F452232

General Info

Members Datasets Scaffolds Average Seq Length
480 229 960 172

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10689991|Ga0157376_106899911
Length 176
Sequence MFMKTLEEKWTAWLDDQLGGRELSEFEASLPDKAAAQAEKAEAKKLGKLLKRELSAHPLKNEEFFSHQLRERIVQESGEQPRERARRNPTSNWWTIPRLLWAGTGSLAVFLICTVLVMHQERPGEESQYLTQILNARVDPVVSPNGTVSIFEVKQDRVTVLWTEGLQTLPADYAAK

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.08
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 24.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10689991 3300014969 Bacteria 1025
2 SwRhRL2b_contig_2070193 2162886007 Bacteria 920
3 JGI24737J22298_10012645 3300001990 Bacteria 2751
4 JGI24035J26624_1000141 3300002126 Bacteria 6413
5 JGI24035J26624_1003257 3300002126 Unclassified 1525
6 JGI25404J52841_10004829 3300003659 Unclassified 2760
7 JGI25405J52794_10000412 3300003911 Bacteria 6018
8 JGI25405J52794_10002813 3300003911 Bacteria 3019
9 JGI25405J52794_10024888 3300003911 Bacteria 1224
10 Ga0065714_10094929 3300005288 Bacteria 1801
11 Ga0065704_10004850 3300005289 Bacteria 3990
12 Ga0065704_10027173 3300005289 Bacteria 1245
13 Ga0065704_10073950 3300005289 Bacteria 6644
14 Ga0065704_10091739 3300005289 Bacteria 2696
15 Ga0065704_10438568 3300005289 Unclassified 701
16 Ga0065712_10001692 3300005290 Bacteria 6372
17 Ga0065712_10004664 3300005290 Bacteria 5980
18 Ga0065712_10016478 3300005290 Unclassified 1439
19 Ga0065712_10019107 3300005290 Unclassified 1834
20 Ga0065712_10026984 3300005290 Unclassified 1111
21 Ga0065712_10116148 3300005290 Bacteria 1740
22 Ga0065712_10180216 3300005290 Bacteria 1196
23 Ga0065715_10001727 3300005293 Bacteria 5692
24 Ga0065715_10089933 3300005293 Bacteria 8092
25 Ga0065715_10119901 3300005293 Unclassified 2274
26 Ga0065715_10167516 3300005293 Bacteria 1574
27 Ga0065715_10174334 3300005293 Unclassified 1523
28 Ga0065715_10340754 3300005293 Unclassified 886
29 Ga0065707_10013106 3300005295 Unclassified 2268
30 Ga0065707_10024750 3300005295 Unclassified 1842
31 Ga0065707_10118992 3300005295 Bacteria 2171
32 Ga0070658_10136660 3300005327 Bacteria 2046
33 Ga0070676_10494148 3300005328 Bacteria 867
34 Ga0070683_100041590 3300005329 Unclassified 4229
35 Ga0070683_100114079 3300005329 Bacteria 2550
36 Ga0070690_100070824 3300005330 Unclassified 2265
37 Ga0070666_10223058 3300005335 Bacteria 1330
38 Ga0070680_100026698 3300005336 Bacteria 4619
39 Ga0070680_100905527 3300005336 Unclassified 761
40 Ga0070660_100319905 3300005339 Bacteria 1274
41 Ga0070689_100000978 3300005340 Bacteria 17870
42 Ga0070689_100128485 3300005340 Bacteria 2031
43 Ga0070687_100068392 3300005343 Bacteria 1899
44 Ga0070661_100192774 3300005344 Bacteria 1555
45 Ga0070692_10116733 3300005345 Bacteria 1483
46 Ga0070668_100031417 3300005347 Bacteria 4040
47 Ga0070668_100178032 3300005347 Bacteria 1735
48 Ga0070668_100707515 3300005347 Unclassified 889
49 Ga0070669_100327219 3300005353 Bacteria 1239
50 Ga0070669_101690418 3300005353 Unclassified 552
51 Ga0070675_100003712 3300005354 Bacteria 11603
52 Ga0070675_100009595 3300005354 Bacteria 7533
53 Ga0070675_100063293 3300005354 Bacteria 3058
54 Ga0070675_100333325 3300005354 Bacteria 1342
55 Ga0070675_100574665 3300005354 Bacteria 1021
56 Ga0070671_100214076 3300005355 Bacteria 1634
57 Ga0070671_100619828 3300005355 Bacteria 935
58 Ga0070674_100337668 3300005356 Unclassified 1213
59 Ga0070674_100523768 3300005356 Unclassified 991
60 Ga0070674_100653919 3300005356 Bacteria 894
61 Ga0070673_100003140 3300005364 Bacteria 10230
62 Ga0070673_100016374 3300005364 Bacteria 5240
63 Ga0070688_100007537 3300005365 Bacteria 5872
64 Ga0070688_100076237 3300005365 Bacteria 2157
65 Ga0070688_100615751 3300005365 Bacteria 833
66 Ga0070659_100000971 3300005366 Bacteria 21095
67 Ga0070667_100281625 3300005367 Bacteria 1493
68 Ga0070667_100697066 3300005367 Bacteria 939
69 Ga0070709_10335287 3300005434 Bacteria 1114
70 Ga0070714_100022318 3300005435 Bacteria 5190
71 Ga0070714_100050890 3300005435 Bacteria 3531
72 Ga0070714_100132998 3300005435 Bacteria 2224
73 Ga0070714_100754987 3300005435 Bacteria 940
74 Ga0070713_100115542 3300005436 Unclassified 2346
75 Ga0070713_100226852 3300005436 Bacteria 1696
76 Ga0070713_100508376 3300005436 Unclassified 1137
77 Ga0070713_100791398 3300005436 Unclassified 909
78 Ga0070710_10169400 3300005437 Unclassified 1360
79 Ga0070710_10290018 3300005437 Bacteria 1065
80 Ga0070711_100012799 3300005439 Bacteria 5254
81 Ga0070711_100020670 3300005439 Unclassified 4247
82 Ga0070711_100114073 3300005439 Bacteria 1988
83 Ga0070705_100035698 3300005440 Bacteria 2789
84 Ga0070705_100128756 3300005440 Bacteria 1648
85 Ga0070705_100146728 3300005440 Bacteria 1560
86 Ga0070705_100229032 3300005440 Bacteria 1292
87 Ga0070700_100039609 3300005441 Bacteria 2880
88 Ga0070694_100024137 3300005444 Bacteria 3922
89 Ga0070708_100047427 3300005445 Bacteria 3795
90 Ga0070708_100085529 3300005445 Bacteria 2862
91 Ga0070708_100090982 3300005445 Unclassified 2778
92 Ga0070708_100117242 3300005445 Unclassified 2452
93 Ga0070708_100251169 3300005445 Bacteria 1661
94 Ga0070708_100549179 3300005445 Unclassified 1090
95 Ga0070678_100195049 3300005456 Unclassified 1667
96 Ga0070662_100097269 3300005457 Bacteria 2222
97 Ga0070662_100131592 3300005457 Bacteria 1930
98 Ga0070662_100496470 3300005457 Bacteria 1017
99 Ga0070662_100897270 3300005457 Bacteria 756
100 Ga0070681_10047861 3300005458 Bacteria 4274
101 Ga0070685_10004903 3300005466 Bacteria 6769
102 Ga0070685_10067747 3300005466 Unclassified 2106
103 Ga0070706_100018474 3300005467 Bacteria 6428
104 Ga0070706_100042062 3300005467 Bacteria 4220
105 Ga0070706_100132337 3300005467 Bacteria 2328
106 Ga0070706_100306393 3300005467 Bacteria 1482
107 Ga0070706_100430716 3300005467 Bacteria 1228
108 Ga0070706_100881451 3300005467 Unclassified 827
109 Ga0070707_100039255 3300005468 Bacteria 4524
110 Ga0070707_100052961 3300005468 Bacteria 3891
111 Ga0070707_100162077 3300005468 Bacteria 2179
112 Ga0070707_100230858 3300005468 Unclassified 1801
113 Ga0070707_101540367 3300005468 Unclassified 632
114 Ga0070698_100028712 3300005471 Bacteria 5775
115 Ga0070698_100234901 3300005471 Bacteria 1766
116 Ga0070698_100258988 3300005471 Unclassified 1672
117 Ga0070699_100208581 3300005518 Bacteria 1739
118 Ga0070699_100242601 3300005518 Unclassified 1609
119 Ga0070699_100267075 3300005518 Bacteria 1531
120 Ga0070699_100731637 3300005518 Unclassified 904
121 Ga0070679_100043747 3300005530 Bacteria 4459
122 Ga0070684_100006663 3300005535 Bacteria 8952
123 Ga0070684_100041434 3300005535 Bacteria 3970
124 Ga0070684_100099186 3300005535 Unclassified 2599
125 Ga0070684_100144234 3300005535 Bacteria 2155
126 Ga0070684_100160218 3300005535 Bacteria 2041
127 Ga0070684_100399990 3300005535 Unclassified 1266
128 Ga0070697_100002917 3300005536 Bacteria 13156
129 Ga0070697_100012443 3300005536 Bacteria 6668
130 Ga0070697_100018284 3300005536 Bacteria 5524
131 Ga0070697_100019422 3300005536 Bacteria 5369
132 Ga0070697_100074750 3300005536 Bacteria 2784
133 Ga0070697_100383910 3300005536 Unclassified 1217
134 Ga0070697_100390410 3300005536 Unclassified 1207
135 Ga0070697_100412577 3300005536 Bacteria 1173
136 Ga0070697_100457155 3300005536 Bacteria 1113
137 Ga0070672_100495084 3300005543 Bacteria 1057
138 Ga0070665_100048215 3300005548 Bacteria 4277
139 Ga0070665_101206620 3300005548 Bacteria 767
140 Ga0070704_100002924 3300005549 Bacteria 9704
141 Ga0068855_101989899 3300005563 Bacteria 587
142 Ga0070664_100523318 3300005564 Bacteria 1095
143 Ga0070664_100596767 3300005564 Bacteria 1024
144 Ga0068856_100246292 3300005614 Bacteria 1802
145 Ga0068864_100578497 3300005618 Bacteria 1088
146 Ga0068861_100130976 3300005719 Bacteria 2036
147 Ga0068861_100907316 3300005719 Bacteria 835
148 Ga0068863_100003600 3300005841 Bacteria 15293
149 Ga0068858_100068419 3300005842 Bacteria 3291
150 Ga0068858_100320271 3300005842 Bacteria 1482
151 Ga0068860_100037757 3300005843 Bacteria 4622
152 Ga0081455_10001872 3300005937 Bacteria 25307
153 Ga0081455_10016809 3300005937 Bacteria 7039
154 Ga0081455_10016935 3300005937 Bacteria 7007
155 Ga0081455_10030722 3300005937 Bacteria 4875
156 Ga0081455_10044602 3300005937 Bacteria 3866
157 Ga0081455_10049102 3300005937 Unclassified 3640
158 Ga0081455_10134780 3300005937 Unclassified 1926
159 Ga0081455_10398506 3300005937 Bacteria 956
160 Ga0081540_1000036 3300005983 Bacteria 140805
161 Ga0081540_1034481 3300005983 Bacteria 2728
162 Ga0081539_10040243 3300005985 Bacteria 2746
163 Ga0070717_10093046 3300006028 Unclassified 2547
164 Ga0070717_10119455 3300006028 Bacteria 2256
165 Ga0070717_10150132 3300006028 Bacteria 2015
166 Ga0070717_10443304 3300006028 Bacteria 1169
167 Ga0070715_10047133 3300006163 Bacteria 1835
168 Ga0070715_10052209 3300006163 Bacteria 1762
169 Ga0070716_100016121 3300006173 Unclassified 3852
170 Ga0070716_100184230 3300006173 Bacteria 1374
171 Ga0070716_100261807 3300006173 Unclassified 1184
172 Ga0070712_100103973 3300006175 Unclassified 2106
173 Ga0070712_100122575 3300006175 Bacteria 1958
174 Ga0070712_100217983 3300006175 Bacteria 1509
175 Ga0070712_100289267 3300006175 Bacteria 1322
176 Ga0070712_100314383 3300006175 Unclassified 1272
177 Ga0070712_100393349 3300006175 Bacteria 1143
178 Ga0070712_100462086 3300006175 Bacteria 1059
179 Ga0070712_100660903 3300006175 Bacteria 889
180 Ga0070712_101030841 3300006175 Unclassified 713
181 Ga0097621_100195024 3300006237 Unclassified 1756
182 Ga0097621_101126170 3300006237 Bacteria 737
183 Ga0068871_100257457 3300006358 Unclassified 1521
184 Ga0068871_100363983 3300006358 Bacteria 1282
185 Ga0075428_100342689 3300006844 Bacteria 1605
186 Ga0075428_100766644 3300006844 Bacteria 1026
187 Ga0075433_10434038 3300006852 Bacteria 1158
188 Ga0075434_100206361 3300006871 Bacteria 1985
189 Ga0075434_100315267 3300006871 Bacteria 1584
190 Ga0068865_100307578 3300006881 Unclassified 1271
191 Ga0099794_10285779 3300007265 Bacteria 853
192 Ga0099794_10299269 3300007265 Unclassified 833
193 Ga0111539_10818175 3300009094 Unclassified 1084
194 Ga0111539_11255332 3300009094 Bacteria 860
195 Ga0105245_10442326 3300009098 Bacteria 1307
196 Ga0105245_11141640 3300009098 Bacteria 826
197 Ga0105245_11154743 3300009098 Unclassified 821
198 Ga0105245_11651040 3300009098 Bacteria 693
199 Ga0105247_10138968 3300009101 Bacteria 1590
200 Ga0105247_10593969 3300009101 Bacteria 820
201 Ga0114129_10007418 3300009147 Bacteria 15610
202 Ga0114129_10244078 3300009147 Bacteria 2413
203 Ga0114129_10265958 3300009147 Bacteria 2296
204 Ga0114129_10598948 3300009147 Unclassified 1428
205 Ga0105243_10127504 3300009148 Bacteria 2155
206 Ga0105241_10118065 3300009174 Bacteria 2132
207 Ga0105241_10872656 3300009174 Unclassified 834
208 Ga0105241_10893821 3300009174 Bacteria 824
209 Ga0105242_10368511 3300009176 Unclassified 1331
210 Ga0105248_11312752 3300009177 Bacteria 818
211 Ga0105249_10021762 3300009553 Bacteria 5741
212 Ga0105249_10122059 3300009553 Bacteria 2477
213 Ga0105249_10625246 3300009553 Unclassified 1133
214 Ga0099796_10029945 3300010159 Bacteria 1761
215 Ga0105239_10155992 3300010375 Bacteria 2549
216 Ga0105239_10217548 3300010375 Bacteria 2142
217 Ga0105239_10505219 3300010375 Bacteria 1375
218 Ga0105239_11481934 3300010375 Bacteria 784
219 Ga0105246_10408075 3300011119 Bacteria 1130
220 Ga0157371_10227161 3300013102 Bacteria 1341
221 Ga0157369_10607696 3300013105 Bacteria 1129
222 Ga0157374_10111000 3300013296 Bacteria 2637
223 Ga0157374_10383692 3300013296 Bacteria 1400
224 Ga0157374_10484372 3300013296 Bacteria 1240
225 Ga0157374_10688677 3300013296 Bacteria 1035
226 Ga0157374_11863618 3300013296 Unclassified 627
227 Ga0157378_10013099 3300013297 Bacteria 7254
228 Ga0157378_10023174 3300013297 Bacteria 5464
229 Ga0157378_10033296 3300013297 Unclassified 4555
230 Ga0157378_10366754 3300013297 Bacteria 1411
231 Ga0157378_10738567 3300013297 Bacteria 1006
232 Ga0157378_12411931 3300013297 Bacteria 578
233 Ga0157378_12419876 3300013297 Bacteria 577
234 Ga0163162_10224840 3300013306 Bacteria 2006
235 Ga0163162_10351894 3300013306 Unclassified 1606
236 Ga0163162_10444203 3300013306 Bacteria 1429
237 Ga0163162_10498761 3300013306 Bacteria 1348
238 Ga0163162_10718145 3300013306 Unclassified 1120
239 Ga0157372_10492839 3300013307 Unclassified 1429
240 Ga0157375_10115628 3300013308 Bacteria 2786
241 Ga0157375_10220135 3300013308 Bacteria 2056
242 Ga0157375_10488812 3300013308 Unclassified 1395
243 Ga0157375_10536949 3300013308 Unclassified 1332
244 Ga0157375_11879119 3300013308 Unclassified 711
245 Ga0163163_10119296 3300014325 Unclassified 2671
246 Ga0163163_10441232 3300014325 Bacteria 1361
247 Ga0163163_10550772 3300014325 Unclassified 1216
248 Ga0163163_10716924 3300014325 Unclassified 1064
249 Ga0182008_10064976 3300014497 Bacteria 1796
250 Ga0157377_10048614 3300014745 Bacteria 2381
251 Ga0157377_10603953 3300014745 Bacteria 783
252 Ga0157379_10100892 3300014968 Unclassified 2591
253 Ga0157379_11452792 3300014968 Bacteria 666
254 Ga0157376_10094594 3300014969 Bacteria 2597
255 Ga0157376_10135143 3300014969 Bacteria 2206
256 Ga0157376_10454591 3300014969 Bacteria 1250
257 Ga0182006_1020264 3300015261 Bacteria 2787
258 Ga0163161_10203079 3300017792 Unclassified 1528
259 Ga0206355_1145327 3300020076 Unclassified 762
260 Ga0207666_1001627 3300025271 Unclassified 2662
261 Ga0207697_10001294 3300025315 Bacteria 13739
262 Ga0207697_10001403 3300025315 Bacteria 13181
263 Ga0207697_10012438 3300025315 Bacteria 3567
264 Ga0207697_10025316 3300025315 Unclassified 2426
265 Ga0207697_10034103 3300025315 Bacteria 2084
266 Ga0207697_10093717 3300025315 Bacteria 1274
267 Ga0207692_10606353 3300025898 Unclassified 704
268 Ga0207680_10257224 3300025903 Bacteria 1207
269 Ga0207647_10004861 3300025904 Bacteria 9931
270 Ga0207685_10022911 3300025905 Bacteria 2118
271 Ga0207685_10199033 3300025905 Bacteria 940
272 Ga0207699_10119319 3300025906 Unclassified 1703
273 Ga0207699_10367150 3300025906 Bacteria 1019
274 Ga0207699_10670631 3300025906 Bacteria 758
275 Ga0207645_10293934 3300025907 Bacteria 1081
276 Ga0207705_10348965 3300025909 Unclassified 1140
277 Ga0207684_10024895 3300025910 Bacteria 5100
278 Ga0207684_10104691 3300025910 Unclassified 2420
279 Ga0207684_10107589 3300025910 Bacteria 2386
280 Ga0207684_10149719 3300025910 Bacteria 2008
281 Ga0207684_10682131 3300025910 Unclassified 874
282 Ga0207684_10839176 3300025910 Unclassified 775
283 Ga0207654_10538338 3300025911 Bacteria 828
284 Ga0207693_10035674 3300025915 Bacteria 3921
285 Ga0207693_10063349 3300025915 Bacteria 2896
286 Ga0207693_10084225 3300025915 Unclassified 2491
287 Ga0207693_10100253 3300025915 Unclassified 2270
288 Ga0207693_10515591 3300025915 Unclassified 933
289 Ga0207663_10055206 3300025916 Bacteria 2491
290 Ga0207663_10077235 3300025916 Bacteria 2167
291 Ga0207663_10177341 3300025916 Bacteria 1519
292 Ga0207663_10237294 3300025916 Unclassified 1335
293 Ga0207663_10362952 3300025916 Bacteria 1099
294 Ga0207660_10022146 3300025917 Bacteria 4280
295 Ga0207662_10047832 3300025918 Bacteria 2533
296 Ga0207657_10100597 3300025919 Bacteria 2400
297 Ga0207649_10113401 3300025920 Bacteria 1815
298 Ga0207652_10068891 3300025921 Unclassified 3071
299 Ga0207652_10805224 3300025921 Bacteria 834
300 Ga0207646_10076725 3300025922 Bacteria 2987
301 Ga0207646_10113228 3300025922 Bacteria 2435
302 Ga0207646_10384124 3300025922 Unclassified 1268
303 Ga0207646_11420269 3300025922 Unclassified 603
304 Ga0207681_10624154 3300025923 Bacteria 892
305 Ga0207659_10003753 3300025926 Bacteria 9156
306 Ga0207659_10028169 3300025926 Bacteria 3815
307 Ga0207659_10633215 3300025926 Bacteria 913
308 Ga0207687_11049905 3300025927 Unclassified 699
309 Ga0207700_10039447 3300025928 Unclassified 3438
310 Ga0207700_10290012 3300025928 Bacteria 1410
311 Ga0207700_10412209 3300025928 Unclassified 1185
312 Ga0207700_11080412 3300025928 Bacteria 717
313 Ga0207664_10085388 3300025929 Bacteria 2576
314 Ga0207664_10121339 3300025929 Bacteria 2187
315 Ga0207644_10213289 3300025931 Bacteria 1527
316 Ga0207644_10475179 3300025931 Bacteria 1029
317 Ga0207690_10001481 3300025932 Bacteria 14676
318 Ga0207690_10905866 3300025932 Unclassified 732
319 Ga0207706_10162413 3300025933 Bacteria 1963
320 Ga0207706_10993595 3300025933 Bacteria 705
321 Ga0207686_10213234 3300025934 Bacteria 1389
322 Ga0207709_10305429 3300025935 Bacteria 1185
323 Ga0207670_10003100 3300025936 Bacteria 8793
324 Ga0207670_10097423 3300025936 Bacteria 2094
325 Ga0207665_10026896 3300025939 Unclassified 3800
326 Ga0207665_10318360 3300025939 Bacteria 1167
327 Ga0207691_10100551 3300025940 Unclassified 2581
328 Ga0207711_10496751 3300025941 Bacteria 1137
329 Ga0207679_10325844 3300025945 Bacteria 1332
330 Ga0207679_10525205 3300025945 Bacteria 1059
331 Ga0207651_10714929 3300025960 Bacteria 883
332 Ga0207712_10092201 3300025961 Bacteria 2233
333 Ga0207712_10163457 3300025961 Bacteria 1733
334 Ga0207668_10056103 3300025972 Bacteria 2742
335 Ga0207668_10527304 3300025972 Unclassified 1020
336 Ga0207668_11010348 3300025972 Bacteria 743
337 Ga0207658_10067376 3300025986 Bacteria 2696
338 Ga0207658_10490577 3300025986 Bacteria 1093
339 Ga0207677_10475463 3300026023 Bacteria 1075
340 Ga0207703_10009368 3300026035 Bacteria 7696
341 Ga0207703_10200678 3300026035 Bacteria 1772
342 Ga0207678_10001585 3300026067 Bacteria 20917
343 Ga0207708_10038619 3300026075 Bacteria 3637
344 Ga0207702_10128811 3300026078 Unclassified 2275
345 Ga0207641_10012427 3300026088 Bacteria 6981
346 Ga0207641_10084465 3300026088 Bacteria 2764
347 Ga0207676_10592417 3300026095 Bacteria 1064
348 Ga0207676_10633153 3300026095 Bacteria 1030
349 Ga0207675_100154766 3300026118 Bacteria 2184
350 Ga0207675_101637184 3300026118 Bacteria 664
351 Ga0207683_10221189 3300026121 Unclassified 1725
352 Ga0207698_11867719 3300026142 Unclassified 616
353 Ga0209981_1018057 3300027378 Bacteria 998
354 Ga0209984_1015919 3300027424 Unclassified 1002
355 Ga0209179_1020935 3300027512 Unclassified 1273
356 Ga0209588_1190886 3300027671 Bacteria 640
357 Ga0209974_10009094 3300027876 Bacteria 3377
358 Ga0268266_10053400 3300028379 Bacteria 3471
359 Ga0268266_10073310 3300028379 Bacteria 2971
360 Ga0268266_10669901 3300028379 Bacteria 999
361 Ga0268264_10016515 3300028381 Bacteria 6044
362 Ga0373944_0197817 3300035089 Bacteria 727
363 Ga0373936_0113169 3300035113 Bacteria 1154
364 Ga0373939_0297324 3300035114 Bacteria 643
365 Ga0373943_0080974 3300035170 Bacteria 1665
366 Ga0373943_0156850 3300035170 Bacteria 1236
367 Ga0373946_0040914 3300035171 Bacteria 1899
368 Ga0373946_0563645 3300035171 Unclassified 588
369 Ga0373955_0055517 3300035172 Bacteria 2170
370 Ga0373924_0131268 3300035410 Bacteria 1090
371 Ga0373931_0015102 3300035691 Bacteria 3785
372 Ga0373935_0018819 3300035692 Bacteria 4208
373 Ga0373935_0173486 3300035692 Bacteria 1476
374 Ga0373935_0262282 3300035692 Bacteria 1212
375 Ga0373927_0071472 3300035695 Bacteria 2246
376 Ga0373927_0076041 3300035695 Bacteria 2175
377 Ga0373933_0082536 3300035724 Unclassified 1973
378 Ga0373947_0028673 3300035725 Bacteria 3265
379 Ga0373947_0500425 3300035725 Bacteria 826
380 Ga0373947_0665902 3300035725 Bacteria 710
381 Ga0373937_0280144 3300036401 Bacteria 1574
382 Ga0373937_0975960 3300036401 Bacteria 796
383 Ga0373925_0010936 3300037068 Bacteria 6588
384 Ga0373925_0429049 3300037068 Bacteria 1081
385 Ga0373925_0525067 3300037068 Bacteria 973
386 Ga0373925_0590631 3300037068 Bacteria 914
387 Ga0395899_0202269 3300037312 Bacteria 1384
388 Ga0395900_0090143 3300037418 Bacteria 3152
389 Ga0395900_0537342 3300037418 Bacteria 1115
390 Ga0395898_0032973 3300037466 Bacteria 5170
391 Ga0395905_0346200 3300037471 Bacteria 1378
392 Ga0395905_0390710 3300037471 Unclassified 1286
393 Ga0395905_0626917 3300037471 Bacteria 977
394 Ga0395905_1757195 3300037471 Bacteria 526
395 Ga0395901_0001548 3300038443 Bacteria 23830
396 Ga0395901_0089180 3300038443 Bacteria 3227
397 Ga0395901_0378666 3300038443 Bacteria 1457
398 Ga0395901_0842928 3300038443 Unclassified 903
399 Ga0451835_0663666 3300041492 Unclassified 564
400 Ga0451853_0577735 3300041512 Bacteria 2215
401 Ga0439448_0018515 3300042005 Bacteria 2136
402 Ga0439455_0000520 3300042012 Bacteria 5374
403 Ga0439458_0014766 3300042157 Unclassified 1765
404 Ga0439464_0017248 3300042439 Unclassified 1957
405 Ga0495603_0356439 3300046455 Bacteria 839
406 Ga0495651_0538991 3300046462 Bacteria 743
407 Ga0495664_0119843 3300046477 Bacteria 1592
408 Ga0495594_0328732 3300046499 Bacteria 871
409 Ga0495608_0241548 3300046511 Bacteria 1128
410 Ga0495630_0142315 3300046517 Bacteria 1824
411 Ga0495630_0415061 3300046517 Bacteria 1031
412 Ga0495666_0085500 3300046526 Bacteria 1490
413 Ga0495652_0388810 3300046529 Bacteria 990
414 Ga0495665_0280518 3300046531 Bacteria 855
415 Ga0495640_0272038 3300046533 Unclassified 1056
416 Ga0495640_0589443 3300046533 Bacteria 672
417 Ga0495586_0166149 3300046535 Bacteria 1246
418 Ga0495587_0165475 3300046536 Bacteria 1257
419 Ga0495587_0348335 3300046536 Unclassified 826
420 Ga0495645_0006709 3300046543 Bacteria 7998
421 Ga0495634_0029418 3300046642 Bacteria 3803
422 Ga0495634_0143867 3300046642 Bacteria 1512
423 Ga0495657_0193567 3300046675 Bacteria 1242
424 Ga0495599_0002744 3300046678 Bacteria 10272
425 Ga0495623_0042456 3300046679 Bacteria 2896
426 Ga0495646_0036436 3300046680 Bacteria 3047
427 Ga0495647_0076865 3300046681 Bacteria 1347
428 Ga0495658_0308605 3300046683 Bacteria 1001
429 Ga0495669_0074203 3300046684 Bacteria 1555
430 Ga0495600_0227156 3300046809 Bacteria 1193
431 Ga0495604_0414233 3300047317 Bacteria 885
432 Ga0495674_0278005 3300047319 Bacteria 1372
433 Ga0495684_0010873 3300047471 Bacteria 7037
434 Ga0495602_0571903 3300048088 Bacteria 780
435 Ga0495614_0310439 3300048089 Bacteria 730
436 Ga0496101_0124446 3300048904 Bacteria 1953
437 Ga0496101_0254864 3300048904 Bacteria 1368
438 Ga0496102_0097697 3300048905 Bacteria 2724
439 Ga0496102_0159621 3300048905 Bacteria 2120
440 Ga0496102_0449645 3300048905 Bacteria 1209
441 Ga0496104_0065707 3300048907 Bacteria 3443
442 Ga0496104_0729065 3300048907 Bacteria 899
443 Ga0496104_0734994 3300048907 Bacteria 894
444 Ga0496104_1371686 3300048907 Unclassified 610
445 Ga0496105_0087870 3300048908 Bacteria 2568
446 Ga0496105_0142286 3300048908 Bacteria 1974
447 Ga0496106_0298970 3300048909 Bacteria 1291
448 Ga0496106_1031804 3300048909 Bacteria 646
449 Ga0496107_0158825 3300048910 Bacteria 1675
450 Ga0496107_0529096 3300048910 Unclassified 874
451 Ga0496109_0005026 3300048912 Bacteria 11049
452 Ga0496109_0829889 3300048912 Unclassified 862
453 Ga0496110_0173027 3300048913 Bacteria 1959
454 Ga0496110_0697704 3300048913 Bacteria 916
455 Ga0496111_0216760 3300048914 Unclassified 1422
456 Ga0496111_0251184 3300048914 Unclassified 1313
457 Ga0496111_0340997 3300048914 Bacteria 1109
458 Ga0496112_0034027 3300048915 Bacteria 4958
459 Ga0496112_0096332 3300048915 Unclassified 2929
460 Ga0496112_0743742 3300048915 Unclassified 907
461 Ga0496113_0044056 3300048916 Bacteria 3304
462 Ga0496113_0152026 3300048916 Unclassified 1827
463 Ga0496114_0018012 3300048917 Bacteria 5706
464 Ga0496114_0089371 3300048917 Bacteria 2614
465 Ga0496115_0098738 3300048918 Unclassified 2392
466 Ga0496115_0208927 3300048918 Bacteria 1612
467 Ga0496115_0224807 3300048918 Unclassified 1549
468 Ga0496115_0435005 3300048918 Bacteria 1061
469 Ga0496115_1144098 3300048918 Bacteria 588
470 Ga0501067_0705979 3300049583 Unclassified 567
471 Ga0501069_0784859 3300049585 Unclassified 577
472 nmdc:mga05p37_1054801_c1 3300050507 Bacteria 857
473 nmdc:mga05p37_4003_c1 3300050507 Bacteria 17226
474 nmdc:mga0n895_386381_c1 3300050512 Bacteria 1416
475 nmdc:mga0n895_830702_c1 3300050512 Bacteria 913
476 nmdc:mga0a205_331162_c1 3300050515 Bacteria 1392
477 nmdc:mga0a205_414541_c1 3300050515 Bacteria 1209
478 Ga0495595_0544707 3300053084 Bacteria 592
479 Ga0495619_0128112 3300053085 Bacteria 1743
480 Ga0495619_0500322 3300053085 Bacteria 836
481 Ga0157376_10689991
482 SwRhRL2b_contig_2070193
483 JGI24737J22298_10012645
484 JGI24035J26624_1000141
485 JGI24035J26624_1003257
486 JGI25404J52841_10004829
487 JGI25405J52794_10000412
488 JGI25405J52794_10002813
489 JGI25405J52794_10024888
490 Ga0065714_10094929
491 Ga0065704_10004850
492 Ga0065704_10027173
493 Ga0065704_10073950
494 Ga0065704_10091739
495 Ga0065704_10438568
496 Ga0065712_10001692
497 Ga0065712_10004664
498 Ga0065712_10016478
499 Ga0065712_10019107
500 Ga0065712_10026984
501 Ga0065712_10116148
502 Ga0065712_10180216
503 Ga0065715_10001727
504 Ga0065715_10089933
505 Ga0065715_10119901
506 Ga0065715_10167516
507 Ga0065715_10174334
508 Ga0065715_10340754
509 Ga0065707_10013106
510 Ga0065707_10024750
511 Ga0065707_10118992
512 Ga0070658_10136660
513 Ga0070676_10494148
514 Ga0070683_100041590
515 Ga0070683_100114079
516 Ga0070690_100070824
517 Ga0070666_10223058
518 Ga0070680_100026698
519 Ga0070680_100905527
520 Ga0070660_100319905
521 Ga0070689_100000978
522 Ga0070689_100128485
523 Ga0070687_100068392
524 Ga0070661_100192774
525 Ga0070692_10116733
526 Ga0070668_100031417
527 Ga0070668_100178032
528 Ga0070668_100707515
529 Ga0070669_100327219
530 Ga0070669_101690418
531 Ga0070675_100003712
532 Ga0070675_100009595
533 Ga0070675_100063293
534 Ga0070675_100333325
535 Ga0070675_100574665
536 Ga0070671_100214076
537 Ga0070671_100619828
538 Ga0070674_100337668
539 Ga0070674_100523768
540 Ga0070674_100653919
541 Ga0070673_100003140
542 Ga0070673_100016374
543 Ga0070688_100007537
544 Ga0070688_100076237
545 Ga0070688_100615751
546 Ga0070659_100000971
547 Ga0070667_100281625
548 Ga0070667_100697066
549 Ga0070709_10335287
550 Ga0070714_100022318
551 Ga0070714_100050890
552 Ga0070714_100132998
553 Ga0070714_100754987
554 Ga0070713_100115542
555 Ga0070713_100226852
556 Ga0070713_100508376
557 Ga0070713_100791398
558 Ga0070710_10169400
559 Ga0070710_10290018
560 Ga0070711_100012799
561 Ga0070711_100020670
562 Ga0070711_100114073
563 Ga0070705_100035698
564 Ga0070705_100128756
565 Ga0070705_100146728
566 Ga0070705_100229032
567 Ga0070700_100039609
568 Ga0070694_100024137
569 Ga0070708_100047427
570 Ga0070708_100085529
571 Ga0070708_100090982
572 Ga0070708_100117242
573 Ga0070708_100251169
574 Ga0070708_100549179
575 Ga0070678_100195049
576 Ga0070662_100097269
577 Ga0070662_100131592
578 Ga0070662_100496470
579 Ga0070662_100897270
580 Ga0070681_10047861
581 Ga0070685_10004903
582 Ga0070685_10067747
583 Ga0070706_100018474
584 Ga0070706_100042062
585 Ga0070706_100132337
586 Ga0070706_100306393
587 Ga0070706_100430716
588 Ga0070706_100881451
589 Ga0070707_100039255
590 Ga0070707_100052961
591 Ga0070707_100162077
592 Ga0070707_100230858
593 Ga0070707_101540367
594 Ga0070698_100028712
595 Ga0070698_100234901
596 Ga0070698_100258988
597 Ga0070699_100208581
598 Ga0070699_100242601
599 Ga0070699_100267075
600 Ga0070699_100731637
601 Ga0070679_100043747
602 Ga0070684_100006663
603 Ga0070684_100041434
604 Ga0070684_100099186
605 Ga0070684_100144234
606 Ga0070684_100160218
607 Ga0070684_100399990
608 Ga0070697_100002917
609 Ga0070697_100012443
610 Ga0070697_100018284
611 Ga0070697_100019422
612 Ga0070697_100074750
613 Ga0070697_100383910
614 Ga0070697_100390410
615 Ga0070697_100412577
616 Ga0070697_100457155
617 Ga0070672_100495084
618 Ga0070665_100048215
619 Ga0070665_101206620
620 Ga0070704_100002924
621 Ga0068855_101989899
622 Ga0070664_100523318
623 Ga0070664_100596767
624 Ga0068856_100246292
625 Ga0068864_100578497
626 Ga0068861_100130976
627 Ga0068861_100907316
628 Ga0068863_100003600
629 Ga0068858_100068419
630 Ga0068858_100320271
631 Ga0068860_100037757
632 Ga0081455_10001872
633 Ga0081455_10016809
634 Ga0081455_10016935
635 Ga0081455_10030722
636 Ga0081455_10044602
637 Ga0081455_10049102
638 Ga0081455_10134780
639 Ga0081455_10398506
640 Ga0081540_1000036
641 Ga0081540_1034481
642 Ga0081539_10040243
643 Ga0070717_10093046
644 Ga0070717_10119455
645 Ga0070717_10150132
646 Ga0070717_10443304
647 Ga0070715_10047133
648 Ga0070715_10052209
649 Ga0070716_100016121
650 Ga0070716_100184230
651 Ga0070716_100261807
652 Ga0070712_100103973
653 Ga0070712_100122575
654 Ga0070712_100217983
655 Ga0070712_100289267
656 Ga0070712_100314383
657 Ga0070712_100393349
658 Ga0070712_100462086
659 Ga0070712_100660903
660 Ga0070712_101030841
661 Ga0097621_100195024
662 Ga0097621_101126170
663 Ga0068871_100257457
664 Ga0068871_100363983
665 Ga0075428_100342689
666 Ga0075428_100766644
667 Ga0075433_10434038
668 Ga0075434_100206361
669 Ga0075434_100315267
670 Ga0068865_100307578
671 Ga0099794_10285779
672 Ga0099794_10299269
673 Ga0111539_10818175
674 Ga0111539_11255332
675 Ga0105245_10442326
676 Ga0105245_11141640
677 Ga0105245_11154743
678 Ga0105245_11651040
679 Ga0105247_10138968
680 Ga0105247_10593969
681 Ga0114129_10007418
682 Ga0114129_10244078
683 Ga0114129_10265958
684 Ga0114129_10598948
685 Ga0105243_10127504
686 Ga0105241_10118065
687 Ga0105241_10872656
688 Ga0105241_10893821
689 Ga0105242_10368511
690 Ga0105248_11312752
691 Ga0105249_10021762
692 Ga0105249_10122059
693 Ga0105249_10625246
694 Ga0099796_10029945
695 Ga0105239_10155992
696 Ga0105239_10217548
697 Ga0105239_10505219
698 Ga0105239_11481934
699 Ga0105246_10408075
700 Ga0157371_10227161
701 Ga0157369_10607696
702 Ga0157374_10111000
703 Ga0157374_10383692
704 Ga0157374_10484372
705 Ga0157374_10688677
706 Ga0157374_11863618
707 Ga0157378_10013099
708 Ga0157378_10023174
709 Ga0157378_10033296
710 Ga0157378_10366754
711 Ga0157378_10738567
712 Ga0157378_12411931
713 Ga0157378_12419876
714 Ga0163162_10224840
715 Ga0163162_10351894
716 Ga0163162_10444203
717 Ga0163162_10498761
718 Ga0163162_10718145
719 Ga0157372_10492839
720 Ga0157375_10115628
721 Ga0157375_10220135
722 Ga0157375_10488812
723 Ga0157375_10536949
724 Ga0157375_11879119
725 Ga0163163_10119296
726 Ga0163163_10441232
727 Ga0163163_10550772
728 Ga0163163_10716924
729 Ga0182008_10064976
730 Ga0157377_10048614
731 Ga0157377_10603953
732 Ga0157379_10100892
733 Ga0157379_11452792
734 Ga0157376_10094594
735 Ga0157376_10135143
736 Ga0157376_10454591
737 Ga0182006_1020264
738 Ga0163161_10203079
739 Ga0206355_1145327
740 Ga0207666_1001627
741 Ga0207697_10001294
742 Ga0207697_10001403
743 Ga0207697_10012438
744 Ga0207697_10025316
745 Ga0207697_10034103
746 Ga0207697_10093717
747 Ga0207692_10606353
748 Ga0207680_10257224
749 Ga0207647_10004861
750 Ga0207685_10022911
751 Ga0207685_10199033
752 Ga0207699_10119319
753 Ga0207699_10367150
754 Ga0207699_10670631
755 Ga0207645_10293934
756 Ga0207705_10348965
757 Ga0207684_10024895
758 Ga0207684_10104691
759 Ga0207684_10107589
760 Ga0207684_10149719
761 Ga0207684_10682131
762 Ga0207684_10839176
763 Ga0207654_10538338
764 Ga0207693_10035674
765 Ga0207693_10063349
766 Ga0207693_10084225
767 Ga0207693_10100253
768 Ga0207693_10515591
769 Ga0207663_10055206
770 Ga0207663_10077235
771 Ga0207663_10177341
772 Ga0207663_10237294
773 Ga0207663_10362952
774 Ga0207660_10022146
775 Ga0207662_10047832
776 Ga0207657_10100597
777 Ga0207649_10113401
778 Ga0207652_10068891
779 Ga0207652_10805224
780 Ga0207646_10076725
781 Ga0207646_10113228
782 Ga0207646_10384124
783 Ga0207646_11420269
784 Ga0207681_10624154
785 Ga0207659_10003753
786 Ga0207659_10028169
787 Ga0207659_10633215
788 Ga0207687_11049905
789 Ga0207700_10039447
790 Ga0207700_10290012
791 Ga0207700_10412209
792 Ga0207700_11080412
793 Ga0207664_10085388
794 Ga0207664_10121339
795 Ga0207644_10213289
796 Ga0207644_10475179
797 Ga0207690_10001481
798 Ga0207690_10905866
799 Ga0207706_10162413
800 Ga0207706_10993595
801 Ga0207686_10213234
802 Ga0207709_10305429
803 Ga0207670_10003100
804 Ga0207670_10097423
805 Ga0207665_10026896
806 Ga0207665_10318360
807 Ga0207691_10100551
808 Ga0207711_10496751
809 Ga0207679_10325844
810 Ga0207679_10525205
811 Ga0207651_10714929
812 Ga0207712_10092201
813 Ga0207712_10163457
814 Ga0207668_10056103
815 Ga0207668_10527304
816 Ga0207668_11010348
817 Ga0207658_10067376
818 Ga0207658_10490577
819 Ga0207677_10475463
820 Ga0207703_10009368
821 Ga0207703_10200678
822 Ga0207678_10001585
823 Ga0207708_10038619
824 Ga0207702_10128811
825 Ga0207641_10012427
826 Ga0207641_10084465
827 Ga0207676_10592417
828 Ga0207676_10633153
829 Ga0207675_100154766
830 Ga0207675_101637184
831 Ga0207683_10221189
832 Ga0207698_11867719
833 Ga0209981_1018057
834 Ga0209984_1015919
835 Ga0209179_1020935
836 Ga0209588_1190886
837 Ga0209974_10009094
838 Ga0268266_10053400
839 Ga0268266_10073310
840 Ga0268266_10669901
841 Ga0268264_10016515
842 Ga0373944_0197817
843 Ga0373936_0113169
844 Ga0373939_0297324
845 Ga0373943_0080974
846 Ga0373943_0156850
847 Ga0373946_0040914
848 Ga0373946_0563645
849 Ga0373955_0055517
850 Ga0373924_0131268
851 Ga0373931_0015102
852 Ga0373935_0018819
853 Ga0373935_0173486
854 Ga0373935_0262282
855 Ga0373927_0071472
856 Ga0373927_0076041
857 Ga0373933_0082536
858 Ga0373947_0028673
859 Ga0373947_0500425
860 Ga0373947_0665902
861 Ga0373937_0280144
862 Ga0373937_0975960
863 Ga0373925_0010936
864 Ga0373925_0429049
865 Ga0373925_0525067
866 Ga0373925_0590631
867 Ga0395899_0202269
868 Ga0395900_0090143
869 Ga0395900_0537342
870 Ga0395898_0032973
871 Ga0395905_0346200
872 Ga0395905_0390710
873 Ga0395905_0626917
874 Ga0395905_1757195
875 Ga0395901_0001548
876 Ga0395901_0089180
877 Ga0395901_0378666
878 Ga0395901_0842928
879 Ga0451835_0663666
880 Ga0451853_0577735
881 Ga0439448_0018515
882 Ga0439455_0000520
883 Ga0439458_0014766
884 Ga0439464_0017248
885 Ga0495603_0356439
886 Ga0495651_0538991
887 Ga0495664_0119843
888 Ga0495594_0328732
889 Ga0495608_0241548
890 Ga0495630_0142315
891 Ga0495630_0415061
892 Ga0495666_0085500
893 Ga0495652_0388810
894 Ga0495665_0280518
895 Ga0495640_0272038
896 Ga0495640_0589443
897 Ga0495586_0166149
898 Ga0495587_0165475
899 Ga0495587_0348335
900 Ga0495645_0006709
901 Ga0495634_0029418
902 Ga0495634_0143867
903 Ga0495657_0193567
904 Ga0495599_0002744
905 Ga0495623_0042456
906 Ga0495646_0036436
907 Ga0495647_0076865
908 Ga0495658_0308605
909 Ga0495669_0074203
910 Ga0495600_0227156
911 Ga0495604_0414233
912 Ga0495674_0278005
913 Ga0495684_0010873
914 Ga0495602_0571903
915 Ga0495614_0310439
916 Ga0496101_0124446
917 Ga0496101_0254864
918 Ga0496102_0097697
919 Ga0496102_0159621
920 Ga0496102_0449645
921 Ga0496104_0065707
922 Ga0496104_0729065
923 Ga0496104_0734994
924 Ga0496104_1371686
925 Ga0496105_0087870
926 Ga0496105_0142286
927 Ga0496106_0298970
928 Ga0496106_1031804
929 Ga0496107_0158825
930 Ga0496107_0529096
931 Ga0496109_0005026
932 Ga0496109_0829889
933 Ga0496110_0173027
934 Ga0496110_0697704
935 Ga0496111_0216760
936 Ga0496111_0251184
937 Ga0496111_0340997
938 Ga0496112_0034027
939 Ga0496112_0096332
940 Ga0496112_0743742
941 Ga0496113_0044056
942 Ga0496113_0152026
943 Ga0496114_0018012
944 Ga0496114_0089371
945 Ga0496115_0098738
946 Ga0496115_0208927
947 Ga0496115_0224807
948 Ga0496115_0435005
949 Ga0496115_1144098
950 Ga0501067_0705979
951 Ga0501069_0784859
952 nmdc:mga05p37_1054801_c1
953 nmdc:mga05p37_4003_c1
954 nmdc:mga0n895_386381_c1
955 nmdc:mga0n895_830702_c1
956 nmdc:mga0a205_331162_c1
957 nmdc:mga0a205_414541_c1
958 Ga0495595_0544707
959 Ga0495619_0128112
960 Ga0495619_0500322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map