F452139

General Info

Members Datasets Scaffolds Average Seq Length
479 421 958 281

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2937877337|2937877446
Length 297
Sequence RKTAPWPRRSSPSIDMLQNAKIVMDAVRAADHDRYLTALYAPADKRDALFSLYAFNAEIAGIRDRIHEPLPGEVRLQWWRDVIAAGGEAGAGHPVADALNLTITAFKLPKLAFENMLEARIFDLYDDPMPSRTDLEGYCGETAAALIQLAAMVLDPADAPGFAELAGRAGCAQAITGLLLLLPLHRRRGQCFIPADILAAAGSSPEEFVAGDGGPGARRAVAAMIALAREHLSAFEQGAAALPGSLRSAFLPLALSRAYLAKMEGSRHSPLGGVARLSALRRHWLLLRRAGKGWPAL

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
140 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
141 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
146 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
149 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
150 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
151 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
152 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
153 2509276019 Ensifer aridi TW10 Isolate Nodule
154 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
155 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
156 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
157 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
158 2512875024
159 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
160 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
161 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
162 2534681786 Brucella suis 92/29 Isolate Unclassified
163 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
164 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
165 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
166 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
167 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
168 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
169 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
170 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
171 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
172 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
173 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
174 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
175 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
176 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
177 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
178 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
179 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
180 2751185800 Brucella pituitosa AA2 Isolate Unclassified
181 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
182 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
183 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
184 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
185 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
186 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
187 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
188 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
189 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
190 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
191 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
192 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
193 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
194 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
195 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
196 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
197 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
198 2854911287 Brucella lupini LUP21 Isolate Unclassified
199 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
200 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
201 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
202 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
203 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
204 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
205 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
206 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
207 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
208 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
209 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
210 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
211 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
212 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
213 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
214 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
215 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
216 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
217 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
218 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
219 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
220 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
221 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
222 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
223 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
224 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
225 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
226 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
227 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
228 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
229 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
230 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
231 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
232 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
233 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
234 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
235 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
236 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
237 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
238 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
239 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
240 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
241 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
242 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
243 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
244 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
245 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
246 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
247 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
248 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
249 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
250 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
251 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
252 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
253 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
254 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
255 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
256 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
257 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
258 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
259 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
260 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
261 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
262 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
263 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
264 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
265 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
266 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
267 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
268 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
269 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
270 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
271 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
272 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
273 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
274 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
275 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
276 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
277 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
278 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
279 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
280 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
281 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
282 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
283 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
284 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
285 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
286 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
287 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
288 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
289 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
290 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
291 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
292 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
293 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
294 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
295 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
296 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
297 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
298 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
299 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
300 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
301 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
302 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
303 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
304 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
305 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
306 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
307 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
308 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
309 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
310 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
311 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
312 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
313 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
314 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
315 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
316 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
317 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
318 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
319 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
320 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
321 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
322 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
323 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
324 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
325 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
326 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
327 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
328 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
329 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
330 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
331 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
332 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
333 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
334 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
335 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
336 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
337 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
338 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
339 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
340 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
341 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
342 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
343 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
344 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
345 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
346 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
347 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
348 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
349 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
350 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
351 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
352 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
353 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
354 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
355 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
356 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
357 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
358 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
359 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
360 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
361 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
362 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
363 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
364 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
365 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
366 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
367 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
368 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
369 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
370 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
371 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
372 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
373 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
374 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
375 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
376 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
377 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
378 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
379 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
380 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
381 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
382 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
383 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
384 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
385 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
386 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
387 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
388 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
389 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
390 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
391 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
392 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
393 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
394 3004167301 Mesorhizobium loti 582 Isolate Unclassified
395 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
396 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
397 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
398 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
399 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
400 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
401 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
402 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
403 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
404 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
405 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
406 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
407 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
408 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
409 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
410 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
411 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
412 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
413 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
414 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
415 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
416 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
417 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
418 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
419 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
420 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
421 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.38
Metatranscriptomes 0
Isolates 57.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.47
Nodule 46.35
Rhizoplane 3.76
Rhizosphere 32.15
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000062 3300003214 Bacteria 206459
2 Ga0055542_1000788 3300003762 Bacteria 23675
3 Ga0070689_100009570 3300005340 Bacteria 6875
4 Ga0070689_100082001 3300005340 Bacteria 2532
5 Ga0070687_100322308 3300005343 Bacteria 988
6 Ga0070671_100067317 3300005355 Bacteria 2986
7 Ga0070674_100016724 3300005356 Bacteria 4601
8 Ga0070673_100318178 3300005364 Bacteria 1374
9 Ga0070700_100035496 3300005441 Bacteria 3018
10 Ga0070678_100089352 3300005456 Bacteria 2358
11 Ga0070662_100024750 3300005457 Bacteria 4140
12 Ga0070681_10226083 3300005458 Bacteria 1786
13 Ga0070685_10179686 3300005466 Bacteria 1361
14 Ga0068853_100057718 3300005539 Bacteria 3350
15 Ga0070665_100186534 3300005548 Bacteria 2075
16 Ga0070665_100746691 3300005548 Bacteria 992
17 Ga0068855_100067195 3300005563 Bacteria 4177
18 Ga0068855_100167388 3300005563 Bacteria 2491
19 Ga0070702_100266491 3300005615 Bacteria 1169
20 Ga0068859_100189743 3300005617 Bacteria 2139
21 Ga0068864_100323466 3300005618 Bacteria 1449
22 Ga0068866_10071123 3300005718 Bacteria 1839
23 Ga0070717_10301285 3300006028 Bacteria 1425
24 Ga0075365_10051415 3300006038 Bacteria 2721
25 Ga0075368_10091823 3300006042 Bacteria 1242
26 Ga0075362_10136591 3300006177 Bacteria 1169
27 Ga0075367_10058050 3300006178 Bacteria 2302
28 Ga0075367_10070691 3300006178 Bacteria 2098
29 Ga0075367_10114208 3300006178 Bacteria 1660
30 Ga0075369_10051019 3300006186 Bacteria 1790
31 Ga0097620_100189750 3300006931 Bacteria 2139
32 Ga0105240_10236094 3300009093 Bacteria 2122
33 Ga0105240_10378230 3300009093 Bacteria 1600
34 Ga0105245_10131484 3300009098 Bacteria 2348
35 Ga0105243_10636263 3300009148 Bacteria 1032
36 Ga0105248_10024745 3300009177 Bacteria 6677
37 Ga0105237_10279372 3300009545 Bacteria 1672
38 Ga0105238_10004699 3300009551 Bacteria 13508
39 Ga0105238_10123786 3300009551 Bacteria 2565
40 Ga0105238_10241519 3300009551 Bacteria 1784
41 Ga0105238_10393246 3300009551 Bacteria 1379
42 Ga0105239_10158133 3300010375 Bacteria 2531
43 Ga0105239_10450893 3300010375 Bacteria 1459
44 Ga0157370_10071615 3300013104 Bacteria 3271
45 Ga0157369_10230019 3300013105 Bacteria 1939
46 Ga0163162_10437490 3300013306 Bacteria 1440
47 Ga0157375_10329689 3300013308 Bacteria 1691
48 Ga0157380_10061542 3300014326 Bacteria 3004
49 Ga0182008_10117234 3300014497 Bacteria 1322
50 Ga0157379_10519048 3300014968 Bacteria 1106
51 Ga0157379_10672397 3300014968 Bacteria 970
52 Ga0209026_1000024 3300025250 Bacteria 355839
53 Ga0209148_1000050 3300025254 Bacteria 413178
54 Ga0209759_1000389 3300025256 Bacteria 54772
55 Ga0209233_1000129 3300025261 Bacteria 206511
56 Ga0209233_1004020 3300025261 Bacteria 5095
57 Ga0209455_1000183 3300025272 Bacteria 99952
58 Ga0207647_10069955 3300025904 Bacteria 2121
59 Ga0207705_10287864 3300025909 Bacteria 1258
60 Ga0207707_10151322 3300025912 Bacteria 2028
61 Ga0207662_10257707 3300025918 Bacteria 1147
62 Ga0207694_10016895 3300025924 Bacteria 5512
63 Ga0207694_10022832 3300025924 Bacteria 4745
64 Ga0207694_10385111 3300025924 Bacteria 1164
65 Ga0207706_10009280 3300025933 Bacteria 9033
66 Ga0207709_10033611 3300025935 Bacteria 3013
67 Ga0207670_10005797 3300025936 Bacteria 6817
68 Ga0207704_10351868 3300025938 Bacteria 1147
69 Ga0207711_10041322 3300025941 Bacteria 3926
70 Ga0207689_10163165 3300025942 Bacteria 1836
71 Ga0207667_10176308 3300025949 Bacteria 2196
72 Ga0207651_10219151 3300025960 Bacteria 1537
73 Ga0207639_10047559 3300026041 Bacteria 3243
74 Ga0207708_10089578 3300026075 Bacteria 2371
75 Ga0207702_10092013 3300026078 Bacteria 2657
76 Ga0207648_10130533 3300026089 Bacteria 2212
77 Ga0207648_10318656 3300026089 Bacteria 1397
78 Ga0207675_100346114 3300026118 Bacteria 1456
79 Ga0207683_10119905 3300026121 Bacteria 2361
80 Ga0209813_10078629 3300027866 Bacteria 1086
81 Ga0268266_10085130 3300028379 Bacteria 2762
82 Ga0268266_10111466 3300028379 Bacteria 2424
83 Ga0268266_10356799 3300028379 Bacteria 1375
84 Ga0268266_10488124 3300028379 Bacteria 1175
85 Ga0268265_10257336 3300028380 Bacteria 1550
86 Ga0307515_10000274 3300028794 Bacteria 126011
87 Ga0307515_10202505 3300028794 Bacteria 1856
88 Ga0265325_10046517 3300031241 Bacteria 2250
89 Ga0307513_10032122 3300031456 Bacteria 5925
90 Ga0307409_100300095 3300031995 Bacteria 1494
91 Ga0307416_100375402 3300032002 Bacteria 1450
92 Ga0373931_0007786 3300035691 Bacteria 5061
93 Ga0373931_0019772 3300035691 Bacteria 3364
94 Ga0373935_0108335 3300035692 Bacteria 1841
95 Ga0373947_0123766 3300035725 Bacteria 1645
96 Ga0373925_0200113 3300037068 Bacteria 1588
97 Ga0395899_0000440 3300037312 Bacteria 47632
98 Ga0395899_0226936 3300037312 Bacteria 1291
99 Ga0395900_0000509 3300037418 Bacteria 54852
100 Ga0395900_0368600 3300037418 Bacteria 1406
101 Ga0395900_0700499 3300037418 Bacteria 946
102 Ga0395898_0000908 3300037466 Bacteria 47632
103 Ga0395898_0402613 3300037466 Bacteria 1305
104 Ga0395898_0412223 3300037466 Bacteria 1288
105 Ga0395905_0000623 3300037471 Bacteria 47316
106 Ga0395905_0019540 3300037471 Bacteria 6421
107 Ga0395905_0338984 3300037471 Bacteria 1394
108 Ga0395901_0000142 3300038443 Bacteria 92246
109 Ga0395901_0010455 3300038443 Bacteria 9401
110 Ga0395901_0029333 3300038443 Bacteria 5664
111 Ga0395901_0173233 3300038443 Bacteria 2264
112 Ga0439465_0016506 3300041413 Bacteria 2303
113 Ga0495638_0085675 3300046460 Bacteria 1905
114 Ga0495606_0016516 3300046507 Bacteria 5622
115 Ga0495628_0179898 3300046516 Bacteria 1600
116 Ga0495656_0138151 3300046615 Bacteria 1166
117 Ga0495625_0030407 3300046660 Bacteria 4030
118 Ga0495660_0139488 3300046810 Bacteria 1208
119 Ga0495672_0034295 3300047320 Bacteria 3137
120 Ga0495687_058775 3300047443 Bacteria 1594
121 Ga0495626_0101290 3300048091 Bacteria 1255
122 Ga0496100_0018738 3300048903 Bacteria 4113
123 Ga0496100_0049630 3300048903 Bacteria 2715
124 Ga0496101_0029783 3300048904 Bacteria 3819
125 Ga0496104_0541080 3300048907 Bacteria 1075
126 Ga0496105_0195957 3300048908 Bacteria 1650
127 Ga0496106_0087882 3300048909 Bacteria 2395
128 Ga0496110_0011785 3300048913 Bacteria 7176
129 Ga0496110_0642230 3300048913 Bacteria 961
130 Ga0496112_0009161 3300048915 Bacteria 8893
131 Ga0496112_0065837 3300048915 Bacteria 3576
132 Ga0496112_0107533 3300048915 Bacteria 2759
133 Ga0496113_0166758 3300048916 Bacteria 1743
134 Ga0496114_0016233 3300048917 Bacteria 5996
135 Ga0496115_0029516 3300048918 Bacteria 4307
136 Ga0496115_0228573 3300048918 Bacteria 1534
137 Ga0496119_0003703 3300048922 Bacteria 15651
138 Ga0496119_0018250 3300048922 Bacteria 5237
139 Ga0496120_0001063 3300048923 Bacteria 36272
140 Ga0496120_0039297 3300048923 Bacteria 2793
141 Ga0496120_0081047 3300048923 Bacteria 1757
142 Ga0496121_0248761 3300048924 Bacteria 1234
143 Ga0496123_0024948 3300048926 Bacteria 4524
144 Ga0496125_0071313 3300048928 Bacteria 2715
145 Ga0501031_0019696 3300049568 Bacteria 4396
146 Ga0501032_0012779 3300049569 Bacteria 5986
147 Ga0501032_0016910 3300049569 Bacteria 5126
148 Ga0501033_0023823 3300049570 Bacteria 4617
149 Ga0501033_0039733 3300049570 Bacteria 3514
150 Ga0501033_0100016 3300049570 Bacteria 2117
151 Ga0501034_0034090 3300049571 Bacteria 5161
152 Ga0501034_0035127 3300049571 Bacteria 5083
153 Ga0501034_0133903 3300049571 Bacteria 2460
154 Ga0501034_0425539 3300049571 Bacteria 1248
155 Ga0501036_0007359 3300049572 Bacteria 8970
156 Ga0501036_0034965 3300049572 Bacteria 4250
157 Ga0501037_0037358 3300049573 Bacteria 3580
158 Ga0501038_0026903 3300049574 Bacteria 5121
159 Ga0501038_0043350 3300049574 Bacteria 3912
160 Ga0501039_0005967 3300049575 Bacteria 9230
161 Ga0501039_0046745 3300049575 Bacteria 3344
162 Ga0501042_0015629 3300049578 Bacteria 5199
163 Ga0501043_0023393 3300049579 Bacteria 4846
164 Ga0501043_0048480 3300049579 Bacteria 3339
165 Ga0501047_0013300 3300049581 Bacteria 7795
166 Ga0501047_0029965 3300049581 Bacteria 5245
167 Ga0501048_0031827 3300049582 Bacteria 3814
168 Ga0501067_0078199 3300049583 Bacteria 1833
169 Ga0501068_0007841 3300049584 Bacteria 5916
170 Ga0501069_0001708 3300049585 Bacteria 10925
171 Ga0501070_0056905 3300049586 Bacteria 3241
172 Ga0501070_0089061 3300049586 Bacteria 2554
173 Ga0501071_0001716 3300049587 Bacteria 12859
174 Ga0501073_0002722 3300049589 Bacteria 13246
175 Ga0501073_0031568 3300049589 Bacteria 3779
176 Ga0501073_0127449 3300049589 Bacteria 1764
177 Ga0501074_0020597 3300049590 Bacteria 4793
178 Ga0501079_0026468 3300049741 Bacteria 4447
179 Ga0501080_0002122 3300049742 Bacteria 17217
180 Ga0501035_0029509 3300049822 Bacteria 5001
181 Ga0501044_0004701 3300049823 Bacteria 15268
182 Ga0501044_0035985 3300049823 Bacteria 5181
183 Ga0501045_0064776 3300049824 Bacteria 2683
184 nmdc:mga00v17_136012_c1 3300050491 Bacteria 1573
185 nmdc:mga0yw44_178761_c1 3300050492 Bacteria 1396
186 nmdc:mga0yw44_19883_c1 3300050492 Bacteria 3713
187 nmdc:mga06z11_321115_c1 3300050494 Bacteria 924
188 nmdc:mga06z11_35927_c1 3300050494 Bacteria 2442
189 nmdc:mga04h51_108243_c1 3300050495 Bacteria 1021
190 nmdc:mga0sz30_5372_c1 3300050516 Bacteria 4694
191 Ga0500610_0085427 3300053079 Bacteria 1643
192 Ga0495595_0050878 3300053084 Bacteria 1920
193 Ga0495619_0439637 3300053085 Unclassified 899
194 Ga0500572_036362 3300053111 Bacteria 1405
195 Ga0500618_027480 3300053125 Bacteria 1353
196 Ga0500655_014921 3300053133 Bacteria 1423
197 Ga0500658_0124542 3300053134 Bacteria 1145
198 Ga0500568_0000144 3300053139 Bacteria 62519
199 Ga0500616_0000045 3300053153 Bacteria 339292
200 Ga0500616_0061047 3300053153 Bacteria 1953
201 Ga0500620_033830 3300053155 Bacteria 1637
202 Ga0500627_0068906 3300053158 Bacteria 1564
203 Ga0501082_0016463 3300060353 Bacteria 6363
204 2937877446 2937877337 Bacteria 7246526
205 2503202037 2503198000 Bacteria 6884444
206 2509115590 2508501123 Bacteria 6283661
207 2509141764 2508501127 Bacteria 7037543
208 2509371208 2509276018 Bacteria 6910194
209 2509376181 2509276019 Bacteria 6802256
210 2509396699 2509276022 Bacteria 6200534
211 2510313865 2510065059 Bacteria 6847884
212 2511388701 2511231027 Bacteria 5013807
213 2512931075 2512875016 Bacteria 6529530
214 2512958793 2512875024 Bacteria 7195110
215 2513610966 2513237090 Bacteria 7096802
216 2514037650 2513237164 Bacteria 7563725
217 2514420281 2513237305 Bacteria 7293571
218 2535484626 2534681786 Bacteria 3308809
219 2551695406 2551306086 Bacteria 6843938
220 2551698318 2551306087 Bacteria 7351905
221 2551710773 2551306089 Bacteria 7162724
222 2551723626 2551306090 Bacteria 7953713
223 2551737719 2551306092 Bacteria 6992595
224 2551745348 2551306093 Bacteria 7064773
225 2588516833 2588253730 Bacteria 6881675
226 2597814251 2597489875 Bacteria 7010078
227 2599938318 2599185301 Bacteria 6161860
228 2643772789 2643221550 Bacteria 4619371
229 2643837849 2643221564 Bacteria 4193379
230 2643989221 2643221595 Bacteria 6565519
231 2644152793 2643221627 Bacteria 6761570
232 2688598851 2687453392 Bacteria 6880454
233 2694629809 2693429783 Bacteria 7019804
234 2694636318 2693429784 Bacteria 7241525
235 2723575796 2721755686 Bacteria 7343952
236 2753359207 2751185800 Bacteria 5467370
237 2756675736 2756170246 Bacteria 7451806
238 2757570829 2757320392 Bacteria 3737298
239 2758641452 2758568016 Bacteria 5645291
240 2765465082 2765235802 Bacteria 5618596
241 2770198246 2767802442 Bacteria 5747986
242 2776271186 2775506902 Bacteria 6208009
243 2776280817 2775506904 Bacteria 5954060
244 2792749743 2791355123 Bacteria 8049106
245 2839995016 2839993093 Bacteria 5512535
246 2840767905 2840764183 Bacteria 6358399
247 2841739708 2841734538 Bacteria 6784580
248 2842872421 2842871566 Bacteria 4827117
249 2844006244 2844002411 Bacteria 7168230
250 2844014192 2844009547 Bacteria 6728125
251 2847675975 2847670302 Bacteria 6165597
252 2847692628 2847686936 Bacteria 6278406
253 2854901948 2854896431 Bacteria 5869725
254 2854911822 2854911287 Bacteria 5582813
255 2854916860 2854916844 Bacteria 5725939
256 2856314467 2856314179 Bacteria 6477897
257 2856325665 2856320880 Bacteria 7263508
258 2856331542 2856328259 Bacteria 6528202
259 2856348705 2856342000 Bacteria 7176905
260 2856355474 2856349417 Bacteria 6230045
261 2856370546 2856364286 Bacteria 6939991
262 2857350631 2857349434 Bacteria 7926032
263 2869168669 2869162929 Bacteria 6399702
264 2869176651 2869169390 Bacteria 6659796
265 2869239308 2869234852 Bacteria 6654993
266 2869249031 2869242130 Bacteria 6609239
267 2869263548 2869256925 Bacteria 6981691
268 2869267769 2869264136 Bacteria 6880765
269 2869276868 2869271264 Bacteria 6908218
270 2869279287 2869278585 Bacteria 7077053
271 2869291727 2869285874 Bacteria 6901219
272 2871434937 2871429161 Bacteria 6547891
273 2871440613 2871435913 Bacteria 6880295
274 2871454018 2871451962 Bacteria 7336357
275 2871462107 2871459585 Bacteria 6866887
276 2871467907 2871466892 Bacteria 6923287
277 2871480303 2871474448 Bacteria 6806570
278 2871484079 2871481445 Bacteria 6700002
279 2871495581 2871488783 Bacteria 6929816
280 2871502837 2871495908 Bacteria 6935695
281 2874103311 2874102143 Bacteria 6342645
282 2874112220 2874109183 Bacteria 6517025
283 2874117304 2874116593 Bacteria 6674494
284 2874130815 2874123672 Bacteria 7238285
285 2874145034 2874139085 Bacteria 7021506
286 2874149327 2874146452 Bacteria 7533118
287 2874157590 2874155637 Bacteria 6724144
288 2874166289 2874162495 Bacteria 6174670
289 2874174367 2874168670 Bacteria 8062617
290 2876365669 2876363079 Bacteria 6544991
291 2876374818 2876369609 Bacteria 6807521
292 2876390604 2876386047 Bacteria 6698674
293 2876394633 2876392853 Bacteria 6660880
294 2876400013 2876399893 Bacteria 6927900
295 2876415793 2876413966 Bacteria 6831344
296 2876425251 2876420981 Bacteria 6687741
297 2878040046 2878035449 Bacteria 6555736
298 2878737215 2878730984 Bacteria 6380721
299 2878745671 2878738818 Bacteria 7136951
300 2878752071 2878745973 Bacteria 6867388
301 2878757824 2878753008 Bacteria 6922523
302 2878766729 2878760144 Bacteria 6823465
303 2878773926 2878767105 Bacteria 6898628
304 2878777300 2878774303 Bacteria 6108671
305 2878788558 2878781027 Bacteria 6834456
306 2881151982 2881147464 Bacteria 7779814
307 2881155708 2881155292 Bacteria 6461656
308 2881167927 2881161766 Bacteria 7127907
309 2881848154 2881845957 Bacteria 6611900
310 2881858668 2881853255 Bacteria 6698367
311 2881867994 2881861095 Bacteria 7128710
312 2882637031 2882632389 Bacteria 8154593
313 2882913964 2882912400 Bacteria 6801539
314 2885309848 2885305155 Bacteria 7348390
315 2885316928 2885312484 Bacteria 6415165
316 2885320376 2885318864 Bacteria 6729568
317 2885332120 2885326080 Bacteria 7134805
318 2885346873 2885342637 Bacteria 7011821
319 2885351919 2885350715 Bacteria 6787678
320 2888339853 2888337043 Bacteria 6629336
321 2888347278 2888343758 Bacteria 6611049
322 2888356196 2888350351 Bacteria 7372807
323 2889017150 2889016732 Bacteria 6700763
324 2894656461 2894652903 Bacteria 4587256
325 2894819872 2894817345 Bacteria 4892941
326 2903455456 2903448605 Bacteria 7357801
327 2903493371 2903492973 Bacteria 13473544
328 2903506541 2903492973 Bacteria 13473544
329 2903523598 2903521522 Bacteria 6525694
330 2903534232 2903528002 Bacteria 6586099
331 2903547976 2903540706 Bacteria 7062119
332 2904581065 2904578770 Bacteria 5302906
333 2904661267 2904659560 Bacteria 6685615
334 2906314465 2906308376 Bacteria 6841989
335 2906327633 2906321335 Bacteria 6579571
336 2906329621 2906328253 Bacteria 6585166
337 2906364243 2906363423 Bacteria 6856682
338 2906375236 2906370794 Bacteria 6881062
339 2906399607 2906393657 Bacteria 6790866
340 2906406592 2906401398 Bacteria 6693206
341 2906408268 2906408224 Bacteria 6162342
342 2906414421 2906414383 Bacteria 6580790
343 2915651722 2915650412 Bacteria 4288180
344 2919121142 2919119836 Bacteria 5208557
345 2922154971 2922151315 Bacteria 6902399
346 2922160207 2922158528 Bacteria 6573167
347 2922176013 2922172374 Bacteria 6167644
348 2922193602 2922185730 Bacteria 7113964
349 2924726287 2924718760 Bacteria 6331356
350 2924731738 2924726620 Bacteria 6271473
351 2924739303 2924733363 Bacteria 7574837
352 2924744665 2924741084 Bacteria 6661321
353 2924751266 2924748358 Bacteria 6154725
354 2924761130 2924754689 Bacteria 6774424
355 2924766837 2924762789 Bacteria 6561353
356 2924783916 2924776078 Bacteria 7492003
357 2924785681 2924784321 Bacteria 7416538
358 2928523487 2928521798 Bacteria 4960112
359 2937816232 2937813078 Bacteria 7783518
360 2937824913 2937822353 Bacteria 7290551
361 2937837976 2937836603 Bacteria 6811263
362 2937855059 2937848649 Bacteria 6983481
363 2937866876 2937861824 Bacteria 6660327
364 2937894773 2937891427 Bacteria 6357007
365 2937975448 2937972304 Bacteria 7532020
366 2938001853 2937994558 Bacteria 7036190
367 2938020174 2938014810 Bacteria 6700592
368 2954015768 2954011201 Bacteria 4762601
369 2958035428 2958034702 Bacteria 6989922
370 2958043615 2958041894 Bacteria 13082850
371 2958054054 2958041894 Bacteria 13082850
372 2958067834 2958064165 Bacteria 7158582
373 2958072650 2958071322 Bacteria 6815895
374 2958084552 2958084443 Bacteria 7312792
375 2958110655 2958108152 Bacteria 6681128
376 2958118822 2958115193 Bacteria 6923548
377 2958124913 2958122699 Bacteria 7280457
378 2958136125 2958130278 Bacteria 6897202
379 2958148610 2958144490 Bacteria 6677056
380 2958171908 2958165035 Bacteria 6906348
381 2958185593 2958179912 Bacteria 6874908
382 2961083970 2961077736 Bacteria 7079850
383 2961116419 2961114664 Bacteria 6680456
384 2961134117 2961127735 Bacteria 7196641
385 2961139935 2961136820 Bacteria 6775228
386 2961170354 2961163497 Bacteria 6901077
387 2961174367 2961170736 Bacteria 7072258
388 2961186599 2961183825 Bacteria 6688536
389 2963648144 2963644680 Bacteria 6530403
390 2964720792 2964719344 Bacteria 7286602
391 2965025100 2965018300 Bacteria 6883036
392 2965026602 2965025482 Bacteria 6532201
393 2965037987 2965032056 Bacteria 6887443
394 2965043873 2965040258 Bacteria 6855979
395 2965053010 2965047637 Bacteria 6623551
396 2965063336 2965062239 Bacteria 7412989
397 2965103499 2965102966 Bacteria 6800987
398 2965122485 2965119406 Bacteria 6956431
399 2968000357 2967996073 Bacteria 6787468
400 2968003758 2968003550 Bacteria 6929263
401 2968018025 2968016561 Bacteria 7022047
402 2968090966 2968083720 Bacteria 7351627
403 2968096638 2968091066 Bacteria 6052692
404 2968100000 2968097103 Bacteria 6107094
405 2968112325 2968110612 Bacteria 6814636
406 2968121125 2968117919 Bacteria 6536078
407 2968132690 2968128360 Bacteria 6270294
408 2968143389 2968138860 Bacteria 6605449
409 2968178741 2968171901 Bacteria 6894245
410 2970471800 2970469710 Bacteria 6969209
411 2970495753 2970489779 Bacteria 6517260
412 2970506954 2970503327 Bacteria 7099517
413 2970512879 2970510686 Bacteria 7006402
414 2970530764 2970524798 Bacteria 6840927
415 2970539936 2970532167 Bacteria 6553173
416 2970541944 2970540015 Bacteria 6977556
417 2970548232 2970547951 Bacteria 6931819
418 2970561586 2970554993 Bacteria 6814252
419 2970593883 2970593180 Bacteria 7073582
420 2970627061 2970619444 Bacteria 6986144
421 2970632565 2970627176 Bacteria 6680862
422 2977822356 2977821940 Bacteria 6906439
423 2977832121 2977828996 Bacteria 7007971
424 2977846468 2977843712 Bacteria 6753583
425 2977856921 2977851361 Bacteria 6694324
426 2977860551 2977858184 Bacteria 6215359
427 2977865863 2977864932 Bacteria 7534097
428 2977900908 2977898635 Bacteria 6675551
429 2977912317 2977907340 Bacteria 6577984
430 2977916383 2977915119 Bacteria 6829656
431 2977929272 2977922695 Bacteria 6956781
432 2977940745 2977935797 Bacteria 6252826
433 2977947664 2977942078 Bacteria 7570577
434 2977952335 2977950692 Bacteria 6893264
435 2977975268 2977971508 Bacteria 7472917
436 2977992347 2977986579 Bacteria 6581278
437 2979713700 2979710463 Bacteria 6785254
438 2979780909 2979779861 Bacteria 6219781
439 2979796102 2979793036 Bacteria 6808957
440 2979812149 2979808191 Bacteria 7179355
441 2987637815 2987636660 Bacteria 8088555
442 2987657444 2987652177 Bacteria 6969023
443 2987666595 2987659509 Bacteria 6966464
444 2987668821 2987666974 Bacteria 6509233
445 2987678102 2987673487 Bacteria 6884027
446 2996312262 2996310559 Bacteria 6357320
447 2996347206 2996341866 Bacteria 6643098
448 2996350584 2996348954 Bacteria 7239054
449 2996389277 2996386984 Bacteria 6978667
450 3000140154 3000135777 Bacteria 6891109
451 3002144140 3002141150 Bacteria 5254435
452 3004169347 3004167301 Bacteria 8330599
453 3004195597 3004188549 Bacteria 6952365
454 3004201285 3004195979 Bacteria 6776956
455 3004205863 3004203850 Bacteria 7307914
456 3004211872 3004211236 Bacteria 7417683
457 3004219119 3004218560 Bacteria 7421728
458 3004235003 3004232784 Bacteria 6662140
459 3004247929 3004239961 Bacteria 6892290
460 3004253565 3004248173 Bacteria 6563236
461 3004268951 3004268573 Bacteria 7043476
462 3004277282 3004275668 Bacteria 7114440
463 3004341259 3004334049 Bacteria 8449246
464 637074178 637000159 Bacteria 7596297
465 649873367 649633066 Bacteria 6690028
466 8004304262 8004300914 Bacteria 6132239
467 8004315396 8004312739 Bacteria 7444653
468 8004364218 8004361976 Bacteria 6858373
469 8004379335 8004374579 Bacteria 6898112
470 8004394547 8004387939 Bacteria 7049250
471 8004396784 8004395343 Bacteria 6620908
472 8004452016 8004445564 Bacteria 6322258
473 8004635084 8004633249 Bacteria 6723080
474 8004640323 8004640170 Bacteria 6723001
475 8004696364 8004695233 Bacteria 6731676
476 8004709724 8004703790 Bacteria 8006957
477 8004720727 8004714634 Bacteria 6776161
478 8004731263 8004727605 Bacteria 6643904
479 8055621332 8055617313 Bacteria 7548464
480 JGI25165J46597_1000062
481 Ga0055542_1000788
482 Ga0070689_100009570
483 Ga0070689_100082001
484 Ga0070687_100322308
485 Ga0070671_100067317
486 Ga0070674_100016724
487 Ga0070673_100318178
488 Ga0070700_100035496
489 Ga0070678_100089352
490 Ga0070662_100024750
491 Ga0070681_10226083
492 Ga0070685_10179686
493 Ga0068853_100057718
494 Ga0070665_100186534
495 Ga0070665_100746691
496 Ga0068855_100067195
497 Ga0068855_100167388
498 Ga0070702_100266491
499 Ga0068859_100189743
500 Ga0068864_100323466
501 Ga0068866_10071123
502 Ga0070717_10301285
503 Ga0075365_10051415
504 Ga0075368_10091823
505 Ga0075362_10136591
506 Ga0075367_10058050
507 Ga0075367_10070691
508 Ga0075367_10114208
509 Ga0075369_10051019
510 Ga0097620_100189750
511 Ga0105240_10236094
512 Ga0105240_10378230
513 Ga0105245_10131484
514 Ga0105243_10636263
515 Ga0105248_10024745
516 Ga0105237_10279372
517 Ga0105238_10004699
518 Ga0105238_10123786
519 Ga0105238_10241519
520 Ga0105238_10393246
521 Ga0105239_10158133
522 Ga0105239_10450893
523 Ga0157370_10071615
524 Ga0157369_10230019
525 Ga0163162_10437490
526 Ga0157375_10329689
527 Ga0157380_10061542
528 Ga0182008_10117234
529 Ga0157379_10519048
530 Ga0157379_10672397
531 Ga0209026_1000024
532 Ga0209148_1000050
533 Ga0209759_1000389
534 Ga0209233_1000129
535 Ga0209233_1004020
536 Ga0209455_1000183
537 Ga0207647_10069955
538 Ga0207705_10287864
539 Ga0207707_10151322
540 Ga0207662_10257707
541 Ga0207694_10016895
542 Ga0207694_10022832
543 Ga0207694_10385111
544 Ga0207706_10009280
545 Ga0207709_10033611
546 Ga0207670_10005797
547 Ga0207704_10351868
548 Ga0207711_10041322
549 Ga0207689_10163165
550 Ga0207667_10176308
551 Ga0207651_10219151
552 Ga0207639_10047559
553 Ga0207708_10089578
554 Ga0207702_10092013
555 Ga0207648_10130533
556 Ga0207648_10318656
557 Ga0207675_100346114
558 Ga0207683_10119905
559 Ga0209813_10078629
560 Ga0268266_10085130
561 Ga0268266_10111466
562 Ga0268266_10356799
563 Ga0268266_10488124
564 Ga0268265_10257336
565 Ga0307515_10000274
566 Ga0307515_10202505
567 Ga0265325_10046517
568 Ga0307513_10032122
569 Ga0307409_100300095
570 Ga0307416_100375402
571 Ga0373931_0007786
572 Ga0373931_0019772
573 Ga0373935_0108335
574 Ga0373947_0123766
575 Ga0373925_0200113
576 Ga0395899_0000440
577 Ga0395899_0226936
578 Ga0395900_0000509
579 Ga0395900_0368600
580 Ga0395900_0700499
581 Ga0395898_0000908
582 Ga0395898_0402613
583 Ga0395898_0412223
584 Ga0395905_0000623
585 Ga0395905_0019540
586 Ga0395905_0338984
587 Ga0395901_0000142
588 Ga0395901_0010455
589 Ga0395901_0029333
590 Ga0395901_0173233
591 Ga0439465_0016506
592 Ga0495638_0085675
593 Ga0495606_0016516
594 Ga0495628_0179898
595 Ga0495656_0138151
596 Ga0495625_0030407
597 Ga0495660_0139488
598 Ga0495672_0034295
599 Ga0495687_058775
600 Ga0495626_0101290
601 Ga0496100_0018738
602 Ga0496100_0049630
603 Ga0496101_0029783
604 Ga0496104_0541080
605 Ga0496105_0195957
606 Ga0496106_0087882
607 Ga0496110_0011785
608 Ga0496110_0642230
609 Ga0496112_0009161
610 Ga0496112_0065837
611 Ga0496112_0107533
612 Ga0496113_0166758
613 Ga0496114_0016233
614 Ga0496115_0029516
615 Ga0496115_0228573
616 Ga0496119_0003703
617 Ga0496119_0018250
618 Ga0496120_0001063
619 Ga0496120_0039297
620 Ga0496120_0081047
621 Ga0496121_0248761
622 Ga0496123_0024948
623 Ga0496125_0071313
624 Ga0501031_0019696
625 Ga0501032_0012779
626 Ga0501032_0016910
627 Ga0501033_0023823
628 Ga0501033_0039733
629 Ga0501033_0100016
630 Ga0501034_0034090
631 Ga0501034_0035127
632 Ga0501034_0133903
633 Ga0501034_0425539
634 Ga0501036_0007359
635 Ga0501036_0034965
636 Ga0501037_0037358
637 Ga0501038_0026903
638 Ga0501038_0043350
639 Ga0501039_0005967
640 Ga0501039_0046745
641 Ga0501042_0015629
642 Ga0501043_0023393
643 Ga0501043_0048480
644 Ga0501047_0013300
645 Ga0501047_0029965
646 Ga0501048_0031827
647 Ga0501067_0078199
648 Ga0501068_0007841
649 Ga0501069_0001708
650 Ga0501070_0056905
651 Ga0501070_0089061
652 Ga0501071_0001716
653 Ga0501073_0002722
654 Ga0501073_0031568
655 Ga0501073_0127449
656 Ga0501074_0020597
657 Ga0501079_0026468
658 Ga0501080_0002122
659 Ga0501035_0029509
660 Ga0501044_0004701
661 Ga0501044_0035985
662 Ga0501045_0064776
663 nmdc:mga00v17_136012_c1
664 nmdc:mga0yw44_178761_c1
665 nmdc:mga0yw44_19883_c1
666 nmdc:mga06z11_321115_c1
667 nmdc:mga06z11_35927_c1
668 nmdc:mga04h51_108243_c1
669 nmdc:mga0sz30_5372_c1
670 Ga0500610_0085427
671 Ga0495595_0050878
672 Ga0495619_0439637
673 Ga0500572_036362
674 Ga0500618_027480
675 Ga0500655_014921
676 Ga0500658_0124542
677 Ga0500568_0000144
678 Ga0500616_0000045
679 Ga0500616_0061047
680 Ga0500620_033830
681 Ga0500627_0068906
682 Ga0501082_0016463
683 2937877446
684 2503202037
685 2509115590
686 2509141764
687 2509371208
688 2509376181
689 2509396699
690 2510313865
691 2511388701
692 2512931075
693 2512958793
694 2513610966
695 2514037650
696 2514420281
697 2535484626
698 2551695406
699 2551698318
700 2551710773
701 2551723626
702 2551737719
703 2551745348
704 2588516833
705 2597814251
706 2599938318
707 2643772789
708 2643837849
709 2643989221
710 2644152793
711 2688598851
712 2694629809
713 2694636318
714 2723575796
715 2753359207
716 2756675736
717 2757570829
718 2758641452
719 2765465082
720 2770198246
721 2776271186
722 2776280817
723 2792749743
724 2839995016
725 2840767905
726 2841739708
727 2842872421
728 2844006244
729 2844014192
730 2847675975
731 2847692628
732 2854901948
733 2854911822
734 2854916860
735 2856314467
736 2856325665
737 2856331542
738 2856348705
739 2856355474
740 2856370546
741 2857350631
742 2869168669
743 2869176651
744 2869239308
745 2869249031
746 2869263548
747 2869267769
748 2869276868
749 2869279287
750 2869291727
751 2871434937
752 2871440613
753 2871454018
754 2871462107
755 2871467907
756 2871480303
757 2871484079
758 2871495581
759 2871502837
760 2874103311
761 2874112220
762 2874117304
763 2874130815
764 2874145034
765 2874149327
766 2874157590
767 2874166289
768 2874174367
769 2876365669
770 2876374818
771 2876390604
772 2876394633
773 2876400013
774 2876415793
775 2876425251
776 2878040046
777 2878737215
778 2878745671
779 2878752071
780 2878757824
781 2878766729
782 2878773926
783 2878777300
784 2878788558
785 2881151982
786 2881155708
787 2881167927
788 2881848154
789 2881858668
790 2881867994
791 2882637031
792 2882913964
793 2885309848
794 2885316928
795 2885320376
796 2885332120
797 2885346873
798 2885351919
799 2888339853
800 2888347278
801 2888356196
802 2889017150
803 2894656461
804 2894819872
805 2903455456
806 2903493371
807 2903506541
808 2903523598
809 2903534232
810 2903547976
811 2904581065
812 2904661267
813 2906314465
814 2906327633
815 2906329621
816 2906364243
817 2906375236
818 2906399607
819 2906406592
820 2906408268
821 2906414421
822 2915651722
823 2919121142
824 2922154971
825 2922160207
826 2922176013
827 2922193602
828 2924726287
829 2924731738
830 2924739303
831 2924744665
832 2924751266
833 2924761130
834 2924766837
835 2924783916
836 2924785681
837 2928523487
838 2937816232
839 2937824913
840 2937837976
841 2937855059
842 2937866876
843 2937894773
844 2937975448
845 2938001853
846 2938020174
847 2954015768
848 2958035428
849 2958043615
850 2958054054
851 2958067834
852 2958072650
853 2958084552
854 2958110655
855 2958118822
856 2958124913
857 2958136125
858 2958148610
859 2958171908
860 2958185593
861 2961083970
862 2961116419
863 2961134117
864 2961139935
865 2961170354
866 2961174367
867 2961186599
868 2963648144
869 2964720792
870 2965025100
871 2965026602
872 2965037987
873 2965043873
874 2965053010
875 2965063336
876 2965103499
877 2965122485
878 2968000357
879 2968003758
880 2968018025
881 2968090966
882 2968096638
883 2968100000
884 2968112325
885 2968121125
886 2968132690
887 2968143389
888 2968178741
889 2970471800
890 2970495753
891 2970506954
892 2970512879
893 2970530764
894 2970539936
895 2970541944
896 2970548232
897 2970561586
898 2970593883
899 2970627061
900 2970632565
901 2977822356
902 2977832121
903 2977846468
904 2977856921
905 2977860551
906 2977865863
907 2977900908
908 2977912317
909 2977916383
910 2977929272
911 2977940745
912 2977947664
913 2977952335
914 2977975268
915 2977992347
916 2979713700
917 2979780909
918 2979796102
919 2979812149
920 2987637815
921 2987657444
922 2987666595
923 2987668821
924 2987678102
925 2996312262
926 2996347206
927 2996350584
928 2996389277
929 3000140154
930 3002144140
931 3004169347
932 3004195597
933 3004201285
934 3004205863
935 3004211872
936 3004219119
937 3004235003
938 3004247929
939 3004253565
940 3004268951
941 3004277282
942 3004341259
943 637074178
944 649873367
945 8004304262
946 8004315396
947 8004364218
948 8004379335
949 8004394547
950 8004396784
951 8004452016
952 8004635084
953 8004640323
954 8004696364
955 8004709724
956 8004720727
957 8004731263
958 8055621332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

27

284

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3we9-assembly1.cif.gz_A the crystal structure of yisp from bacillus subtilis subsp. subtilis strain 168 0.8824 1 278
3we9-assembly1.cif.gz_A the crystal structure of yisp from bacillus subtilis subsp. subtilis strain 168 0.866 1 278
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.8652 5 282
3adz-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp 0.8418 7 283
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.84 5 282
ID Description Score Start End Superfamily
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9156 5 261 1.10.600.10
af_Q9VYS5_51_308_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8991 10 259 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8981 11 261 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.888 11 261 1.10.600.10
3we9A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8824 1 278 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A529FHN2-F1-model_v4 Phytoene/squalene synthase family protein 0.9948 22 195 GO:0005737
GO:0009058
GO:0043231
AF-A0A526YH11-F1-model_v4 Phytoene/squalene synthase family protein 0.9918 22 241 GO:0005737
GO:0009058
GO:0043231
AF-A0A371XDU3-F1-model_v4 Phytoene/squalene synthase family protein 0.9893 19 284 GO:0005737
GO:0009058
GO:0043231
AF-A0A529FHN2-F1-model_v4 Phytoene/squalene synthase family protein 0.9891 22 195 GO:0005737
GO:0009058
GO:0043231
AF-A0A529U6J3-F1-model_v4 deleted 0.9888 83 231

Map