F452091

General Info

Members Datasets Scaffolds Average Seq Length
479 304 421 333

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0003711|Ga0495638_0003711_2731_3822
Length 363
Sequence MGEHYEIIIDIATVPQQTLQKFANGRNSMVRIAVLGCGRIGRMHADNIAAHGRASLAGVFDVVTNASKEVAGKHGTKVFSSAEEAISSGDVDAVLIATTTATHADLLETAVAANKPILCEKPIDLSLDRVNRCAQVLAGTKVPIMLGFVRRFDTGHRAVRDAIKSGELGDLHQVVITSRDPGMPPVAYAEASGGIYRDMTIHDFDMARFILGEEVTEVSATGSRLVAPELMERLGDYDTVSVVLKTASGKQCIINNSRQAVYGYDQRVEALGNAGMAVSENKPLNMATFYKADYTGRGAPLMNFFIDRYLDAFMAEIGAFVDAVENGTAPEVGFEDGRLALVLAEAAIKSSQEGRTVKVSEVG

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
6 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
7 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
8 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
9 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
10 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
11 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
12 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
13 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
14 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
15 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
16 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
17 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
18 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
19 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
20 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
21 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
22 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
23 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
24 2643221582 Rhizobium sp. Root651 Isolate Unclassified
25 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
26 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
27 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
28 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
29 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
30 2791355262 Rhizobium sp. M1 Isolate Nodule
31 2791355267 Rhizobium sp. L18 Isolate Nodule
32 2818991450 Burkholderia sp. 604 Isolate Unclassified
33 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
34 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
35 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
36 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
37 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
38 2854911287 Brucella lupini LUP21 Isolate Unclassified
39 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
40 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
41 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
42 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
43 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
44 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
45 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
46 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
47 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
48 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
49 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
50 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
51 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
52 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
53 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
54 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
57 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
58 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
133 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
154 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
161 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
167 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
168 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
169 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
170 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
290 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
291 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
292 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
293 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
294 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
295 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
300 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
301 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
302 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
303 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
304 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.89
Metatranscriptomes 0
Isolates 12.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 2.92
Rhizoplane 4.8
Rhizosphere 69.73
Stem 0
Stem Tuber 0
Unclassified 14.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10048922 3300001979 Bacteria 1225
2 JGI24739J22299_10000780 3300001989 Bacteria 11609
3 JGI25162J39368_1000350 3300002737 Bacteria 39592
4 JGI25157J39369_1000053 3300002741 Bacteria 110228
5 JGI25406J46586_10011616 3300003203 Bacteria 3856
6 JGI25406J46586_10014068 3300003203 Bacteria 3411
7 JGI25165J46597_1000474 3300003214 Bacteria 39621
8 JGI25153J46596_10000756 3300003215 Bacteria 19789
9 Ga0055528_1015533 3300003790 Bacteria 2745
10 Ga0055540_1000384 3300003792 Bacteria 36797
11 Ga0058692_1002224 3300003856 Bacteria 6605
12 Ga0065714_10067211 3300005288 Bacteria 5772
13 Ga0065704_10009956 3300005289 Bacteria 2778
14 Ga0070680_100104438 3300005336 Bacteria 2354
15 Ga0068868_100357187 3300005338 Bacteria 1253
16 Ga0070669_100013312 3300005353 Bacteria 5847
17 Ga0070669_100063270 3300005353 Bacteria 2723
18 Ga0070694_100046324 3300005444 Bacteria 2919
19 Ga0070662_100001139 3300005457 Bacteria 16278
20 Ga0070681_10155491 3300005458 Bacteria 2212
21 Ga0068867_100073622 3300005459 Bacteria 2558
22 Ga0070706_100009173 3300005467 Bacteria 9210
23 Ga0070698_100035512 3300005471 Bacteria 5155
24 Ga0070697_100116965 3300005536 Bacteria 2227
25 Ga0068853_100434240 3300005539 Bacteria 1233
26 Ga0070695_100012360 3300005545 Bacteria 5120
27 Ga0070696_100001268 3300005546 Bacteria 16415
28 Ga0070693_100044455 3300005547 Bacteria 2513
29 Ga0068851_10000338 3300005834 Bacteria 21202
30 Ga0068870_10076132 3300005840 Bacteria 1842
31 Ga0081539_10000890 3300005985 Bacteria 57132
32 Ga0081539_10002175 3300005985 Bacteria 28809
33 Ga0075365_10054216 3300006038 Bacteria 2658
34 Ga0075365_10078537 3300006038 Bacteria 2232
35 Ga0075368_10000054 3300006042 Bacteria 28035
36 Ga0075363_100004577 3300006048 Bacteria 6065
37 Ga0075363_100005826 3300006048 Bacteria 5538
38 Ga0075363_100127046 3300006048 Bacteria 1428
39 Ga0075367_10002241 3300006178 Bacteria 8740
40 Ga0075367_10020180 3300006178 Bacteria 3707
41 Ga0075370_10009764 3300006353 Bacteria 4998
42 Ga0075433_10034403 3300006852 Bacteria 4352
43 Ga0075436_100063503 3300006914 Bacteria 2552
44 Ga0079104_1007087 3300006946 Bacteria 4123
45 Ga0105251_10000001 3300009011 Bacteria 466643
46 Ga0105251_10000002 3300009011 Bacteria 350843
47 Ga0105251_10000292 3300009011 Bacteria 50581
48 Ga0105251_10000966 3300009011 Bacteria 25549
49 Ga0105251_10001869 3300009011 Bacteria 17307
50 Ga0105251_10009223 3300009011 Bacteria 5849
51 Ga0105244_10004704 3300009036 Bacteria 9295
52 Ga0105250_10000088 3300009092 Bacteria 80904
53 Ga0105250_10000431 3300009092 Bacteria 30668
54 Ga0111539_10129244 3300009094 Bacteria 2958
55 Ga0114129_10153543 3300009147 Bacteria 3150
56 Ga0105241_10000002 3300009174 Bacteria 869480
57 Ga0105238_10046008 3300009551 Bacteria 4407
58 Ga0105239_10069395 3300010375 Bacteria 3872
59 Ga0105246_10000279 3300011119 Bacteria 26696
60 Ga0157373_10005363 3300013100 Bacteria 9632
61 Ga0157373_10074764 3300013100 Bacteria 2390
62 Ga0157369_10004166 3300013105 Bacteria 17134
63 Ga0157378_10060106 3300013297 Bacteria 3391
64 Ga0163162_10197553 3300013306 Bacteria 2140
65 Ga0157375_10000050 3300013308 Bacteria 134913
66 Ga0182008_10000598 3300014497 Bacteria 26495
67 Ga0182007_10002098 3300015262 Bacteria 10219
68 Ga0182005_1011757 3300015265 Bacteria 2487
69 Ga0163161_10115860 3300017792 Bacteria 2009
70 Ga0209437_100400 3300025233 Bacteria 40383
71 Ga0209026_1000002 3300025250 Bacteria 1136158
72 Ga0209759_1000179 3300025256 Bacteria 105045
73 Ga0209233_1000037 3300025261 Bacteria 554620
74 Ga0209233_1018754 3300025261 Bacteria 1854
75 Ga0209673_1002071 3300025273 Bacteria 15086
76 Ga0209758_1000793 3300025297 Bacteria 44917
77 Ga0209758_1001268 3300025297 Bacteria 31270
78 Ga0209051_1000166 3300025303 Bacteria 120265
79 Ga0207656_10000156 3300025321 Bacteria 25322
80 Ga0207696_1000007 3300025711 Bacteria 578417
81 Ga0207696_1000091 3300025711 Bacteria 187999
82 Ga0207655_1006408 3300025728 Bacteria 7804
83 Ga0207713_1000008 3300025735 Bacteria 553952
84 Ga0207713_1000117 3300025735 Bacteria 129339
85 Ga0207713_1000345 3300025735 Bacteria 50910
86 Ga0207713_1000569 3300025735 Bacteria 36636
87 Ga0207713_1001488 3300025735 Bacteria 18530
88 Ga0207713_1004863 3300025735 Bacteria 8611
89 Ga0207647_10000615 3300025904 Bacteria 27759
90 Ga0207643_10161765 3300025908 Bacteria 1347
91 Ga0207684_10133489 3300025910 Bacteria 2131
92 Ga0207654_10000005 3300025911 Bacteria 869492
93 Ga0207652_10385720 3300025921 Bacteria 1264
94 Ga0207681_10002265 3300025923 Bacteria 12232
95 Ga0207681_10003449 3300025923 Bacteria 9854
96 Ga0207706_10000935 3300025933 Bacteria 29879
97 Ga0207661_10171381 3300025944 Bacteria 1890
98 Ga0207679_10064878 3300025945 Bacteria 2731
99 Ga0207639_10204274 3300026041 Bacteria 1697
100 Ga0207648_10160356 3300026089 Bacteria 1986
101 Ga0207698_10197637 3300026142 Bacteria 1798
102 Ga0209281_1000003 3300027111 Bacteria 1260089
103 Ga0209179_1022367 3300027512 Bacteria 1241
104 Ga0268265_10274342 3300028380 Bacteria 1506
105 Ga0265319_1003747 3300028563 Bacteria 7800
106 Ga0307517_10074635 3300028786 Bacteria 2988
107 Ga0307513_10008207 3300031456 Bacteria 13394
108 Ga0307509_10001769 3300031507 Bacteria 35880
109 Ga0307509_10171525 3300031507 Bacteria 2048
110 Ga0307508_10000430 3300031616 Bacteria 49980
111 Ga0316579_10026235 3300031691 Bacteria 2636
112 Ga0316576_10037349 3300031727 Bacteria 3477
113 Ga0316576_10072327 3300031727 Bacteria 2545
114 Ga0316578_10065546 3300031728 Bacteria 2145
115 Ga0307405_10000958 3300031731 Bacteria 11551
116 Ga0316577_10000222 3300031733 Bacteria 19490
117 Ga0316577_10012162 3300031733 Bacteria 4683
118 Ga0316577_10021794 3300031733 Bacteria 3555
119 Ga0316577_10064120 3300031733 Bacteria 2051
120 Ga0316577_10087463 3300031733 Bacteria 1743
121 Ga0307410_10114474 3300031852 Bacteria 1957
122 Ga0307406_10171211 3300031901 Bacteria 1572
123 Ga0307407_10167103 3300031903 Bacteria 1445
124 Ga0307409_100332521 3300031995 Bacteria 1426
125 Ga0307510_10097814 3300033180 Bacteria 2742
126 Ga0307510_10123800 3300033180 Bacteria 2281
127 Ga0373946_0087778 3300035171 Bacteria 1373
128 Ga0316574_0017856 3300035398 Bacteria 4160
129 Ga0316574_0283064 3300035398 Bacteria 1056
130 Ga0373947_0039721 3300035725 Bacteria 2801
131 Ga0316582_0000745 3300036647 Bacteria 13020
132 Ga0316582_0004291 3300036647 Bacteria 7173
133 Ga0316582_0094900 3300036647 Bacteria 1968
134 Ga0316582_0101014 3300036647 Bacteria 1910
135 Ga0316584_0000161 3300036712 Bacteria 31222
136 Ga0316584_0002151 3300036712 Bacteria 12334
137 Ga0316584_0003443 3300036712 Bacteria 10273
138 Ga0316584_0007086 3300036712 Bacteria 7639
139 Ga0316584_0111716 3300036712 Bacteria 2045
140 Ga0395899_0113235 3300037312 Bacteria 1949
141 Ga0395898_0020177 3300037466 Bacteria 6770
142 Ga0395898_0135539 3300037466 Bacteria 2357
143 Ga0395898_0433287 3300037466 Bacteria 1253
144 Ga0395905_0000185 3300037471 Bacteria 99394
145 Ga0395905_0004520 3300037471 Bacteria 14409
146 Ga0395905_0137251 3300037471 Bacteria 2301
147 Ga0316581_0001374 3300037588 Bacteria 5429
148 Ga0395901_0076627 3300038443 Bacteria 3489
149 Ga0395901_0380543 3300038443 Bacteria 1453
150 Ga0395901_0459043 3300038443 Bacteria 1302
151 Ga0400483_093241 3300039062 Bacteria 1501
152 Ga0400487_16784 3300039110 Bacteria 1514
153 Ga0451795_1056918 3300041456 Bacteria 1658
154 Ga0451833_0213720 3300041491 Bacteria 1617
155 Ga0451841_1362367 3300041498 Bacteria 1712
156 Ga0451853_1272035 3300041512 Bacteria 1722
157 Ga0439463_014052 3300042016 Bacteria 1973
158 Ga0450894_002934 3300042131 Bacteria 2259
159 Ga0450898_000679 3300042134 Bacteria 4100
160 Ga0450899_003176 3300042135 Bacteria 1769
161 Ga0439459_0019767 3300042438 Bacteria 1279
162 Ga0466969_0090323 3300044656 Bacteria 1452
163 Ga0466965_0073627 3300044683 Bacteria 1720
164 Ga0466966_0102043 3300044684 Bacteria 1774
165 Ga0466966_0110832 3300044684 Bacteria 1691
166 Ga0466961_0000291 3300044693 Bacteria 33308
167 Ga0466961_0009073 3300044693 Bacteria 6342
168 Ga0466961_0084073 3300044693 Bacteria 2013
169 Ga0466963_0009949 3300044694 Bacteria 5744
170 Ga0466964_0019140 3300044706 Bacteria 2630
171 Ga0466957_0011486 3300044842 Bacteria 5111
172 Ga0466957_0047097 3300044842 Bacteria 2619
173 Ga0466959_0018291 3300045049 Bacteria 5145
174 Ga0466959_0024584 3300045049 Bacteria 4463
175 Ga0466958_0088991 3300045836 Bacteria 1908
176 Ga0466967_0030582 3300045976 Bacteria 4520
177 Ga0495627_003174 3300046453 Bacteria 7403
178 Ga0495591_000131 3300046458 Bacteria 82199
179 Ga0495591_001248 3300046458 Bacteria 16341
180 Ga0495591_007866 3300046458 Bacteria 4452
181 Ga0495591_007991 3300046458 Bacteria 4397
182 Ga0495629_0000152 3300046459 Bacteria 60605
183 Ga0495629_0007216 3300046459 Bacteria 8183
184 Ga0495638_0000785 3300046460 Bacteria 33482
185 Ga0495638_0003711 3300046460 Bacteria 11886
186 Ga0495653_0009895 3300046463 Bacteria 7797
187 Ga0495653_0033253 3300046463 Bacteria 4087
188 Ga0495650_0003554 3300046471 Bacteria 11281
189 Ga0495650_0039589 3300046471 Bacteria 2033
190 Ga0495580_0172551 3300046472 Bacteria 1494
191 Ga0495580_0226551 3300046472 Bacteria 1284
192 Ga0495582_0063073 3300046473 Bacteria 2047
193 Ga0495605_0000001 3300046474 Bacteria 614538
194 Ga0495605_0000132 3300046474 Bacteria 97986
195 Ga0495605_0007127 3300046474 Bacteria 6363
196 Ga0495662_0051997 3300046476 Bacteria 1978
197 Ga0495664_0035863 3300046477 Bacteria 2922
198 Ga0495584_0013570 3300046491 Bacteria 4158
199 Ga0495585_0026094 3300046492 Bacteria 3339
200 Ga0495585_0061824 3300046492 Bacteria 2058
201 Ga0495585_0080017 3300046492 Bacteria 1771
202 Ga0495594_0119088 3300046499 Bacteria 1492
203 Ga0495596_0048506 3300046500 Bacteria 1665
204 Ga0495596_0057376 3300046500 Bacteria 1519
205 Ga0495607_0000018 3300046501 Bacteria 167673
206 Ga0495607_0006946 3300046501 Bacteria 7888
207 Ga0495607_0010315 3300046501 Bacteria 6285
208 Ga0495607_0012573 3300046501 Bacteria 5581
209 Ga0495607_0098817 3300046501 Bacteria 1567
210 Ga0495583_0000651 3300046506 Bacteria 45809
211 Ga0495583_0001236 3300046506 Bacteria 27137
212 Ga0495583_0002032 3300046506 Bacteria 18425
213 Ga0495583_0002095 3300046506 Bacteria 17997
214 Ga0495583_0002581 3300046506 Bacteria 15189
215 Ga0495583_0031913 3300046506 Bacteria 2547
216 Ga0495583_0103857 3300046506 Bacteria 1210
217 Ga0495606_0000176 3300046507 Bacteria 113311
218 Ga0495606_0000794 3300046507 Bacteria 48239
219 Ga0495606_0001289 3300046507 Bacteria 34720
220 Ga0495606_0010536 3300046507 Bacteria 7655
221 Ga0495610_0000940 3300046512 Bacteria 27024
222 Ga0495610_0006348 3300046512 Bacteria 8167
223 Ga0495610_0023057 3300046512 Bacteria 3391
224 Ga0495616_0107204 3300046513 Bacteria 1302
225 Ga0495620_0001338 3300046515 Bacteria 14966
226 Ga0495620_0009921 3300046515 Bacteria 5040
227 Ga0495628_0013724 3300046516 Bacteria 6810
228 Ga0495628_0049203 3300046516 Bacteria 3338
229 Ga0495631_0005171 3300046518 Bacteria 6872
230 Ga0495631_0008440 3300046518 Bacteria 5191
231 Ga0495631_0058205 3300046518 Bacteria 1681
232 Ga0495632_0003819 3300046519 Bacteria 10482
233 Ga0495632_0004270 3300046519 Bacteria 9753
234 Ga0495632_0008634 3300046519 Bacteria 6222
235 Ga0495637_0000202 3300046520 Bacteria 46505
236 Ga0495637_0002261 3300046520 Bacteria 10693
237 Ga0495637_0007350 3300046520 Bacteria 5469
238 Ga0495637_0015082 3300046520 Bacteria 3632
239 Ga0495643_0008792 3300046522 Bacteria 6362
240 Ga0495644_0003896 3300046523 Bacteria 5874
241 Ga0495648_0002590 3300046524 Bacteria 16563
242 Ga0495648_0007696 3300046524 Bacteria 8589
243 Ga0495648_0011783 3300046524 Bacteria 6561
244 Ga0495648_0080261 3300046524 Bacteria 1859
245 Ga0495648_0173918 3300046524 Bacteria 1101
246 Ga0495666_0008516 3300046526 Bacteria 5143
247 Ga0495654_0000119 3300046530 Bacteria 88217
248 Ga0495654_0003370 3300046530 Bacteria 9843
249 Ga0495654_0004292 3300046530 Bacteria 8504
250 Ga0495654_0064581 3300046530 Bacteria 1749
251 Ga0495665_0005681 3300046531 Bacteria 6731
252 Ga0495640_0096561 3300046533 Bacteria 1944
253 Ga0495586_0038940 3300046535 Bacteria 2555
254 Ga0495609_0000014 3300046538 Bacteria 326023
255 Ga0495609_0000067 3300046538 Bacteria 130284
256 Ga0495597_0034289 3300046542 Bacteria 2294
257 Ga0495622_0003196 3300046557 Bacteria 7760
258 Ga0495633_0070886 3300046558 Bacteria 1626
259 Ga0495656_0092741 3300046615 Bacteria 1384
260 Ga0495668_0006421 3300046616 Bacteria 7700
261 Ga0495668_0020337 3300046616 Bacteria 3819
262 Ga0495668_0154245 3300046616 Bacteria 1258
263 Ga0495611_0000175 3300046648 Bacteria 46491
264 Ga0495611_0000950 3300046648 Bacteria 15530
265 Ga0495611_0007803 3300046648 Bacteria 4545
266 Ga0495611_0010652 3300046648 Bacteria 3893
267 Ga0495625_0000028 3300046660 Bacteria 256946
268 Ga0495625_0004366 3300046660 Bacteria 13420
269 Ga0495625_0125373 3300046660 Bacteria 1744
270 Ga0495635_0077317 3300046663 Bacteria 2280
271 Ga0495661_0000135 3300046665 Bacteria 86985
272 Ga0495661_0000191 3300046665 Bacteria 71123
273 Ga0495661_0000698 3300046665 Bacteria 33395
274 Ga0495661_0007574 3300046665 Bacteria 7565
275 Ga0495588_0042257 3300046674 Bacteria 2330
276 Ga0495588_0043913 3300046674 Bacteria 2288
277 Ga0495646_0081036 3300046680 Bacteria 1892
278 Ga0495646_0100335 3300046680 Bacteria 1661
279 Ga0495624_0001078 3300046690 Bacteria 21554
280 Ga0495670_0125761 3300046691 Bacteria 1334
281 Ga0495670_0128810 3300046691 Bacteria 1318
282 Ga0495671_0026715 3300046692 Bacteria 2989
283 Ga0495649_0024512 3300046694 Bacteria 3364
284 Ga0495649_0040376 3300046694 Bacteria 2556
285 Ga0495589_0000377 3300046794 Bacteria 34084
286 Ga0495589_0007570 3300046794 Bacteria 5689
287 Ga0495660_0004711 3300046810 Bacteria 8229
288 Ga0495660_0034018 3300046810 Bacteria 2854
289 Ga0495660_0076525 3300046810 Bacteria 1763
290 Ga0495581_0152949 3300047315 Bacteria 1348
291 Ga0495674_0002112 3300047319 Bacteria 19511
292 Ga0495674_0035028 3300047319 Bacteria 4532
293 Ga0495674_0109875 3300047319 Bacteria 2338
294 Ga0495672_0000177 3300047320 Bacteria 92373
295 Ga0495672_0014127 3300047320 Bacteria 5478
296 Ga0495672_0038416 3300047320 Bacteria 2920
297 Ga0495676_0000006 3300047321 Bacteria 280508
298 Ga0495676_0009634 3300047321 Bacteria 8790
299 Ga0495676_0047881 3300047321 Bacteria 3451
300 Ga0495680_0067722 3300047322 Bacteria 2729
301 Ga0495683_0031868 3300047323 Bacteria 2685
302 Ga0495683_0105067 3300047323 Bacteria 1354
303 Ga0495687_016768 3300047443 Bacteria 3674
304 Ga0495675_0070116 3300047444 Bacteria 2213
305 Ga0495679_000226 3300047446 Bacteria 47732
306 Ga0495679_000427 3300047446 Bacteria 31171
307 Ga0495679_001677 3300047446 Bacteria 12308
308 Ga0495679_008977 3300047446 Bacteria 4031
309 Ga0495673_0000279 3300047469 Bacteria 69195
310 Ga0495673_0001663 3300047469 Bacteria 17119
311 Ga0495673_0003800 3300047469 Bacteria 9759
312 Ga0495673_0006065 3300047469 Bacteria 7177
313 Ga0495673_0014424 3300047469 Bacteria 4109
314 Ga0495681_0000789 3300047470 Bacteria 24391
315 Ga0495686_0090797 3300047472 Bacteria 1854
316 Ga0495593_0002456 3300047673 Bacteria 11150
317 Ga0495593_0013399 3300047673 Bacteria 4679
318 Ga0495626_0000019 3300048091 Bacteria 225494
319 Ga0496100_0016405 3300048903 Bacteria 4350
320 Ga0496100_0145571 3300048903 Bacteria 1684
321 Ga0496102_0031092 3300048905 Bacteria 4785
322 Ga0496102_0113223 3300048905 Bacteria 2531
323 Ga0496104_0058642 3300048907 Bacteria 3644
324 Ga0496108_0029826 3300048911 Bacteria 4520
325 Ga0496108_0166730 3300048911 Bacteria 1905
326 Ga0496110_0112458 3300048913 Bacteria 2448
327 Ga0496110_0132203 3300048913 Bacteria 2254
328 Ga0496110_0223772 3300048913 Bacteria 1711
329 Ga0496110_0409969 3300048913 Bacteria 1235
330 Ga0496111_0055626 3300048914 Bacteria 2862
331 Ga0496114_0066942 3300048917 Bacteria 3012
332 Ga0496114_0106860 3300048917 Bacteria 2395
333 Ga0496116_0015672 3300048919 Bacteria 5981
334 Ga0496116_0162367 3300048919 Bacteria 1224
335 Ga0496117_0007078 3300048920 Bacteria 11091
336 Ga0496117_0035173 3300048920 Bacteria 3764
337 Ga0496117_0037521 3300048920 Bacteria 3609
338 Ga0496117_0047577 3300048920 Bacteria 3074
339 Ga0496118_0000897 3300048921 Bacteria 46751
340 Ga0496118_0049679 3300048921 Bacteria 3227
341 Ga0496119_0006413 3300048922 Bacteria 10913
342 Ga0496119_0019177 3300048922 Bacteria 5052
343 Ga0496120_0004700 3300048923 Bacteria 11265
344 Ga0496121_0001435 3300048924 Bacteria 40263
345 Ga0496121_0005397 3300048924 Bacteria 16415
346 Ga0496121_0017703 3300048924 Bacteria 7253
347 Ga0496122_0000327 3300048925 Bacteria 103468
348 Ga0496122_0005708 3300048925 Bacteria 14671
349 Ga0496122_0030429 3300048925 Bacteria 4522
350 Ga0496122_0047190 3300048925 Bacteria 3327
351 Ga0496122_0062147 3300048925 Bacteria 2736
352 Ga0496123_0000115 3300048926 Bacteria 163097
353 Ga0496123_0001974 3300048926 Bacteria 26588
354 Ga0496123_0009858 3300048926 Bacteria 8530
355 Ga0496123_0034362 3300048926 Bacteria 3633
356 Ga0496124_0001309 3300048927 Bacteria 37591
357 Ga0496124_0012416 3300048927 Bacteria 8411
358 Ga0496124_0036395 3300048927 Bacteria 4294
359 Ga0496124_0144479 3300048927 Bacteria 1873
360 Ga0496124_0181928 3300048927 Bacteria 1617
361 Ga0496125_0000245 3300048928 Bacteria 111310
362 Ga0496125_0001265 3300048928 Bacteria 37668
363 Ga0496125_0004266 3300048928 Bacteria 16636
364 Ga0496125_0024665 3300048928 Bacteria 5524
365 Ga0496125_0037402 3300048928 Bacteria 4221
366 Ga0496126_0010016 3300048929 Bacteria 10003
367 Ga0496126_0015283 3300048929 Bacteria 7727
368 Ga0496126_0112853 3300048929 Bacteria 2366
369 Ga0495678_000072 3300049459 Bacteria 128270
370 Ga0495678_051076 3300049459 Bacteria 1600
371 Ga0495682_0000361 3300049460 Bacteria 33190
372 Ga0501034_0245700 3300049571 Bacteria 1735
373 Ga0501036_0222182 3300049572 Bacteria 1586
374 Ga0501036_0442364 3300049572 Bacteria 1083
375 Ga0501042_0075319 3300049578 Bacteria 2415
376 Ga0501042_0165363 3300049578 Bacteria 1596
377 Ga0501043_0176607 3300049579 Bacteria 1665
378 Ga0501048_0050950 3300049582 Bacteria 2948
379 Ga0501048_0235577 3300049582 Bacteria 1299
380 Ga0501067_0007004 3300049583 Bacteria 6259
381 Ga0501067_0026481 3300049583 Bacteria 3212
382 Ga0501067_0036006 3300049583 Bacteria 2749
383 Ga0501068_0001431 3300049584 Bacteria 12660
384 Ga0501068_0107666 3300049584 Bacteria 1731
385 Ga0501070_0151912 3300049586 Bacteria 1910
386 Ga0501071_0153466 3300049587 Bacteria 1719
387 Ga0501072_0099390 3300049588 Bacteria 2313
388 Ga0501076_0055347 3300049592 Bacteria 3146
389 Ga0501077_0093613 3300049593 Bacteria 1905
390 Ga0501079_0106086 3300049741 Bacteria 2180
391 Ga0501045_0020356 3300049824 Bacteria 4739
392 Ga0501045_0030078 3300049824 Bacteria 3929
393 Ga0501045_0069329 3300049824 Bacteria 2592
394 Ga0501045_0122109 3300049824 Bacteria 1934
395 nmdc:mga03n38_14184_c1 3300050490 Bacteria 3048
396 nmdc:mga03n38_51157_c1 3300050490 Bacteria 1844
397 nmdc:mga00v17_222101_c1 3300050491 Bacteria 1223
398 nmdc:mga00v17_87229_c1 3300050491 Bacteria 1956
399 nmdc:mga0yw44_104940_c1 3300050492 Bacteria 1805
400 nmdc:mga0yw44_24640_c1 3300050492 Bacteria 3408
401 nmdc:mga06z11_17109_c1 3300050494 Bacteria 3283
402 nmdc:mga06z11_48526_c1 3300050494 Bacteria 2161
403 nmdc:mga05p37_283603_c1 3300050507 Bacteria 1974
404 nmdc:mga08y16_104569_c1 3300050511 Bacteria 2947
405 nmdc:mga0a205_10875_c1 3300050515 Bacteria 8372
406 nmdc:mga0sz30_10110_c1 3300050516 Bacteria 2333
407 nmdc:mga0sz30_14389_c1 3300050516 Bacteria 3112
408 Ga0495619_0178112 3300053085 Bacteria 1471
409 Ga0500643_035422 3300053087 Bacteria 1497
410 Ga0500557_009971 3300053105 Bacteria 2355
411 Ga0500594_0002368 3300053118 Bacteria 4097
412 Ga0500618_000475 3300053125 Bacteria 25939
413 Ga0500652_065695 3300053131 Bacteria 1499
414 Ga0500588_0036435 3300053146 Bacteria 1455
415 Ga0500634_0000568 3300053161 Bacteria 12224
416 Ga0501084_0303315 3300054114 Bacteria 1349
417 Ga0501082_0196692 3300060353 Bacteria 1754
418 Ga0466962_0000953 3300061719 Bacteria 13127
419 Ga0530510_0129340 3300061734 Bacteria 1857
420 Ga0530510_0319961 3300061734 Bacteria 1163
421 Ga0530510_0320828 3300061734 Bacteria 1161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0409969 Ga0496110_0409969_358_1218 284
2 3300005336 Ga0070680_100104438 Ga0070680_1001044382 299
3 3300006852 Ga0075433_10034403 Ga0075433_100344034 299
4 3300050515 nmdc:mga0a205_10875_c1 nmdc:mga0a205_10875_c1_4800_5795 299
5 3300049572 Ga0501036_0222182 Ga0501036_0222182_461_1513 300
6 3300048913 Ga0496110_0132203 Ga0496110_0132203_282_1319 302
7 3300005539 Ga0068853_100434240 Ga0068853_1004342402 307
8 3300009551 Ga0105238_10046008 Ga0105238_100460082 307
9 3300026041 Ga0207639_10204274 Ga0207639_102042742 307
10 3300042438 Ga0439459_0019767 Ga0439459_0019767_225_1217 307
11 3300046472 Ga0495580_0226551 Ga0495580_0226551_232_1224 307
12 3300050491 nmdc:mga00v17_222101_c1 nmdc:mga00v17_222101_c1_21_1085 307
13 3300017792 Ga0163161_10115860 Ga0163161_101158602 314
14 3300049571 Ga0501034_0245700 Ga0501034_0245700_325_1389 315
15 3300049572 Ga0501036_0442364 Ga0501036_0442364_37_987 315
16 3300049592 Ga0501076_0055347 Ga0501076_0055347_1160_2113 316
17 3300049824 Ga0501045_0020356 Ga0501045_0020356_1478_2431 316
18 3300054114 Ga0501084_0303315 Ga0501084_0303315_278_1231 316
19 3300060353 Ga0501082_0196692 Ga0501082_0196692_748_1701 316
20 3300049583 Ga0501067_0036006 Ga0501067_0036006_600_1664 317
21 3300061734 Ga0530510_0319961 Ga0530510_0319961_13_972 318
22 3300005471 Ga0070698_100035512 Ga0070698_1000355123 319
23 3300009147 Ga0114129_10153543 Ga0114129_101535432 319
24 3300039110 Ga0400487_16784 Ga0400487_16784_511_1473 319
25 3300050507 nmdc:mga05p37_283603_c1 nmdc:mga05p37_283603_c1_166_1128 319
26 3300006038 Ga0075365_10078537 Ga0075365_100785372 320
27 3300031852 Ga0307410_10114474 Ga0307410_101144742 320
28 3300031903 Ga0307407_10167103 Ga0307407_101671031 320
29 3300003203 JGI25406J46586_10011616 JGI25406J46586_100116161 321
30 3300005985 Ga0081539_10000890 Ga0081539_1000089027 321
31 3300010375 Ga0105239_10069395 Ga0105239_100693953 321
32 3300039062 Ga0400483_093241 Ga0400483_093241_63_1031 321
33 3300046460 Ga0495638_0000785 Ga0495638_0000785_19735_20700 321
34 3300046492 Ga0495585_0061824 Ga0495585_0061824_949_1914 321
35 3300046513 Ga0495616_0107204 Ga0495616_0107204_103_1068 321
36 3300046518 Ga0495631_0058205 Ga0495631_0058205_556_1521 321
37 3300046616 Ga0495668_0020337 Ga0495668_0020337_2147_3112 321
38 3300046648 Ga0495611_0010652 Ga0495611_0010652_1859_2824 321
39 3300046660 Ga0495625_0004366 Ga0495625_0004366_6675_7640 321
40 3300050516 nmdc:mga0sz30_10110_c1 nmdc:mga0sz30_10110_c1_966_1931 321
41 3300053087 Ga0500643_035422 Ga0500643_035422_269_1234 321
42 3300053105 Ga0500557_009971 Ga0500557_009971_827_1792 321
43 3300053118 Ga0500594_0002368 Ga0500594_0002368_796_1761 321
44 3300053131 Ga0500652_065695 Ga0500652_065695_235_1200 321
45 3300053146 Ga0500588_0036435 Ga0500588_0036435_453_1418 321
46 3300035725 Ga0373947_0039721 Ga0373947_0039721_14_991 325
47 3300050516 nmdc:mga0sz30_14389_c1 nmdc:mga0sz30_14389_c1_1683_2660 325
48 3300035398 Ga0316574_0283064 Ga0316574_0283064_14_1003 326
49 iso_pu_bacteria 2513237166 2514052121 326
50 iso_pu_bacteria 2818991450 2819622489 326
51 iso_pu_bacteria 2883087390 2883092776 326
52 iso_pu_bacteria 2900634093 2900635172 326
53 iso_pu_bacteria 2904615490 2904624945 326
54 iso_pu_bacteria 2928108538 2928111904 326
55 iso_pu_bacteria 2928135762 2928139143 326
56 iso_pu_bacteria 2928503688 2928508841 326
57 iso_pu_bacteria 8055266321 8055269597 326
58 iso_pu_bacteria 2599185167 2599398564 327
59 3300025944 Ga0207661_10171381 Ga0207661_101713812 328
60 3300046691 Ga0495670_0125761 Ga0495670_0125761_73_1059 328
61 iso_pu_bacteria 2738541271 2738688022 328
62 iso_pu_bacteria 2738543016 2739263543 328
63 3300031901 Ga0307406_10171211 Ga0307406_101712112 329
64 3300001989 JGI24739J22299_10000780 JGI24739J22299_100007808 330
65 3300005459 Ga0068867_100073622 Ga0068867_1000736222 330
66 3300005536 Ga0070697_100116965 Ga0070697_1001169652 330
67 3300009011 Ga0105251_10001869 Ga0105251_1000186916 330
68 3300009094 Ga0111539_10129244 Ga0111539_101292441 330
69 3300015262 Ga0182007_10002098 Ga0182007_100020984 330
70 3300025261 Ga0209233_1018754 Ga0209233_10187542 330
71 3300025735 Ga0207713_1001488 Ga0207713_100148816 330
72 3300025904 Ga0207647_10000615 Ga0207647_1000061520 330
73 3300025910 Ga0207684_10133489 Ga0207684_101334892 330
74 3300026089 Ga0207648_10160356 Ga0207648_101603562 330
75 3300037471 Ga0395905_0000185 Ga0395905_0000185_75181_76173 330
76 3300037471 Ga0395905_0004520 Ga0395905_0004520_297_1289 330
77 3300044656 Ga0466969_0090323 Ga0466969_0090323_149_1141 330
78 3300046459 Ga0495629_0000152 Ga0495629_0000152_10034_11026 330
79 3300046459 Ga0495629_0007216 Ga0495629_0007216_6599_7591 330
80 3300046463 Ga0495653_0009895 Ga0495653_0009895_5821_6813 330
81 3300046463 Ga0495653_0033253 Ga0495653_0033253_1300_2292 330
82 3300046472 Ga0495580_0172551 Ga0495580_0172551_200_1192 330
83 3300046473 Ga0495582_0063073 Ga0495582_0063073_824_1816 330
84 3300046474 Ga0495605_0000001 Ga0495605_0000001_600397_601389 330
85 3300046476 Ga0495662_0051997 Ga0495662_0051997_874_1866 330
86 3300046477 Ga0495664_0035863 Ga0495664_0035863_971_1963 330
87 3300046499 Ga0495594_0119088 Ga0495594_0119088_68_1060 330
88 3300046500 Ga0495596_0048506 Ga0495596_0048506_655_1647 330
89 3300046506 Ga0495583_0031913 Ga0495583_0031913_1241_2233 330
90 3300046506 Ga0495583_0103857 Ga0495583_0103857_132_1124 330
91 3300046516 Ga0495628_0013724 Ga0495628_0013724_4044_5036 330
92 3300046516 Ga0495628_0049203 Ga0495628_0049203_1518_2510 330
93 3300046526 Ga0495666_0008516 Ga0495666_0008516_1330_2322 330
94 3300046531 Ga0495665_0005681 Ga0495665_0005681_1548_2540 330
95 3300046533 Ga0495640_0096561 Ga0495640_0096561_204_1196 330
96 3300046535 Ga0495586_0038940 Ga0495586_0038940_781_1773 330
97 3300046615 Ga0495656_0092741 Ga0495656_0092741_46_1038 330
98 3300046616 Ga0495668_0154245 Ga0495668_0154245_131_1123 330
99 3300046663 Ga0495635_0077317 Ga0495635_0077317_1098_2090 330
100 3300046674 Ga0495588_0042257 Ga0495588_0042257_1107_2099 330
101 3300046680 Ga0495646_0081036 Ga0495646_0081036_130_1122 330
102 3300046680 Ga0495646_0100335 Ga0495646_0100335_580_1572 330
103 3300046690 Ga0495624_0001078 Ga0495624_0001078_12011_13003 330
104 3300046694 Ga0495649_0024512 Ga0495649_0024512_1425_2417 330
105 3300046694 Ga0495649_0040376 Ga0495649_0040376_926_1918 330
106 3300046810 Ga0495660_0076525 Ga0495660_0076525_469_1461 330
107 3300047319 Ga0495674_0002112 Ga0495674_0002112_16475_17467 330
108 3300047319 Ga0495674_0035028 Ga0495674_0035028_676_1668 330
109 3300047319 Ga0495674_0109875 Ga0495674_0109875_1147_2139 330
110 3300047321 Ga0495676_0009634 Ga0495676_0009634_7574_8566 330
111 3300047321 Ga0495676_0047881 Ga0495676_0047881_1438_2430 330
112 3300047322 Ga0495680_0067722 Ga0495680_0067722_466_1458 330
113 3300047323 Ga0495683_0105067 Ga0495683_0105067_81_1073 330
114 3300047443 Ga0495687_016768 Ga0495687_016768_449_1441 330
115 3300047444 Ga0495675_0070116 Ga0495675_0070116_990_1982 330
116 3300047673 Ga0495593_0002456 Ga0495593_0002456_5849_6841 330
117 3300047673 Ga0495593_0013399 Ga0495593_0013399_2692_3684 330
118 3300048903 Ga0496100_0145571 Ga0496100_0145571_561_1553 330
119 3300048905 Ga0496102_0113223 Ga0496102_0113223_71_1063 330
120 3300048907 Ga0496104_0058642 Ga0496104_0058642_958_1950 330
121 3300048911 Ga0496108_0029826 Ga0496108_0029826_3197_4189 330
122 3300048913 Ga0496110_0112458 Ga0496110_0112458_1041_2033 330
123 3300048917 Ga0496114_0066942 Ga0496114_0066942_1696_2688 330
124 3300048919 Ga0496116_0015672 Ga0496116_0015672_758_1750 330
125 3300048920 Ga0496117_0037521 Ga0496117_0037521_2094_3086 330
126 3300048921 Ga0496118_0000897 Ga0496118_0000897_9170_10162 330
127 3300048927 Ga0496124_0181928 Ga0496124_0181928_321_1313 330
128 3300048929 Ga0496126_0112853 Ga0496126_0112853_232_1224 330
129 3300050511 nmdc:mga08y16_104569_c1 nmdc:mga08y16_104569_c1_184_1254 330
130 3300053085 Ga0495619_0178112 Ga0495619_0178112_166_1158 330
131 iso_pu_bacteria 2511231007 2511273294 330
132 iso_pu_bacteria 2597489888 2597863656 330
133 iso_pu_bacteria 2597489889 2597869625 330
134 iso_pu_bacteria 2599185179 2599450617 330
135 iso_pu_bacteria 2599185189 2599507134 330
136 iso_pu_bacteria 2599185190 2599513048 330
137 iso_pu_bacteria 2599185191 2599520741 330
138 iso_pu_bacteria 2599185288 2599880308 330
139 iso_pu_bacteria 2599185290 2599891725 330
140 iso_pu_bacteria 2600255296 2601692068 330
141 iso_pu_bacteria 2643221571 2643870419 330
142 iso_pu_bacteria 2643221713 2644620981 330
143 iso_pu_bacteria 2738541294 2738806532 330
144 iso_pu_bacteria 2738541309 2738893892 330
145 iso_pu_bacteria 2842826826 2842827135 330
146 iso_pu_bacteria 2842837860 2842843146 330
147 iso_pu_bacteria 2931390751 2931393701 330
148 iso_pu_bacteria 2945928738 2945933243 330
149 iso_pu_bacteria 2945961074 2945964014 330
150 iso_pu_bacteria 2946006987 2946009481 330
151 iso_pu_bacteria 2946027586 2946030722 330
152 3300005444 Ga0070694_100046324 Ga0070694_1000463243 331
153 3300005458 Ga0070681_10155491 Ga0070681_101554912 331
154 3300005545 Ga0070695_100012360 Ga0070695_1000123602 331
155 3300005546 Ga0070696_100001268 Ga0070696_10000126810 331
156 3300005547 Ga0070693_100044455 Ga0070693_1000444552 331
157 3300006946 Ga0079104_1007087 Ga0079104_10070873 331
158 3300009011 Ga0105251_10000002 Ga0105251_1000000230 331
159 3300009092 Ga0105250_10000431 Ga0105250_1000043112 331
160 3300009174 Ga0105241_10000002 Ga0105241_10000002216 331
161 3300013100 Ga0157373_10005363 Ga0157373_100053635 331
162 3300025711 Ga0207696_1000007 Ga0207696_100000712 331
163 3300025735 Ga0207713_1000008 Ga0207713_1000008315 331
164 3300025911 Ga0207654_10000005 Ga0207654_10000005216 331
165 3300025921 Ga0207652_10385720 Ga0207652_103857201 331
166 3300027111 Ga0209281_1000003 Ga0209281_1000003490 331
167 3300031995 Ga0307409_100332521 Ga0307409_1003325212 331
168 3300046492 Ga0495585_0026094 Ga0495585_0026094_799_1869 331
169 3300046674 Ga0495588_0043913 Ga0495588_0043913_1150_2220 331
170 3300048920 Ga0496117_0047577 Ga0496117_0047577_354_1379 331
171 3300048928 Ga0496125_0037402 Ga0496125_0037402_1231_2226 331
172 3300048929 Ga0496126_0010016 Ga0496126_0010016_1229_2224 331
173 iso_pu_bacteria 2510917022 2511136705 331
174 iso_pu_bacteria 2510917028 2511182008 331
175 iso_pu_bacteria 2582581307 2585276312 331
176 iso_pu_bacteria 2582581315 2585329093 331
177 iso_pu_bacteria 2582581866 2585393681 331
178 iso_pu_bacteria 2585427531 2585564112 331
179 iso_pu_bacteria 2585427590 2585820603 331
180 iso_pu_bacteria 2585427609 2585903042 331
181 iso_pu_bacteria 2585428125 2587978383 331
182 iso_pu_bacteria 2617270742 2617386576 331
183 iso_pu_bacteria 2643221582 2643916999 331
184 iso_pu_bacteria 2791355262 2793335263 331
185 iso_pu_bacteria 2791355267 2793366322 331
186 iso_pu_bacteria 2841734538 2841739752 331
187 iso_pu_bacteria 2841859092 2841861667 331
188 iso_pu_bacteria 2842515876 2842518067 331
189 iso_pu_bacteria 2854911287 2854915528 331
190 iso_pu_bacteria 2933011516 2933013696 331
191 iso_pu_bacteria 2937822353 2937828003 331
192 iso_pu_bacteria 3006984091 3006988150 331
193 iso_pu_bacteria 8003570095 8003572911 331
194 iso_pu_bacteria 8054563764 8054567363 331
195 iso_pu_bacteria 8056375014 8056380033 331
196 iso_pu_bacteria 8057874678 8057875928 331
197 3300003203 JGI25406J46586_10014068 JGI25406J46586_100140684 332
198 3300005338 Ga0068868_100357187 Ga0068868_1003571872 332
199 3300005840 Ga0068870_10076132 Ga0068870_100761322 332
200 3300005985 Ga0081539_10002175 Ga0081539_1000217518 332
201 3300006042 Ga0075368_10000054 Ga0075368_100000549 332
202 3300006048 Ga0075363_100004577 Ga0075363_1000045773 332
203 3300006048 Ga0075363_100005826 Ga0075363_1000058265 332
204 3300006178 Ga0075367_10002241 Ga0075367_100022417 332
205 3300009011 Ga0105251_10000001 Ga0105251_10000001203 332
206 3300015265 Ga0182005_1011757 Ga0182005_10117572 332
207 3300025735 Ga0207713_1000117 Ga0207713_1000117120 332
208 3300025908 Ga0207643_10161765 Ga0207643_101617652 332
209 3300031691 Ga0316579_10026235 Ga0316579_100262352 332
210 3300031727 Ga0316576_10037349 Ga0316576_100373492 332
211 3300031727 Ga0316576_10072327 Ga0316576_100723272 332
212 3300031728 Ga0316578_10065546 Ga0316578_100655462 332
213 3300031733 Ga0316577_10000222 Ga0316577_100002225 332
214 3300031733 Ga0316577_10012162 Ga0316577_100121621 332
215 3300031733 Ga0316577_10021794 Ga0316577_100217943 332
216 3300031733 Ga0316577_10064120 Ga0316577_100641202 332
217 3300031733 Ga0316577_10087463 Ga0316577_100874632 332
218 3300035398 Ga0316574_0017856 Ga0316574_0017856_146_1165 332
219 3300036647 Ga0316582_0000745 Ga0316582_0000745_7945_8964 332
220 3300036647 Ga0316582_0004291 Ga0316582_0004291_5720_6736 332
221 3300036647 Ga0316582_0094900 Ga0316582_0094900_445_1473 332
222 3300036647 Ga0316582_0101014 Ga0316582_0101014_94_1113 332
223 3300036712 Ga0316584_0000161 Ga0316584_0000161_22995_24014 332
224 3300036712 Ga0316584_0002151 Ga0316584_0002151_4307_5332 332
225 3300036712 Ga0316584_0003443 Ga0316584_0003443_6561_7577 332
226 3300036712 Ga0316584_0007086 Ga0316584_0007086_4431_5450 332
227 3300036712 Ga0316584_0111716 Ga0316584_0111716_734_1759 332
228 3300037588 Ga0316581_0001374 Ga0316581_0001374_2102_3121 332
229 3300038443 Ga0395901_0380543 Ga0395901_0380543_354_1406 332
230 3300038443 Ga0395901_0459043 Ga0395901_0459043_231_1280 332
231 3300041456 Ga0451795_1056918 Ga0451795_1056918_299_1348 332
232 3300041491 Ga0451833_0213720 Ga0451833_0213720_355_1404 332
233 3300041498 Ga0451841_1362367 Ga0451841_1362367_121_1167 332
234 3300041512 Ga0451853_1272035 Ga0451853_1272035_439_1488 332
235 3300042016 Ga0439463_014052 Ga0439463_014052_318_1316 332
236 3300044683 Ga0466965_0073627 Ga0466965_0073627_702_1700 332
237 3300044684 Ga0466966_0102043 Ga0466966_0102043_42_1052 332
238 3300044684 Ga0466966_0110832 Ga0466966_0110832_27_1025 332
239 3300044693 Ga0466961_0000291 Ga0466961_0000291_13148_14146 332
240 3300044693 Ga0466961_0009073 Ga0466961_0009073_3211_4239 332
241 3300044693 Ga0466961_0084073 Ga0466961_0084073_469_1521 332
242 3300044694 Ga0466963_0009949 Ga0466963_0009949_4079_5131 332
243 3300044706 Ga0466964_0019140 Ga0466964_0019140_93_1145 332
244 3300044842 Ga0466957_0011486 Ga0466957_0011486_952_2004 332
245 3300044842 Ga0466957_0047097 Ga0466957_0047097_451_1479 332
246 3300045049 Ga0466959_0018291 Ga0466959_0018291_1395_2393 332
247 3300045049 Ga0466959_0024584 Ga0466959_0024584_1128_2156 332
248 3300045836 Ga0466958_0088991 Ga0466958_0088991_459_1511 332
249 3300045976 Ga0466967_0030582 Ga0466967_0030582_2458_3510 332
250 3300046453 Ga0495627_003174 Ga0495627_003174_6345_7343 332
251 3300046458 Ga0495591_000131 Ga0495591_000131_52191_53189 332
252 3300046458 Ga0495591_001248 Ga0495591_001248_6597_7595 332
253 3300046458 Ga0495591_007866 Ga0495591_007866_63_1061 332
254 3300046458 Ga0495591_007991 Ga0495591_007991_2781_3779 332
255 3300046471 Ga0495650_0003554 Ga0495650_0003554_8423_9421 332
256 3300046474 Ga0495605_0000132 Ga0495605_0000132_92181_93179 332
257 3300046474 Ga0495605_0007127 Ga0495605_0007127_4560_5558 332
258 3300046491 Ga0495584_0013570 Ga0495584_0013570_1181_2179 332
259 3300046492 Ga0495585_0080017 Ga0495585_0080017_71_1069 332
260 3300046500 Ga0495596_0057376 Ga0495596_0057376_84_1082 332
261 3300046501 Ga0495607_0000018 Ga0495607_0000018_143414_144412 332
262 3300046501 Ga0495607_0006946 Ga0495607_0006946_4473_5471 332
263 3300046501 Ga0495607_0010315 Ga0495607_0010315_4693_5691 332
264 3300046501 Ga0495607_0012573 Ga0495607_0012573_796_1794 332
265 3300046506 Ga0495583_0001236 Ga0495583_0001236_16949_17947 332
266 3300046506 Ga0495583_0002032 Ga0495583_0002032_3817_4815 332
267 3300046506 Ga0495583_0002095 Ga0495583_0002095_14958_15956 332
268 3300046506 Ga0495583_0002581 Ga0495583_0002581_6355_7353 332
269 3300046507 Ga0495606_0000176 Ga0495606_0000176_60873_61871 332
270 3300046507 Ga0495606_0001289 Ga0495606_0001289_6600_7598 332
271 3300046512 Ga0495610_0023057 Ga0495610_0023057_1804_2802 332
272 3300046515 Ga0495620_0001338 Ga0495620_0001338_8780_9778 332
273 3300046515 Ga0495620_0009921 Ga0495620_0009921_2237_3235 332
274 3300046518 Ga0495631_0005171 Ga0495631_0005171_488_1486 332
275 3300046519 Ga0495632_0003819 Ga0495632_0003819_3568_4566 332
276 3300046519 Ga0495632_0004270 Ga0495632_0004270_671_1669 332
277 3300046519 Ga0495632_0008634 Ga0495632_0008634_3430_4428 332
278 3300046520 Ga0495637_0000202 Ga0495637_0000202_32891_33889 332
279 3300046520 Ga0495637_0002261 Ga0495637_0002261_7482_8480 332
280 3300046520 Ga0495637_0007350 Ga0495637_0007350_3774_4772 332
281 3300046520 Ga0495637_0015082 Ga0495637_0015082_2523_3521 332
282 3300046522 Ga0495643_0008792 Ga0495643_0008792_1958_2956 332
283 3300046523 Ga0495644_0003896 Ga0495644_0003896_1367_2365 332
284 3300046524 Ga0495648_0002590 Ga0495648_0002590_12105_13103 332
285 3300046524 Ga0495648_0011783 Ga0495648_0011783_4162_5160 332
286 3300046524 Ga0495648_0173918 Ga0495648_0173918_25_1023 332
287 3300046530 Ga0495654_0004292 Ga0495654_0004292_3643_4641 332
288 3300046538 Ga0495609_0000014 Ga0495609_0000014_13563_14561 332
289 3300046538 Ga0495609_0000067 Ga0495609_0000067_4178_5176 332
290 3300046542 Ga0495597_0034289 Ga0495597_0034289_616_1614 332
291 3300046557 Ga0495622_0003196 Ga0495622_0003196_4317_5315 332
292 3300046616 Ga0495668_0006421 Ga0495668_0006421_6404_7402 332
293 3300046648 Ga0495611_0000175 Ga0495611_0000175_36704_37702 332
294 3300046648 Ga0495611_0000950 Ga0495611_0000950_12336_13334 332
295 3300046660 Ga0495625_0000028 Ga0495625_0000028_79750_80748 332
296 3300046665 Ga0495661_0000135 Ga0495661_0000135_73937_74935 332
297 3300046665 Ga0495661_0000191 Ga0495661_0000191_14235_15233 332
298 3300046665 Ga0495661_0007574 Ga0495661_0007574_1111_2109 332
299 3300046691 Ga0495670_0128810 Ga0495670_0128810_224_1222 332
300 3300046810 Ga0495660_0004711 Ga0495660_0004711_1679_2677 332
301 3300046810 Ga0495660_0034018 Ga0495660_0034018_224_1222 332
302 3300047320 Ga0495672_0014127 Ga0495672_0014127_1305_2303 332
303 3300047320 Ga0495672_0038416 Ga0495672_0038416_1343_2341 332
304 3300047321 Ga0495676_0000006 Ga0495676_0000006_80011_81009 332
305 3300047323 Ga0495683_0031868 Ga0495683_0031868_156_1154 332
306 3300047446 Ga0495679_000427 Ga0495679_000427_3761_4759 332
307 3300047469 Ga0495673_0000279 Ga0495673_0000279_20230_21228 332
308 3300047469 Ga0495673_0001663 Ga0495673_0001663_12151_13149 332
309 3300047469 Ga0495673_0003800 Ga0495673_0003800_4088_5086 332
310 3300047469 Ga0495673_0006065 Ga0495673_0006065_3046_4044 332
311 3300047469 Ga0495673_0014424 Ga0495673_0014424_1837_2835 332
312 3300047470 Ga0495681_0000789 Ga0495681_0000789_8416_9414 332
313 3300048091 Ga0495626_0000019 Ga0495626_0000019_44168_45166 332
314 3300048905 Ga0496102_0031092 Ga0496102_0031092_28_1026 332
315 3300048913 Ga0496110_0223772 Ga0496110_0223772_29_1027 332
316 3300048917 Ga0496114_0106860 Ga0496114_0106860_1050_2114 332
317 3300048919 Ga0496116_0162367 Ga0496116_0162367_186_1184 332
318 3300048920 Ga0496117_0035173 Ga0496117_0035173_2670_3668 332
319 3300048924 Ga0496121_0001435 Ga0496121_0001435_34411_35409 332
320 3300048924 Ga0496121_0005397 Ga0496121_0005397_9343_10341 332
321 3300048925 Ga0496122_0000327 Ga0496122_0000327_19153_20151 332
322 3300048925 Ga0496122_0062147 Ga0496122_0062147_1635_2633 332
323 3300048926 Ga0496123_0000115 Ga0496123_0000115_121592_122590 332
324 3300048927 Ga0496124_0001309 Ga0496124_0001309_13249_14247 332
325 3300048927 Ga0496124_0012416 Ga0496124_0012416_6212_7210 332
326 3300048927 Ga0496124_0036395 Ga0496124_0036395_1226_2224 332
327 3300049459 Ga0495678_000072 Ga0495678_000072_91157_92155 332
328 3300049460 Ga0495682_0000361 Ga0495682_0000361_18369_19367 332
329 3300049578 Ga0501042_0075319 Ga0501042_0075319_474_1487 332
330 3300049579 Ga0501043_0176607 Ga0501043_0176607_441_1454 332
331 3300049582 Ga0501048_0235577 Ga0501048_0235577_75_1127 332
332 3300049583 Ga0501067_0026481 Ga0501067_0026481_2032_3108 332
333 3300049586 Ga0501070_0151912 Ga0501070_0151912_717_1766 332
334 3300049588 Ga0501072_0099390 Ga0501072_0099390_699_1712 332
335 3300049741 Ga0501079_0106086 Ga0501079_0106086_1008_2021 332
336 3300049824 Ga0501045_0069329 Ga0501045_0069329_237_1250 332
337 3300050490 nmdc:mga03n38_14184_c1 nmdc:mga03n38_14184_c1_1221_2270 332
338 3300050490 nmdc:mga03n38_51157_c1 nmdc:mga03n38_51157_c1_317_1366 332
339 3300050491 nmdc:mga00v17_87229_c1 nmdc:mga00v17_87229_c1_308_1372 332
340 3300050492 nmdc:mga0yw44_104940_c1 nmdc:mga0yw44_104940_c1_26_1090 332
341 3300050492 nmdc:mga0yw44_24640_c1 nmdc:mga0yw44_24640_c1_613_1677 332
342 3300050494 nmdc:mga06z11_17109_c1 nmdc:mga06z11_17109_c1_1203_2252 332
343 3300050494 nmdc:mga06z11_48526_c1 nmdc:mga06z11_48526_c1_465_1529 332
344 3300061719 Ga0466962_0000953 Ga0466962_0000953_4131_5159 332
345 3300061734 Ga0530510_0320828 Ga0530510_0320828_103_1116 332
346 iso_pu_bacteria 2881633906 2881635949 332
347 3300005353 Ga0070669_100013312 Ga0070669_1000133122 333
348 3300005467 Ga0070706_100009173 Ga0070706_1000091732 333
349 3300006914 Ga0075436_100063503 Ga0075436_1000635032 333
350 3300013306 Ga0163162_10197553 Ga0163162_101975532 333
351 3300025923 Ga0207681_10002265 Ga0207681_100022655 333
352 3300025945 Ga0207679_10064878 Ga0207679_100648782 333
353 3300026142 Ga0207698_10197637 Ga0207698_101976372 333
354 3300028380 Ga0268265_10274342 Ga0268265_102743422 333
355 3300028563 Ga0265319_1003747 Ga0265319_10037475 333
356 3300035171 Ga0373946_0087778 Ga0373946_0087778_190_1212 333
357 3300037312 Ga0395899_0113235 Ga0395899_0113235_589_1596 333
358 3300037466 Ga0395898_0020177 Ga0395898_0020177_2711_3718 333
359 3300037466 Ga0395898_0135539 Ga0395898_0135539_1219_2226 333
360 3300037466 Ga0395898_0433287 Ga0395898_0433287_145_1161 333
361 3300037471 Ga0395905_0137251 Ga0395905_0137251_1122_2129 333
362 3300038443 Ga0395901_0076627 Ga0395901_0076627_236_1243 333
363 3300047315 Ga0495581_0152949 Ga0495581_0152949_166_1188 333
364 3300048903 Ga0496100_0016405 Ga0496100_0016405_313_1380 333
365 3300048911 Ga0496108_0166730 Ga0496108_0166730_117_1130 333
366 3300048914 Ga0496111_0055626 Ga0496111_0055626_906_1919 333
367 3300049578 Ga0501042_0165363 Ga0501042_0165363_488_1507 333
368 3300049582 Ga0501048_0050950 Ga0501048_0050950_1558_2577 333
369 3300049583 Ga0501067_0007004 Ga0501067_0007004_2687_3715 333
370 3300049584 Ga0501068_0001431 Ga0501068_0001431_2385_3410 333
371 3300049584 Ga0501068_0107666 Ga0501068_0107666_537_1565 333
372 3300049587 Ga0501071_0153466 Ga0501071_0153466_633_1652 333
373 3300049593 Ga0501077_0093613 Ga0501077_0093613_538_1566 333
374 3300049824 Ga0501045_0030078 Ga0501045_0030078_494_1513 333
375 3300049824 Ga0501045_0122109 Ga0501045_0122109_132_1160 333
376 3300061734 Ga0530510_0129340 Ga0530510_0129340_774_1793 333
377 3300005288 Ga0065714_10067211 Ga0065714_100672113 334
378 3300005289 Ga0065704_10009956 Ga0065704_100099562 334
379 3300005353 Ga0070669_100063270 Ga0070669_1000632702 334
380 3300005457 Ga0070662_100001139 Ga0070662_1000011394 334
381 3300005834 Ga0068851_10000338 Ga0068851_100003388 334
382 3300009011 Ga0105251_10000292 Ga0105251_100002925 334
383 3300009011 Ga0105251_10000966 Ga0105251_1000096624 334
384 3300009011 Ga0105251_10009223 Ga0105251_100092235 334
385 3300009036 Ga0105244_10004704 Ga0105244_100047044 334
386 3300009092 Ga0105250_10000088 Ga0105250_1000008839 334
387 3300011119 Ga0105246_10000279 Ga0105246_100002797 334
388 3300013100 Ga0157373_10074764 Ga0157373_100747642 334
389 3300013105 Ga0157369_10004166 Ga0157369_100041662 334
390 3300013308 Ga0157375_10000050 Ga0157375_10000050103 334
391 3300014497 Ga0182008_10000598 Ga0182008_1000059812 334
392 3300025321 Ga0207656_10000156 Ga0207656_1000015611 334
393 3300025711 Ga0207696_1000091 Ga0207696_1000091119 334
394 3300025728 Ga0207655_1006408 Ga0207655_10064082 334
395 3300025735 Ga0207713_1000345 Ga0207713_10003455 334
396 3300025735 Ga0207713_1000569 Ga0207713_100056912 334
397 3300025735 Ga0207713_1004863 Ga0207713_10048635 334
398 3300025923 Ga0207681_10003449 Ga0207681_100034498 334
399 3300025933 Ga0207706_10000935 Ga0207706_1000093516 334
400 3300028786 Ga0307517_10074635 Ga0307517_100746352 334
401 3300031507 Ga0307509_10171525 Ga0307509_101715252 334
402 3300031731 Ga0307405_10000958 Ga0307405_1000095813 334
403 3300042131 Ga0450894_002934 Ga0450894_002934_362_1366 334
404 3300042134 Ga0450898_000679 Ga0450898_000679_2694_3698 334
405 3300042135 Ga0450899_003176 Ga0450899_003176_61_1065 334
406 3300046501 Ga0495607_0098817 Ga0495607_0098817_257_1261 334
407 3300046506 Ga0495583_0000651 Ga0495583_0000651_14101_15105 334
408 3300046507 Ga0495606_0000794 Ga0495606_0000794_33529_34533 334
409 3300046507 Ga0495606_0010536 Ga0495606_0010536_728_1732 334
410 3300046512 Ga0495610_0000940 Ga0495610_0000940_18587_19591 334
411 3300046512 Ga0495610_0006348 Ga0495610_0006348_5674_6678 334
412 3300046518 Ga0495631_0008440 Ga0495631_0008440_2582_3586 334
413 3300046524 Ga0495648_0007696 Ga0495648_0007696_6604_7608 334
414 3300046530 Ga0495654_0000119 Ga0495654_0000119_47705_48709 334
415 3300046530 Ga0495654_0003370 Ga0495654_0003370_1934_2938 334
416 3300046530 Ga0495654_0064581 Ga0495654_0064581_668_1672 334
417 3300046558 Ga0495633_0070886 Ga0495633_0070886_216_1220 334
418 3300046648 Ga0495611_0007803 Ga0495611_0007803_293_1297 334
419 3300046665 Ga0495661_0000698 Ga0495661_0000698_25452_26456 334
420 3300046692 Ga0495671_0026715 Ga0495671_0026715_301_1305 334
421 3300046794 Ga0495589_0000377 Ga0495589_0000377_1682_2686 334
422 3300046794 Ga0495589_0007570 Ga0495589_0007570_261_1265 334
423 3300047320 Ga0495672_0000177 Ga0495672_0000177_71562_72566 334
424 3300047446 Ga0495679_000226 Ga0495679_000226_29625_30629 334
425 3300047446 Ga0495679_001677 Ga0495679_001677_7702_8706 334
426 3300047446 Ga0495679_008977 Ga0495679_008977_2608_3612 334
427 3300047472 Ga0495686_0090797 Ga0495686_0090797_125_1129 334
428 3300048920 Ga0496117_0007078 Ga0496117_0007078_3641_4651 334
429 3300048921 Ga0496118_0049679 Ga0496118_0049679_1586_2590 334
430 3300048922 Ga0496119_0006413 Ga0496119_0006413_6070_7080 334
431 3300048922 Ga0496119_0019177 Ga0496119_0019177_508_1512 334
432 3300048923 Ga0496120_0004700 Ga0496120_0004700_3674_4684 334
433 3300048924 Ga0496121_0017703 Ga0496121_0017703_487_1491 334
434 3300048925 Ga0496122_0005708 Ga0496122_0005708_8652_9656 334
435 3300048925 Ga0496122_0030429 Ga0496122_0030429_2966_3970 334
436 3300048925 Ga0496122_0047190 Ga0496122_0047190_1298_2302 334
437 3300048926 Ga0496123_0001974 Ga0496123_0001974_12539_13543 334
438 3300048926 Ga0496123_0009858 Ga0496123_0009858_2006_3010 334
439 3300048926 Ga0496123_0034362 Ga0496123_0034362_1304_2308 334
440 3300048927 Ga0496124_0144479 Ga0496124_0144479_273_1277 334
441 3300048928 Ga0496125_0000245 Ga0496125_0000245_29403_30407 334
442 3300048928 Ga0496125_0001265 Ga0496125_0001265_24126_25130 334
443 3300048928 Ga0496125_0004266 Ga0496125_0004266_3669_4679 334
444 3300048928 Ga0496125_0024665 Ga0496125_0024665_3336_4340 334
445 3300048929 Ga0496126_0015283 Ga0496126_0015283_5420_6424 334
446 3300049459 Ga0495678_051076 Ga0495678_051076_114_1118 334
447 3300053161 Ga0500634_0000568 Ga0500634_0000568_4240_5244 334
448 3300001979 JGI24740J21852_10048922 JGI24740J21852_100489221 335
449 3300002737 JGI25162J39368_1000350 JGI25162J39368_100035031 335
450 3300002741 JGI25157J39369_1000053 JGI25157J39369_100005377 335
451 3300003214 JGI25165J46597_1000474 JGI25165J46597_100047431 335
452 3300003215 JGI25153J46596_10000756 JGI25153J46596_100007566 335
453 3300003790 Ga0055528_1015533 Ga0055528_10155332 335
454 3300003792 Ga0055540_1000384 Ga0055540_100038433 335
455 3300003856 Ga0058692_1002224 Ga0058692_10022243 335
456 3300006038 Ga0075365_10054216 Ga0075365_100542162 335
457 3300006048 Ga0075363_100127046 Ga0075363_1001270462 335
458 3300006178 Ga0075367_10020180 Ga0075367_100201802 335
459 3300006353 Ga0075370_10009764 Ga0075370_100097644 335
460 3300013297 Ga0157378_10060106 Ga0157378_100601062 335
461 3300025233 Ga0209437_100400 Ga0209437_10040015 335
462 3300025250 Ga0209026_1000002 Ga0209026_1000002910 335
463 3300025256 Ga0209759_1000179 Ga0209759_100017992 335
464 3300025261 Ga0209233_1000037 Ga0209233_100003712 335
465 3300025273 Ga0209673_1002071 Ga0209673_10020718 335
466 3300025297 Ga0209758_1000793 Ga0209758_100079334 335
467 3300025297 Ga0209758_1001268 Ga0209758_100126818 335
468 3300025303 Ga0209051_1000166 Ga0209051_100016685 335
469 3300027512 Ga0209179_1022367 Ga0209179_10223672 335
470 3300031456 Ga0307513_10008207 Ga0307513_100082075 335
471 3300031507 Ga0307509_10001769 Ga0307509_100017698 335
472 3300031616 Ga0307508_10000430 Ga0307508_1000043035 335
473 3300033180 Ga0307510_10097814 Ga0307510_100978142 335
474 3300033180 Ga0307510_10123800 Ga0307510_101238002 335
475 3300046460 Ga0495638_0003711 Ga0495638_0003711_2731_3822 335
476 3300046471 Ga0495650_0039589 Ga0495650_0039589_631_1638 335
477 3300046524 Ga0495648_0080261 Ga0495648_0080261_409_1416 335
478 3300046660 Ga0495625_0125373 Ga0495625_0125373_415_1422 335
479 3300053125 Ga0500618_000475 Ga0500618_000475_14603_15610 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

30

148

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

156

278

0.95

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

160

359

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3euw-assembly1.cif.gz_B crystal structure of a myo-inositol dehydrogenase from corynebacterium glutamicum atcc 13032 0.9639 1 331
3ezy-assembly1.cif.gz_B crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9623 2 335
4hkt-assembly1.cif.gz_D crystal structure of a putative myo-inositol dehydrogenase from sinorhizobium meliloti 1021 (target psi-012312) 0.9611 1 331
3ezy-assembly1.cif.gz_C crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9595 2 333
3ezy-assembly1.cif.gz_B crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9594 2 335
ID Description Score Start End Superfamily
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9626 1 119 3.40.50.720
3euwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 1 113 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9547 1 119 3.40.50.720
3ezyC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9535 121 333 3.30.360.10
3euwD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9419 121 331 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A534B6X1-F1-model_v4 Inositol 2-dehydrogenase 0.9727 1 141 GO:0000166
GO:0005737
GO:0006740
GO:0016491
AF-A0A1X6P8B4-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9678 1 335 GO:0000166
GO:0016491
AF-A0A6I2WRQ7-F1-model_v4 deleted 0.9642 2 185
AF-A0A7C3ZRM2-F1-model_v4 Inositol 2-dehydrogenase (EC 1.1.1.18) 0.9636 1 330 GO:0000166
GO:0050112
AF-A0A1X6P8B4-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9622 1 335 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.01 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map