga0495604_0001503 3300047317 Bacteria 19219
419 Ga0495604_0047109 3300047317 Bacteria 3360
420 Ga0495604_0099424 3300047317 Bacteria 2141
421 Ga0495636_0008949 3300047318 Bacteria 3943
422 Ga0495674_0077804 3300047319 Bacteria 2851
423 Ga0495674_0078247 3300047319 Bacteria 2842
424 Ga0495676_0011015 3300047321 Bacteria 8179
425 Ga0495680_0043355 3300047322 Bacteria 3563
426 Ga0495675_0001738 3300047444 Bacteria 13034
427 Ga0495684_0006626 3300047471 Bacteria 8983
428 Ga0495602_0000596 3300048088 Bacteria 33879
429 Ga0495602_0033144 3300048088 Bacteria 4851
430 Ga0496100_0023230 3300048903 Bacteria 3765
431 Ga0496101_0013752 3300048904 Bacteria 5429
432 Ga0496101_0108502 3300048904 Bacteria 2087
433 Ga0496102_0003287 3300048905 Bacteria 13705
434 Ga0496102_0081611 3300048905 Bacteria 2981
435 Ga0496102_0149093 3300048905 Bacteria 2197
436 Ga0496103_0003343 3300048906 Bacteria 9811
437 Ga0496103_0048121 3300048906 Bacteria 2635
438 Ga0496104_0015474 3300048907 Bacteria 6908
439 Ga0496104_0177988 3300048907 Bacteria 2037
440 Ga0496104_0376397 3300048907 Bacteria 1332
441 Ga0496105_0002451 3300048908 Bacteria 13425
442 Ga0496105_0068945 3300048908 Bacteria 2922
443 Ga0496106_0040313 3300048909 Bacteria 3497
444 Ga0496106_0072238 3300048909 Bacteria 2639
445 Ga0496106_0105628 3300048909 Bacteria 2188
446 Ga0496107_0022557 3300048910 Bacteria 4448
447 Ga0496109_0000428 3300048912 Bacteria 36938
448 Ga0496112_0018191 3300048915 Bacteria 6614
449 Ga0496112_0041807 3300048915 Bacteria 4484
450 Ga0496112_0078045 3300048915 Bacteria 3275
451 Ga0496113_0001982 3300048916 Bacteria 11732
452 Ga0496114_0003393 3300048917 Bacteria 12234
453 Ga0496114_0008339 3300048917 Bacteria 8209
454 Ga0496114_0197242 3300048917 Bacteria 1762
455 Ga0496115_0019692 3300048918 Bacteria 5196
456 Ga0496119_0001037 3300048922 Bacteria 35545
457 Ga0496120_0000843 3300048923 Bacteria 43594
458 Ga0501033_0029312 3300049570 Bacteria 4136
459 Ga0501034_0103003 3300049571 Bacteria 2848
460 Ga0501068_0056126 3300049584 Bacteria 2387
461 nmdc:mga05p37_37948_c1 3300050507 Bacteria 5909
462 nmdc:mga0qj67_3155_c1 3300050509 Bacteria 11867
463 nmdc:mga0qj67_88356_c1 3300050509 Bacteria 2488
464 nmdc:mga0n895_48031_c1 3300050512 Bacteria 4176
465 nmdc:mga0rr50_28363_c1 3300050513 Bacteria 3934
466 nmdc:mga0rr50_86043_c1 3300050513 Bacteria 2437
467 nmdc:mga08x19_27287_c1 3300050514 Bacteria 3570
468 nmdc:mga08x19_40049_c1 3300050514 Unclassified 2981
469 nmdc:mga08x19_7752_c1 3300050514 Bacteria 6377
470 nmdc:mga08x19_78181_c1 3300050514 Bacteria 2168
471 nmdc:mga08x19_9800_c1 3300050514 Bacteria 5739
472 Ga0495601_0065586 3300053077 Bacteria 2311
473 Ga0495612_0043041 3300053078 Bacteria 1844
474 Ga0500555_000127 3300053103 Bacteria 36304
475 Ga0500616_0000075 3300053153 Bacteria 221455
476 Ga0500637_0001382 3300053178 Bacteria 10312
477 2522553638 2522125168 Bacteria 7376607
478 2911139824 2911138879 Bacteria 5811561
479 2974316352 2974315732 Bacteria 4602776
480 2984524516 2984523437 Bacteria 4508481
481 Ga0496102_0040772
482 Ga0055536_1005576
483 Ga0065165_1000861
484 Ga0070683_100000023
485 Ga0070683_100002487
486 Ga0070683_100102629
487 Ga0070683_100168340
488 Ga0070670_100002755
489 Ga0068869_100041115
490 Ga0068868_100005397
491 Ga0070660_100182265
492 Ga0070689_100048205
493 Ga0070687_100072029
494 Ga0070661_100014783
495 Ga0070661_100018976
496 Ga0070692_10056286
497 Ga0070669_100033452
498 Ga0070669_100088441
499 Ga0070675_100000534
500 Ga0070673_100081075
501 Ga0070688_100031361
502 Ga0070709_10004170
503 Ga0070709_10048780
504 Ga0070709_10057510
505 Ga0070714_100002293
506 Ga0070714_100017569
507 Ga0070714_100047523
508 Ga0070714_100285843
509 Ga0070713_100012400
510 Ga0070713_100046316
511 Ga0070713_100050423
512 Ga0070713_100081652
513 Ga0070713_100114403
514 Ga0070710_10020162
515 Ga0070710_10025974
516 Ga0070711_100011680
517 Ga0070711_100011880
518 Ga0070711_100023025
519 Ga0070711_100064663
520 Ga0070705_100108003
521 Ga0070694_100003262
522 Ga0070694_100004415
523 Ga0070708_100003823
524 Ga0070708_100008248
525 Ga0070708_100011718
526 Ga0070708_100026928
527 Ga0070708_100045079
528 Ga0070708_100047828
529 Ga0070663_100007514
530 Ga0070678_100109784
531 Ga0070662_100006127
532 Ga0070681_10007844
533 Ga0070681_10095202
534 Ga0068867_100083246
535 Ga0068867_100120988
536 Ga0070685_10028034
537 Ga0070706_100001270
538 Ga0070706_100012451
539 Ga0070706_100017162
540 Ga0070706_100018487
541 Ga0070706_100064685
542 Ga0070706_100113754
543 Ga0070706_100200781
544 Ga0070707_100018036
545 Ga0070707_100025625
546 Ga0070698_100009258
547 Ga0070698_100011453
548 Ga0070698_100055179
549 Ga0070699_100002435
550 Ga0070699_100006069
551 Ga0070699_100064282
552 Ga0070679_100005094
553 Ga0070679_100015828
554 Ga0070679_100145759
555 Ga0070679_100273295
556 Ga0070684_100000116
557 Ga0070684_100013183
558 Ga0070684_100082555
559 Ga0070697_100000214
560 Ga0070697_100005713
561 Ga0070697_100007475
562 Ga0070697_100013140
563 Ga0070697_100021147
564 Ga0070697_100050916
565 Ga0068853_100089249
566 Ga0070686_100028267
567 Ga0070695_100015152
568 Ga0070696_100010146
569 Ga0070696_100026966
570 Ga0070696_100064826
571 Ga0070693_100000253
572 Ga0070665_100001312
573 Ga0070665_100007075
574 Ga0070665_100078422
575 Ga0070704_100000070
576 Ga0068855_100044829
577 Ga0068855_100070162
578 Ga0068855_100108921
579 Ga0070664_100067968
580 Ga0070664_100082278
581 Ga0068857_100051414
582 Ga0068854_100021982
583 Ga0070702_100017067
584 Ga0068852_100064040
585 Ga0068859_100040547
586 Ga0068864_100053662
587 Ga0068861_100002063
588 Ga0068870_10020004
589 Ga0068863_100000764
590 Ga0068863_100176453
591 Ga0068863_100216824
592 Ga0068858_100010967
593 Ga0068858_100069892
594 Ga0068860_100015433
595 Ga0068860_100075650
596 Ga0068860_100087977
597 Ga0068862_100107473
598 Ga0081540_1018833
599 Ga0070717_10002640
600 Ga0070717_10006541
601 Ga0070717_10018614
602 Ga0070716_100000221
603 Ga0070716_100001016
604 Ga0070716_100001398
605 Ga0070716_100039864
606 Ga0070712_100000175
607 Ga0070712_100021313
608 Ga0070712_100068577
609 Ga0070712_100083965
610 Ga0097621_100005958
611 Ga0097621_100035041
612 Ga0097621_100081373
613 Ga0068871_100091790
614 Ga0068871_100133795
615 Ga0075431_100008502
616 Ga0075431_100112007
617 Ga0075433_10017086
618 Ga0075433_10073419
619 Ga0075434_100014860
620 Ga0075434_100038879
621 Ga0068865_100020707
622 Ga0075436_100007096
623 Ga0075436_100014486
624 Ga0075436_100015790
625 Ga0075436_100127436
626 Ga0097620_100040547
627 Ga0075435_100014963
628 Ga0075435_100034572
629 Ga0099794_10002558
630 Ga0099794_10006359
631 Ga0099794_10006541
632 Ga0099795_10003741
633 Ga0099795_10015344
634 Ga0105240_10002509
635 Ga0105240_10055027
636 Ga0105240_10191030
637 Ga0111539_10014647
638 Ga0111539_10022515
639 Ga0105245_10008688
640 Ga0105245_10012813
641 Ga0105245_10037175
642 Ga0105245_10100037
643 Ga0114129_10020391
644 Ga0114129_10027475
645 Ga0114129_10180564
646 Ga0105243_10006216
647 Ga0105243_10038661
648 Ga0105241_10086332
649 Ga0105242_10121821
650 Ga0105248_10017574
651 Ga0105248_10109844
652 Ga0105248_10134814
653 Ga0105248_10245721
654 Ga0105237_10004212
655 Ga0105237_10019824
656 Ga0105237_10050625
657 Ga0105238_10039389
658 Ga0105238_10091297
659 Ga0105249_10166080
660 Ga0105239_10051080
661 Ga0105239_10182903
662 Ga0105239_10239590
663 Ga0105246_10009434
664 Ga0157373_10054086
665 Ga0157373_10105777
666 Ga0157370_10016077
667 Ga0157369_10039529
668 Ga0157369_10115711
669 Ga0157374_10000262
670 Ga0157374_10000480
671 Ga0157374_10015893
672 Ga0157378_10000081
673 Ga0157378_10001031
674 Ga0157378_10024532
675 Ga0163162_10005088
676 Ga0163162_10011257
677 Ga0163162_10051553
678 Ga0163162_10122138
679 Ga0157372_10001653
680 Ga0157375_10002088
681 Ga0157375_10146152
682 Ga0163163_10005873
683 Ga0163163_10020209
684 Ga0163163_10112133
685 Ga0157377_10009080
686 Ga0157379_10004886
687 Ga0157379_10238627
688 Ga0157376_10000050
689 Ga0157376_10000058
690 Ga0157376_10000647
691 Ga0213873_10008412
692 Ga0213872_10003152
693 Ga0213872_10018631
694 Ga0213872_10041083
695 Ga0213874_10000967
696 Ga0213875_10012346
697 Ga0224572_1000042
698 Ga0228598_1000110
699 Ga0209676_1000363
700 Ga0207692_10019019
701 Ga0207692_10042057
702 Ga0207642_10016429
703 Ga0207680_10037557
704 Ga0207685_10016793
705 Ga0207699_10001517
706 Ga0207699_10005536
707 Ga0207699_10022630
708 Ga0207699_10034492
709 Ga0207699_10060986
710 Ga0207645_10008683
711 Ga0207643_10028908
712 Ga0207684_10000307
713 Ga0207684_10018831
714 Ga0207684_10053181
715 Ga0207654_10004210
716 Ga0207707_10023020
717 Ga0207707_10047482
718 Ga0207707_10084871
719 Ga0207695_10008610
720 Ga0207695_10020253
721 Ga0207695_10172479
722 Ga0207693_10000013
723 Ga0207693_10015462
724 Ga0207693_10035596
725 Ga0207693_10100673
726 Ga0207663_10007273
727 Ga0207663_10022872
728 Ga0207662_10019212
729 Ga0207657_10010615
730 Ga0207652_10011133
731 Ga0207652_10105194
732 Ga0207652_10116838
733 Ga0207652_10119690
734 Ga0207646_10000473
735 Ga0207646_10007765
736 Ga0207646_10077396
737 Ga0207646_10171954
738 Ga0207681_10044345
739 Ga0207659_10000860
740 Ga0207659_10046316
741 Ga0207687_10001896
742 Ga0207687_10005920
743 Ga0207700_10053280
744 Ga0207700_10080525
745 Ga0207700_10174087
746 Ga0207664_10031890
747 Ga0207664_10057756
748 Ga0207664_10064442
749 Ga0207664_10085909
750 Ga0207644_10101431
751 Ga0207706_10003535
752 Ga0207670_10019958
753 Ga0207704_10004044
754 Ga0207665_10000156
755 Ga0207665_10000267
756 Ga0207665_10001266
757 Ga0207665_10004917
758 Ga0207665_10021234
759 Ga0207665_10034042
760 Ga0207665_10070937
761 Ga0207665_10085611
762 Ga0207691_10202806
763 Ga0207711_10006797
764 Ga0207689_10057649
765 Ga0207689_10175105
766 Ga0207661_10000027
767 Ga0207661_10041108
768 Ga0207661_10163749
769 Ga0207679_10013167
770 Ga0207667_10045045
771 Ga0207651_10022905
772 Ga0207651_10096210
773 Ga0207677_10042035
774 Ga0207703_10057742
775 Ga0207678_10000405
776 Ga0207702_10022508
777 Ga0207641_10005322
778 Ga0207641_10040348
779 Ga0207641_10098954
780 Ga0207641_10248054
781 Ga0207676_10029430
782 Ga0207674_10004680
783 Ga0207674_10070402
784 Ga0207675_100084987
785 Ga0207683_10059839
786 Ga0209588_1003361
787 Ga0209588_1004853
788 Ga0209588_1005088
789 Ga0265354_1000390
790 Ga0265354_1001007
791 Ga0268266_10000227
792 Ga0268266_10033070
793 Ga0268265_10045460
794 Ga0268264_10013257
795 Ga0268264_10013315
796 Ga0265318_10006620
797 Ga0265338_10025493
798 Ga0265762_1000725
799 Ga0265762_1002540
800 Ga0265770_1001159
801 Ga0265770_1006099
802 Ga0265765_1001243
803 Ga0265760_10005953
804 Ga0265760_10011348
805 Ga0265760_10012158
806 Ga0265339_10067744
807 Ga0265331_10005182
808 Ga0265331_10006734
809 Ga0265331_10062614
810 Ga0265316_10003023
811 Ga0265316_10010847
812 Ga0265316_10019727
813 Ga0265316_10048998
814 Ga0307405_10001628
815 Ga0307416_100063844
816 Ga0373926_0005527
817 Ga0373945_0001309
818 Ga0373954_0000878
819 Ga0373954_0027323
820 Ga0373956_0003945
821 Ga0373956_0019795
822 Ga0373956_0040933
823 Ga0373943_0002503
824 Ga0373943_0042456
825 Ga0373955_0016002
826 Ga0373924_0000016
827 Ga0373931_0016841
828 Ga0373935_0038778
829 Ga0373935_0136925
830 Ga0373927_0003819
831 Ga0373927_0114226
832 Ga0373933_0003465
833 Ga0373933_0049819
834 Ga0373947_0009100
835 Ga0373947_0014172
836 Ga0373947_0014200
837 Ga0373937_0000266
838 Ga0373937_0000397
839 Ga0373937_0000562
840 Ga0373937_0004124
841 Ga0373937_0011482
842 Ga0373937_0013870
843 Ga0373937_0050272
844 Ga0316582_0013329
845 Ga0316584_0018462
846 Ga0373925_0002239
847 Ga0373925_0008191
848 Ga0373925_0037999
849 Ga0316581_0012922
850 Ga0436364_0712212
851 Ga0436360_0380383
852 Ga0436361_0321415
853 Ga0436361_0937214
854 Ga0436363_0562392
855 Ga0436362_1144378
856 Ga0450914_000181
857 Ga0466963_0048671
858 Ga0453684_0048873
859 Ga0466957_0024768
860 Ga0466959_0009247
861 Ga0451576_0087853
862 Ga0451576_0214360
863 Ga0495592_0062290
864 Ga0495629_0035468
865 Ga0495651_0037616
866 Ga0495651_0049396
867 Ga0495651_0097150
868 Ga0495580_0002529
869 Ga0495580_0003499
870 Ga0495580_0004286
871 Ga0495580_0005446
872 Ga0495580_0066159
873 Ga0495580_0108149
874 Ga0495580_0139538
875 Ga0495582_0002957
876 Ga0495582_0004699
877 Ga0495582_0017526
878 Ga0495639_0058803
879 Ga0495584_0020295
880 Ga0495583_0000248
881 Ga0495666_0019711
882 Ga0495642_0007585
883 Ga0495652_0125769
884 Ga0495665_0011025
885 Ga0495665_0023596
886 Ga0495640_0054471
887 Ga0495586_0029366
888 Ga0495587_0000430
889 Ga0495587_0001959
890 Ga0495587_0014637
891 Ga0495634_0058486
892 Ga0495659_0047359
893 Ga0495661_0006197
894 Ga0495647_0008183
895 Ga0495658_0037231
896 Ga0495649_0033735
897 Ga0495581_0036158
898 Ga0495604_0001503
899 Ga0495604_0047109
900 Ga0495604_0099424
901 Ga0495636_0008949
902 Ga0495674_0077804
903 Ga0495674_0078247
904 Ga0495676_0011015
905 Ga0495680_0043355
906 Ga0495675_0001738
907 Ga0495684_0006626
908 Ga0495602_0000596
909 Ga0495602_0033144
910 Ga0496100_0023230
911 Ga0496101_0013752
912 Ga0496101_0108502
913 Ga0496102_0003287
914 Ga0496102_0081611
915 Ga0496102_0149093
916 Ga0496103_0003343
917 Ga0496103_0048121
918 Ga0496104_0015474
919 Ga0496104_0177988
920 Ga0496104_0376397
921 Ga0496105_0002451
922 Ga0496105_0068945
923 Ga0496106_0040313
924 Ga0496106_0072238
925 Ga0496106_0105628
926 Ga0496107_0022557
927 Ga0496109_0000428
928 Ga0496112_0018191
929 Ga0496112_0041807
930 Ga0496112_0078045
931 Ga0496113_0001982
932 Ga0496114_0003393
933 Ga0496114_0008339
934 Ga0496114_0197242
935 Ga0496115_0019692
936 Ga0496119_0001037
937 Ga0496120_0000843
938 Ga0501033_0029312
939 Ga0501034_0103003
940 Ga0501068_0056126
941 nmdc:mga05p37_37948_c1
942 nmdc:mga0qj67_3155_c1
943 nmdc:mga0qj67_88356_c1
944 nmdc:mga0n895_48031_c1
945 nmdc:mga0rr50_28363_c1
946 nmdc:mga0rr50_86043_c1
947 nmdc:mga08x19_27287_c1
948 nmdc:mga08x19_40049_c1
949 nmdc:mga08x19_7752_c1
950 nmdc:mga08x19_78181_c1
951 nmdc:mga08x19_9800_c1
952 Ga0495601_0065586
953 Ga0495612_0043041
954 Ga0500555_000127
955 Ga0500616_0000075
956 Ga0500637_0001382
957 2522553638
958 2911139824
959 2974316352
960 2984524516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00370

FGGY_N

FGGY family of carbohydrate kinases, N-terminal domain

27

270

0.98

PF02782

FGGY_C

FGGY family of carbohydrate kinases, C-terminal domain

279

470

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4w-assembly1.cif.gz_B crystal structure of glycerol kinase from cellulomonas sp. nt3060 0.979 3 499
6k79-assembly2.cif.gz_C glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9767 3 497
6k79-assembly1.cif.gz_B-2 glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9755 3 497
6zq4-assembly4.cif.gz_F crystal structure of chaetomium thermophilum glycerol kinase in complex with substrate in p1 space group 0.9742 3 499
6k78-assembly1.cif.gz_A glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9742 3 497
ID Description Score Start End Superfamily
1gleG01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9794 3 253 3.30.420.40
4e1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9768 4 253 3.30.420.40
af_Q7JY99_14_266_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9703 7 251 3.30.420.40
4e1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9691 4 253 3.30.420.40
af_Q63060_9_266_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9668 1 251 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A4R9B0T7-F1-model_v4 Glycerol kinase 0.9917 1 107 GO:0004370
GO:0005829
GO:0019563
AF-A0A3M2YHT2-F1-model_v4 Glycerol kinase 0.9914 2 81 GO:0004370
GO:0005829
GO:0019563
AF-A0A259S2Z2-F1-model_v4 ATP:glycerol 3-phosphotransferase 0.9908 16 439 GO:0004370
GO:0005524
GO:0005829
GO:0006072
GO:0019563
AF-A0A7X6WC90-F1-model_v4 Glycerol kinase 0.9905 2 118 GO:0004370
GO:0005829
GO:0019563
AF-A0A7S2SKS2-F1-model_v4 Carbohydrate kinase FGGY N-terminal domain-containing protein 0.9903 1 121 GO:0004370
GO:0005524
GO:0005829
GO:0006071

Map