F452044

General Info

Members Datasets Scaffolds Average Seq Length
479 282 958 104

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10084492|Ga0157369_100844922
Length 120
Sequence LWYPIVLPLPFQEQEAVFAIIQSGGRQVKVTPGAVVEVDRIDAKAGDEVSIDRVLFLEKDGGEVLAGAPFVANVKILGVVDGESRGPKIRIFKKKRRKGMRNTKGHRATYTRVRVTDIQI

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
184 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
185 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
186 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
187 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
188 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
216 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
217 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
218 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
219 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
237 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
238 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
239 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
246 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
247 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
248 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.62
Metatranscriptomes 4.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.78
Nodule 0
Rhizoplane 2.92
Rhizosphere 82.05
Stem 0
Stem Tuber 0
Unclassified 13.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10084492 3300013105 Bacteria 3393
2 JGI24034J26672_10107955 3300002239 Unclassified 530
3 Ga0058863_10064820 3300004799 Bacteria 2670
4 Ga0058861_11851634 3300004800 Bacteria 2189
5 Ga0058860_12004808 3300004801 Bacteria 745
6 Ga0058862_10102061 3300004803 Bacteria 2412
7 Ga0065714_10196442 3300005288 Unclassified 910
8 Ga0065714_10348752 3300005288 Unclassified 637
9 Ga0065712_10072381 3300005290 Bacteria 4776
10 Ga0065712_10095126 3300005290 Bacteria 2230
11 Ga0065712_10128776 3300005290 Unclassified 1575
12 Ga0065712_10452822 3300005290 Bacteria 684
13 Ga0065715_10026664 3300005293 Bacteria 1989
14 Ga0065715_10029117 3300005293 Bacteria 1502
15 Ga0065715_10455938 3300005293 Bacteria 821
16 Ga0065715_10848151 3300005293 Bacteria 592
17 Ga0065707_10212412 3300005295 Bacteria 1259
18 Ga0065707_11007504 3300005295 Bacteria 537
19 Ga0070658_10842020 3300005327 Bacteria 797
20 Ga0070658_11922348 3300005327 Bacteria 511
21 Ga0070676_10249190 3300005328 Bacteria 1184
22 Ga0070676_10806306 3300005328 Bacteria 693
23 Ga0070683_100002445 3300005329 Bacteria 14778
24 Ga0070670_100008907 3300005331 Bacteria 8568
25 Ga0070670_100112454 3300005331 Bacteria 2347
26 Ga0070670_100329688 3300005331 Bacteria 1338
27 Ga0070670_100437503 3300005331 Bacteria 1158
28 Ga0070670_101393203 3300005331 Bacteria 643
29 Ga0070677_10078202 3300005333 Bacteria 1409
30 Ga0070677_10466825 3300005333 Bacteria 678
31 Ga0068869_100674028 3300005334 Bacteria 880
32 Ga0070680_100082734 3300005336 Bacteria 2650
33 Ga0070680_100947456 3300005336 Bacteria 743
34 Ga0068868_100888015 3300005338 Bacteria 809
35 Ga0070689_100052629 3300005340 Bacteria 3149
36 Ga0070661_100054947 3300005344 Bacteria 2916
37 Ga0070661_100559556 3300005344 Bacteria 921
38 Ga0070668_100129937 3300005347 Bacteria 2021
39 Ga0070668_100409998 3300005347 Bacteria 1158
40 Ga0070675_100092189 3300005354 Bacteria 2539
41 Ga0070675_100203121 3300005354 Bacteria 1720
42 Ga0070675_100330671 3300005354 Unclassified 1348
43 Ga0070675_101428662 3300005354 Bacteria 638
44 Ga0070671_100018164 3300005355 Bacteria 5710
45 Ga0070671_100189515 3300005355 Bacteria 1743
46 Ga0070674_101039756 3300005356 Bacteria 720
47 Ga0070673_100152284 3300005364 Bacteria 1959
48 Ga0070673_100330322 3300005364 Bacteria 1349
49 Ga0070673_101719803 3300005364 Bacteria 594
50 Ga0070688_100967590 3300005365 Bacteria 675
51 Ga0070659_100299932 3300005366 Bacteria 1340
52 Ga0070659_100649752 3300005366 Bacteria 909
53 Ga0070667_100041505 3300005367 Bacteria 3860
54 Ga0070667_100479917 3300005367 Bacteria 1138
55 Ga0070667_101649249 3300005367 Unclassified 603
56 Ga0070703_10154243 3300005406 Bacteria 865
57 Ga0070711_100971061 3300005439 Bacteria 728
58 Ga0070700_100496536 3300005441 Bacteria 938
59 Ga0070700_100657926 3300005441 Bacteria 828
60 Ga0070694_100100680 3300005444 Bacteria 2044
61 Ga0070663_100418708 3300005455 Bacteria 1098
62 Ga0070663_100574918 3300005455 Bacteria 945
63 Ga0070678_100852092 3300005456 Bacteria 830
64 Ga0070678_101288929 3300005456 Bacteria 679
65 Ga0070678_101986968 3300005456 Bacteria 550
66 Ga0070678_102305593 3300005456 Bacteria 511
67 Ga0070662_100366053 3300005457 Bacteria 1184
68 Ga0070681_10152512 3300005458 Bacteria 2237
69 Ga0068867_100384395 3300005459 Bacteria 1180
70 Ga0068867_100412433 3300005459 Bacteria 1142
71 Ga0070685_10359368 3300005466 Bacteria 998
72 Ga0070706_100335907 3300005467 Unclassified 1409
73 Ga0070707_100928763 3300005468 Unclassified 835
74 Ga0070699_101547905 3300005518 Bacteria 608
75 Ga0070679_100336045 3300005530 Bacteria 1459
76 Ga0070684_100042920 3300005535 Bacteria 3906
77 Ga0070684_100177871 3300005535 Bacteria 1934
78 Ga0070697_101509923 3300005536 Bacteria 600
79 Ga0070672_100301875 3300005543 Bacteria 1357
80 Ga0070686_100124437 3300005544 Bacteria 1774
81 Ga0070686_100312702 3300005544 Bacteria 1169
82 Ga0070695_100182063 3300005545 Unclassified 1490
83 Ga0070695_101255816 3300005545 Unclassified 611
84 Ga0070696_100142859 3300005546 Bacteria 1751
85 Ga0070696_101496505 3300005546 Bacteria 578
86 Ga0070693_100024877 3300005547 Bacteria 3216
87 Ga0070704_100010859 3300005549 Bacteria 5555
88 Ga0070704_100057503 3300005549 Bacteria 2766
89 Ga0070704_101248513 3300005549 Bacteria 679
90 Ga0068855_101697033 3300005563 Bacteria 644
91 Ga0070664_100030086 3300005564 Bacteria 4529
92 Ga0070664_100279278 3300005564 Bacteria 1506
93 Ga0070664_100948146 3300005564 Bacteria 808
94 Ga0070664_102288078 3300005564 Bacteria 513
95 Ga0070664_102366656 3300005564 Bacteria 504
96 Ga0068857_100223343 3300005577 Bacteria 1721
97 Ga0068857_100515843 3300005577 Unclassified 1123
98 Ga0068857_101921100 3300005577 Bacteria 580
99 Ga0068854_100550191 3300005578 Bacteria 979
100 Ga0068854_100755042 3300005578 Bacteria 844
101 Ga0068856_101585650 3300005614 Bacteria 668
102 Ga0070702_100053640 3300005615 Bacteria 2317
103 Ga0070702_101491045 3300005615 Bacteria 556
104 Ga0068852_101795575 3300005616 Bacteria 636
105 Ga0068859_100010453 3300005617 Bacteria 9337
106 Ga0068859_100517050 3300005617 Bacteria 1289
107 Ga0068864_100051110 3300005618 Bacteria 3559
108 Ga0068864_100061419 3300005618 Bacteria 3255
109 Ga0068864_100584009 3300005618 Bacteria 1083
110 Ga0068866_10440454 3300005718 Bacteria 850
111 Ga0068861_100310955 3300005719 Bacteria 1369
112 Ga0068861_101827672 3300005719 Bacteria 603
113 Ga0068851_10997482 3300005834 Unclassified 528
114 Ga0068870_10200949 3300005840 Bacteria 1208
115 Ga0068870_10561822 3300005840 Bacteria 770
116 Ga0068863_100651395 3300005841 Bacteria 1045
117 Ga0068858_101209353 3300005842 Bacteria 743
118 Ga0068860_100416194 3300005843 Bacteria 1332
119 Ga0068862_100279326 3300005844 Bacteria 1530
120 Ga0068862_100407864 3300005844 Unclassified 1272
121 Ga0075365_10139600 3300006038 Bacteria 1682
122 Ga0075365_10157009 3300006038 Bacteria 1584
123 Ga0075368_10013588 3300006042 Bacteria 2992
124 Ga0075368_10043500 3300006042 Bacteria 1770
125 Ga0075368_10166409 3300006042 Bacteria 925
126 Ga0075368_10439029 3300006042 Bacteria 577
127 Ga0075363_100039848 3300006048 Bacteria 2474
128 Ga0075364_10004582 3300006051 Bacteria 7960
129 Ga0075364_10005737 3300006051 Bacteria 7239
130 Ga0075364_10029358 3300006051 Bacteria 3526
131 Ga0075364_10094340 3300006051 Bacteria 1988
132 Ga0075364_10795919 3300006051 Unclassified 644
133 Ga0070716_101711937 3300006173 Bacteria 519
134 Ga0075362_10000489 3300006177 Bacteria 11538
135 Ga0075367_10000798 3300006178 Bacteria 12406
136 Ga0075367_10002068 3300006178 Bacteria 8987
137 Ga0075367_10004668 3300006178 Bacteria 6721
138 Ga0075367_10018729 3300006178 Bacteria 3826
139 Ga0075367_10114443 3300006178 Bacteria 1658
140 Ga0075367_10127349 3300006178 Bacteria 1572
141 Ga0075369_10537626 3300006186 Bacteria 557
142 Ga0075366_10026602 3300006195 Bacteria 3389
143 Ga0075366_10084435 3300006195 Bacteria 1898
144 Ga0075366_10203117 3300006195 Bacteria 1205
145 Ga0075366_10214387 3300006195 Unclassified 1172
146 Ga0075366_10339166 3300006195 Bacteria 921
147 Ga0097621_101046311 3300006237 Bacteria 765
148 Ga0075370_10002038 3300006353 Bacteria 9171
149 Ga0075370_10003265 3300006353 Bacteria 7686
150 Ga0068871_100745201 3300006358 Bacteria 900
151 Ga0075428_100009413 3300006844 Bacteria 10839
152 Ga0075428_100010179 3300006844 Bacteria 10442
153 Ga0075428_100017106 3300006844 Bacteria 8010
154 Ga0075430_100012219 3300006846 Bacteria 7311
155 Ga0075430_100043419 3300006846 Bacteria 3799
156 Ga0075431_100008733 3300006847 Bacteria 10151
157 Ga0075431_100019271 3300006847 Bacteria 6954
158 Ga0075433_10005701 3300006852 Bacteria 9791
159 Ga0075433_10008001 3300006852 Bacteria 8415
160 Ga0075433_10045537 3300006852 Bacteria 3814
161 Ga0075434_100007229 3300006871 Bacteria 10276
162 Ga0075434_102523840 3300006871 Bacteria 515
163 Ga0075429_100026645 3300006880 Bacteria 5020
164 Ga0075429_100112134 3300006880 Bacteria 2383
165 Ga0075429_100279189 3300006880 Bacteria 1463
166 Ga0075429_101058597 3300006880 Bacteria 709
167 Ga0097620_100010455 3300006931 Bacteria 9337
168 Ga0097620_100517068 3300006931 Bacteria 1289
169 Ga0075435_101941047 3300007076 Bacteria 517
170 Ga0105240_10065113 3300009093 Bacteria 4525
171 Ga0105240_10443682 3300009093 Bacteria 1454
172 Ga0111539_10023936 3300009094 Bacteria 7503
173 Ga0111539_10130015 3300009094 Bacteria 2949
174 Ga0111539_10248249 3300009094 Bacteria 2072
175 Ga0111539_11426064 3300009094 Bacteria 803
176 Ga0111539_11559965 3300009094 Bacteria 766
177 Ga0105245_11013737 3300009098 Bacteria 875
178 Ga0105245_12540498 3300009098 Unclassified 565
179 Ga0114129_10000288 3300009147 Bacteria 58119
180 Ga0114129_10011087 3300009147 Bacteria 12841
181 Ga0114129_10016501 3300009147 Bacteria 10516
182 Ga0114129_10020431 3300009147 Bacteria 9417
183 Ga0114129_10038076 3300009147 Bacteria 6785
184 Ga0114129_11270643 3300009147 Bacteria 914
185 Ga0105243_10185955 3300009148 Bacteria 1811
186 Ga0105243_10420441 3300009148 Bacteria 1246
187 Ga0105243_10767571 3300009148 Bacteria 947
188 Ga0105248_10112356 3300009177 Bacteria 3072
189 Ga0105248_10180866 3300009177 Bacteria 2376
190 Ga0105248_10829585 3300009177 Bacteria 1043
191 Ga0105248_11168156 3300009177 Bacteria 870
192 Ga0105238_10343650 3300009551 Bacteria 1481
193 Ga0105238_12903970 3300009551 Bacteria 515
194 Ga0105249_10302217 3300009553 Bacteria 1605
195 Ga0105249_10755278 3300009553 Bacteria 1035
196 Ga0105249_10810590 3300009553 Bacteria 1000
197 Ga0105246_10116601 3300011119 Bacteria 1972
198 Ga0157370_10120831 3300013104 Bacteria 2446
199 Ga0157378_10224108 3300013297 Bacteria 1788
200 Ga0157375_10381944 3300013308 Bacteria 1575
201 Ga0163163_10974898 3300014325 Bacteria 911
202 Ga0157380_10154005 3300014326 Bacteria 1990
203 Ga0157380_10419391 3300014326 Bacteria 1276
204 Ga0157380_10574279 3300014326 Bacteria 1111
205 Ga0157380_11272119 3300014326 Bacteria 782
206 Ga0157380_11912188 3300014326 Bacteria 654
207 Ga0157377_10122918 3300014745 Bacteria 1575
208 Ga0157376_11170625 3300014969 Unclassified 796
209 Ga0163161_10136938 3300017792 Bacteria 1852
210 Ga0206356_10466454 3300020070 Bacteria 732
211 Ga0206353_10702851 3300020082 Bacteria 757
212 Ga0154015_1013679 3300020610 Bacteria 1141
213 Ga0207697_10275325 3300025315 Bacteria 746
214 Ga0207656_10732492 3300025321 Unclassified 507
215 Ga0207653_10285253 3300025885 Bacteria 638
216 Ga0207682_10042770 3300025893 Bacteria 1852
217 Ga0207688_10108737 3300025901 Bacteria 1608
218 Ga0207647_10681671 3300025904 Unclassified 562
219 Ga0207645_10101369 3300025907 Bacteria 1858
220 Ga0207643_10064402 3300025908 Bacteria 2098
221 Ga0207643_10243293 3300025908 Bacteria 1107
222 Ga0207684_10228505 3300025910 Bacteria 1605
223 Ga0207684_11008308 3300025910 Bacteria 696
224 Ga0207707_10972702 3300025912 Bacteria 698
225 Ga0207695_10266037 3300025913 Bacteria 1611
226 Ga0207695_10902076 3300025913 Bacteria 763
227 Ga0207660_10829744 3300025917 Bacteria 754
228 Ga0207657_10265889 3300025919 Bacteria 1364
229 Ga0207649_10169893 3300025920 Bacteria 1518
230 Ga0207652_10483360 3300025921 Bacteria 1115
231 Ga0207646_10297375 3300025922 Bacteria 1458
232 Ga0207681_10448095 3300025923 Bacteria 1050
233 Ga0207681_10560944 3300025923 Bacteria 941
234 Ga0207694_10418667 3300025924 Bacteria 1116
235 Ga0207650_10033880 3300025925 Bacteria 3702
236 Ga0207650_10138953 3300025925 Bacteria 1908
237 Ga0207650_11099636 3300025925 Bacteria 676
238 Ga0207659_10022618 3300025926 Bacteria 4186
239 Ga0207659_10249108 3300025926 Bacteria 1441
240 Ga0207659_10679510 3300025926 Unclassified 881
241 Ga0207687_11300058 3300025927 Bacteria 625
242 Ga0207644_10064072 3300025931 Bacteria 2670
243 Ga0207644_11428254 3300025931 Bacteria 581
244 Ga0207690_10405289 3300025932 Bacteria 1088
245 Ga0207690_10544766 3300025932 Bacteria 943
246 Ga0207690_11700616 3300025932 Bacteria 527
247 Ga0207706_10224906 3300025933 Bacteria 1643
248 Ga0207709_10187083 3300025935 Bacteria 1467
249 Ga0207669_10531935 3300025937 Bacteria 945
250 Ga0207704_11336873 3300025938 Unclassified 613
251 Ga0207665_10667401 3300025939 Bacteria 816
252 Ga0207691_10024424 3300025940 Bacteria 5684
253 Ga0207711_10206289 3300025941 Bacteria 1795
254 Ga0207711_10344055 3300025941 Bacteria 1380
255 Ga0207689_10174187 3300025942 Unclassified 1774
256 Ga0207689_10513546 3300025942 Bacteria 1004
257 Ga0207689_10522946 3300025942 Bacteria 995
258 Ga0207661_10001481 3300025944 Bacteria 15878
259 Ga0207679_10005395 3300025945 Bacteria 8009
260 Ga0207679_10692770 3300025945 Bacteria 924
261 Ga0207679_11254356 3300025945 Bacteria 680
262 Ga0207679_11390251 3300025945 Bacteria 644
263 Ga0207667_10106183 3300025949 Bacteria 2897
264 Ga0207667_10970013 3300025949 Bacteria 839
265 Ga0207667_11166466 3300025949 Bacteria 751
266 Ga0207651_10336836 3300025960 Bacteria 1266
267 Ga0207651_10505417 3300025960 Bacteria 1045
268 Ga0207712_10078428 3300025961 Bacteria 2397
269 Ga0207712_10435093 3300025961 Bacteria 1109
270 Ga0207668_10019475 3300025972 Bacteria 4292
271 Ga0207640_11563900 3300025981 Bacteria 594
272 Ga0207658_11211615 3300025986 Bacteria 690
273 Ga0207677_10957929 3300026023 Bacteria 774
274 Ga0207703_12320313 3300026035 Unclassified 512
275 Ga0207639_10813442 3300026041 Bacteria 871
276 Ga0207678_10704482 3300026067 Unclassified 889
277 Ga0207708_10180160 3300026075 Bacteria 1677
278 Ga0207708_10583121 3300026075 Bacteria 946
279 Ga0207702_11218609 3300026078 Bacteria 747
280 Ga0207641_10309662 3300026088 Bacteria 1494
281 Ga0207641_10599740 3300026088 Unclassified 1078
282 Ga0207676_10107894 3300026095 Unclassified 2323
283 Ga0207674_10421689 3300026116 Bacteria 1289
284 Ga0207675_100036985 3300026118 Bacteria 4554
285 Ga0207675_101258610 3300026118 Bacteria 760
286 Ga0207683_10068044 3300026121 Bacteria 3142
287 Ga0207698_11282138 3300026142 Bacteria 747
288 Ga0209813_10029350 3300027866 Bacteria 1610
289 Ga0209813_10083688 3300027866 Unclassified 1059
290 Ga0209813_10110085 3300027866 Unclassified 948
291 Ga0209813_10205088 3300027866 Bacteria 732
292 Ga0207428_10001421 3300027907 Bacteria 25181
293 Ga0207428_11240789 3300027907 Bacteria 518
294 Ga0268265_10718592 3300028380 Unclassified 967
295 Ga0268265_11348655 3300028380 Bacteria 714
296 Ga0268264_12352119 3300028381 Unclassified 539
297 Ga0307408_100159303 3300031548 Bacteria 1791
298 Ga0307408_100169225 3300031548 Bacteria 1743
299 Ga0307408_100222812 3300031548 Unclassified 1540
300 Ga0307408_100287167 3300031548 Bacteria 1372
301 Ga0307408_100793572 3300031548 Unclassified 859
302 Ga0307405_10024544 3300031731 Bacteria 3446
303 Ga0307405_10026523 3300031731 Bacteria 3344
304 Ga0307413_10224557 3300031824 Unclassified 1374
305 Ga0307413_11193761 3300031824 Bacteria 661
306 Ga0307410_10418960 3300031852 Bacteria 1086
307 Ga0307410_11581357 3300031852 Unclassified 579
308 Ga0307406_10071179 3300031901 Bacteria 2279
309 Ga0307406_11134680 3300031901 Bacteria 676
310 Ga0307412_10158984 3300031911 Bacteria 1676
311 Ga0307412_10588492 3300031911 Unclassified 940
312 Ga0307409_100064777 3300031995 Bacteria 2873
313 Ga0307416_100029631 3300032002 Bacteria 4092
314 Ga0307416_100136120 3300032002 Bacteria 2222
315 Ga0307416_100242692 3300032002 Unclassified 1747
316 Ga0307416_101576383 3300032002 Bacteria 762
317 Ga0307414_10751473 3300032004 Unclassified 886
318 Ga0307411_11311577 3300032005 Bacteria 660
319 Ga0307415_100139869 3300032126 Bacteria 1847
320 Ga0373926_0008201 3300035083 Bacteria 3477
321 Ga0373936_0327902 3300035113 Bacteria 694
322 Ga0373935_0207406 3300035692 Bacteria 1357
323 Ga0373935_0458537 3300035692 Bacteria 921
324 Ga0373947_0188262 3300035725 Bacteria 1346
325 Ga0373937_1236099 3300036401 Bacteria 695
326 Ga0373925_0121645 3300037068 Unclassified 2026
327 Ga0373925_0198555 3300037068 Bacteria 1594
328 Ga0395898_1332689 3300037466 Bacteria 647
329 Ga0395901_0387891 3300038443 Bacteria 1437
330 Ga0436365_0693531 3300039437 Bacteria 1789
331 Ga0439453_0160800 3300041408 Unclassified 538
332 Ga0451789_1019162 3300041443 Bacteria 523
333 Ga0451791_0710523 3300041451 Bacteria 1068
334 Ga0451797_1499161 3300041453 Unclassified 649
335 Ga0451798_0246949 3300041458 Bacteria 1048
336 Ga0451798_0594751 3300041458 Unclassified 859
337 Ga0451800_1564513 3300041459 Bacteria 1264
338 Ga0451802_1065277 3300041460 Bacteria 992
339 Ga0451807_1718721 3300041486 Bacteria 918
340 Ga0451807_2155549 3300041486 Bacteria 711
341 Ga0451837_0987234 3300041494 Bacteria 702
342 Ga0451853_1492214 3300041512 Bacteria 2247
343 Ga0451853_2280574 3300041512 Bacteria 963
344 Ga0451853_3264069 3300041512 Bacteria 914
345 Ga0439462_0211140 3300042015 Unclassified 554
346 Ga0450919_035589 3300042121 Bacteria 575
347 Ga0450898_152682 3300042134 Bacteria 506
348 Ga0439446_0041487 3300042156 Bacteria 1357
349 Ga0439446_0136393 3300042156 Bacteria 799
350 Ga0439446_0378882 3300042156 Bacteria 508
351 Ga0439435_0034819 3300042436 Bacteria 1386
352 Ga0439460_0165736 3300042461 Bacteria 742
353 Ga0466957_0853597 3300044842 Bacteria 649
354 Ga0466967_0660229 3300045976 Bacteria 1034
355 Ga0495582_0736529 3300046473 Unclassified 570
356 Ga0495633_0214974 3300046558 Unclassified 881
357 Ga0495667_0011613 3300046559 Bacteria 5965
358 Ga0495634_0510252 3300046642 Bacteria 704
359 Ga0495635_0477375 3300046663 Bacteria 822
360 Ga0495657_0873698 3300046675 Bacteria 512
361 Ga0495600_0339055 3300046809 Bacteria 943
362 Ga0496107_0743187 3300048910 Bacteria 720
363 Ga0496108_0545941 3300048911 Bacteria 1011
364 Ga0496109_1107014 3300048912 Bacteria 729
365 Ga0496109_1336722 3300048912 Bacteria 652
366 Ga0496112_0805736 3300048915 Bacteria 864
367 Ga0501308_045289 3300049128 Bacteria 630
368 Ga0501309_055372 3300049129 Bacteria 630
369 Ga0501305_072347 3300049161 Unclassified 608
370 Ga0501296_042836 3300049519 Unclassified 643
371 Ga0501297_045887 3300049520 Bacteria 629
372 Ga0501299_124744 3300049522 Unclassified 624
373 Ga0501300_034525 3300049523 Bacteria 752
374 Ga0501312_043368 3300049528 Bacteria 741
375 Ga0501313_072793 3300049529 Bacteria 500
376 Ga0501317_069325 3300049533 Unclassified 592
377 Ga0501033_1194777 3300049570 Bacteria 504
378 Ga0501034_0010134 3300049571 Bacteria 9832
379 Ga0501036_0074517 3300049572 Bacteria 2871
380 Ga0501036_0609903 3300049572 Bacteria 905
381 Ga0501036_0748189 3300049572 Bacteria 806
382 Ga0501036_0833258 3300049572 Bacteria 759
383 Ga0501040_0055007 3300049576 Bacteria 2729
384 Ga0501041_0306834 3300049577 Bacteria 1000
385 Ga0501042_0662633 3300049578 Bacteria 759
386 Ga0501047_0072847 3300049581 Bacteria 3307
387 Ga0501048_0045903 3300049582 Bacteria 3119
388 Ga0501070_1155979 3300049586 Unclassified 595
389 Ga0501071_0043848 3300049587 Bacteria 3208
390 Ga0501072_0204121 3300049588 Bacteria 1576
391 Ga0501074_0593491 3300049590 Bacteria 783
392 Ga0501075_0025191 3300049591 Bacteria 4371
393 Ga0501076_0015504 3300049592 Bacteria 5762
394 Ga0501202_058478 3300049652 Bacteria 867
395 Ga0501216_062665 3300049660 Unclassified 753
396 Ga0501217_009331 3300049661 Unclassified 2133
397 Ga0501233_289358 3300049668 Unclassified 503
398 Ga0501235_039082 3300049669 Bacteria 1083
399 Ga0501221_015663 3300049704 Bacteria 1425
400 Ga0501225_0063830 3300049705 Unclassified 1039
401 Ga0501080_0116878 3300049742 Bacteria 2472
402 Ga0501080_0241767 3300049742 Unclassified 1648
403 Ga0501081_0056415 3300049743 Bacteria 2715
404 Ga0501241_135720 3300049758 Unclassified 557
405 Ga0501265_039302 3300049762 Bacteria 710
406 Ga0501271_038225 3300049768 Unclassified 617
407 Ga0501283_015939 3300049779 Bacteria 1161
408 Ga0501035_0258271 3300049822 Bacteria 1477
409 Ga0501045_0035210 3300049824 Bacteria 3634
410 nmdc:mga03683_3561_c1 3300050489 Bacteria 5046
411 nmdc:mga03n38_158934_c1 3300050490 Bacteria 1143
412 nmdc:mga03n38_21287_c1 3300050490 Bacteria 2607
413 nmdc:mga00v17_1024715_c1 3300050491 Unclassified 519
414 nmdc:mga00v17_104763_c1 3300050491 Bacteria 1789
415 nmdc:mga00v17_117472_c1 3300050491 Bacteria 1692
416 nmdc:mga00v17_123438_c1 3300050491 Bacteria 1651
417 nmdc:mga00v17_3738_c2 3300050491 Bacteria 4454
418 nmdc:mga00v17_712955_c1 3300050491 Unclassified 643
419 nmdc:mga0yw44_316113_c1 3300050492 Bacteria 1048
420 nmdc:mga0yw44_3469_c1 3300050492 Bacteria 7005
421 nmdc:mga0yw44_435621_c1 3300050492 Bacteria 888
422 nmdc:mga0k408_134485_c1 3300050493 Bacteria 1469
423 nmdc:mga0k408_281998_c1 3300050493 Unclassified 992
424 nmdc:mga0k408_50030_c1 3300050493 Bacteria 2419
425 nmdc:mga0k408_830468_c1 3300050493 Bacteria 538
426 nmdc:mga0k408_9176_c1 3300050493 Bacteria 5331
427 nmdc:mga0k408_95159_c1 3300050493 Bacteria 1752
428 nmdc:mga06z11_15480_c1 3300050494 Bacteria 3406
429 nmdc:mga06z11_285355_c1 3300050494 Unclassified 979
430 nmdc:mga06z11_29375_c1 3300050494 Bacteria 2648
431 nmdc:mga06z11_32521_c1 3300050494 Bacteria 2545
432 nmdc:mga06z11_439445_c1 3300050494 Bacteria 788
433 nmdc:mga04h51_12974_c1 3300050495 Bacteria 2351
434 nmdc:mga04h51_25720_c1 3300050495 Bacteria 1814
435 nmdc:mga04h51_363244_c1 3300050495 Unclassified 601
436 nmdc:mga04h51_70534_c1 3300050495 Unclassified 1219
437 nmdc:mga07m45_24731_c1 3300050496 Bacteria 3292
438 nmdc:mga07m45_63000_c1 3300050496 Bacteria 2103
439 nmdc:mga05p37_10687_c1 3300050507 Bacteria 10895
440 nmdc:mga05p37_1171_c1 3300050507 Bacteria 30211
441 nmdc:mga05p37_218512_c1 3300050507 Bacteria 2301
442 nmdc:mga05p37_508351_c1 3300050507 Bacteria 1381
443 nmdc:mga09592_275178_c1 3300050508 Bacteria 1460
444 nmdc:mga09592_31494_c1 3300050508 Bacteria 4420
445 nmdc:mga09592_65027_c1 3300050508 Bacteria 3088
446 nmdc:mga09592_70796_c1 3300050508 Bacteria 2960
447 nmdc:mga0qj67_103406_c1 3300050509 Bacteria 2298
448 nmdc:mga0qj67_269354_c1 3300050509 Bacteria 1381
449 nmdc:mga0qj67_498252_c1 3300050509 Bacteria 979
450 nmdc:mga06r32_19697_c1 3300050510 Bacteria 6199
451 nmdc:mga06r32_209196_c1 3300050510 Bacteria 1939
452 nmdc:mga06r32_21085_c1 3300050510 Bacteria 6012
453 nmdc:mga08y16_106622_c1 3300050511 Bacteria 2917
454 nmdc:mga08y16_550153_c1 3300050511 Bacteria 1168
455 nmdc:mga0n895_89327_c1 3300050512 Bacteria 3082
456 nmdc:mga0a205_166953_c1 3300050515 Bacteria 2097
457 nmdc:mga0a205_232844_c1 3300050515 Bacteria 1725
458 nmdc:mga0a205_9054_c1 3300050515 Bacteria 9080
459 nmdc:mga0sz30_203883_c1 3300050516 Bacteria 878
460 nmdc:mga0sz30_305813_c1 3300050516 Bacteria 709
461 Ga0495619_0308476 3300053085 Bacteria 1096
462 Ga0495619_0525042 3300053085 Bacteria 813
463 Ga0500646_0134633 3300053090 Bacteria 806
464 Ga0500641_0000556 3300053096 Bacteria 13482
465 Ga0500628_002853 3300053129 Bacteria 2840
466 Ga0500568_0003131 3300053139 Bacteria 9435
467 Ga0501084_0199473 3300054114 Bacteria 1688
468 Ga0501084_0737288 3300054114 Bacteria 830
469 Ga0587073_0263062 3300059492 Unclassified 546
470 Ga0587080_065255 3300059503 Bacteria 717
471 Ga0587083_0136718 3300059505 Bacteria 649
472 Ga0587091_174318 3300059511 Unclassified 562
473 Ga0587106_126811 3300059605 Unclassified 547
474 Ga0587101_049868 3300059623 Bacteria 718
475 Ga0587100_003370 3300059648 Bacteria 1092
476 Ga0587071_142447 3300060344 Bacteria 590
477 Ga0501082_1053634 3300060353 Bacteria 711
478 Ga0530510_0260160 3300061734 Bacteria 1294
479 Ga0530510_1119133 3300061734 Bacteria 603
480 Ga0157369_10084492
481 JGI24034J26672_10107955
482 Ga0058863_10064820
483 Ga0058861_11851634
484 Ga0058860_12004808
485 Ga0058862_10102061
486 Ga0065714_10196442
487 Ga0065714_10348752
488 Ga0065712_10072381
489 Ga0065712_10095126
490 Ga0065712_10128776
491 Ga0065712_10452822
492 Ga0065715_10026664
493 Ga0065715_10029117
494 Ga0065715_10455938
495 Ga0065715_10848151
496 Ga0065707_10212412
497 Ga0065707_11007504
498 Ga0070658_10842020
499 Ga0070658_11922348
500 Ga0070676_10249190
501 Ga0070676_10806306
502 Ga0070683_100002445
503 Ga0070670_100008907
504 Ga0070670_100112454
505 Ga0070670_100329688
506 Ga0070670_100437503
507 Ga0070670_101393203
508 Ga0070677_10078202
509 Ga0070677_10466825
510 Ga0068869_100674028
511 Ga0070680_100082734
512 Ga0070680_100947456
513 Ga0068868_100888015
514 Ga0070689_100052629
515 Ga0070661_100054947
516 Ga0070661_100559556
517 Ga0070668_100129937
518 Ga0070668_100409998
519 Ga0070675_100092189
520 Ga0070675_100203121
521 Ga0070675_100330671
522 Ga0070675_101428662
523 Ga0070671_100018164
524 Ga0070671_100189515
525 Ga0070674_101039756
526 Ga0070673_100152284
527 Ga0070673_100330322
528 Ga0070673_101719803
529 Ga0070688_100967590
530 Ga0070659_100299932
531 Ga0070659_100649752
532 Ga0070667_100041505
533 Ga0070667_100479917
534 Ga0070667_101649249
535 Ga0070703_10154243
536 Ga0070711_100971061
537 Ga0070700_100496536
538 Ga0070700_100657926
539 Ga0070694_100100680
540 Ga0070663_100418708
541 Ga0070663_100574918
542 Ga0070678_100852092
543 Ga0070678_101288929
544 Ga0070678_101986968
545 Ga0070678_102305593
546 Ga0070662_100366053
547 Ga0070681_10152512
548 Ga0068867_100384395
549 Ga0068867_100412433
550 Ga0070685_10359368
551 Ga0070706_100335907
552 Ga0070707_100928763
553 Ga0070699_101547905
554 Ga0070679_100336045
555 Ga0070684_100042920
556 Ga0070684_100177871
557 Ga0070697_101509923
558 Ga0070672_100301875
559 Ga0070686_100124437
560 Ga0070686_100312702
561 Ga0070695_100182063
562 Ga0070695_101255816
563 Ga0070696_100142859
564 Ga0070696_101496505
565 Ga0070693_100024877
566 Ga0070704_100010859
567 Ga0070704_100057503
568 Ga0070704_101248513
569 Ga0068855_101697033
570 Ga0070664_100030086
571 Ga0070664_100279278
572 Ga0070664_100948146
573 Ga0070664_102288078
574 Ga0070664_102366656
575 Ga0068857_100223343
576 Ga0068857_100515843
577 Ga0068857_101921100
578 Ga0068854_100550191
579 Ga0068854_100755042
580 Ga0068856_101585650
581 Ga0070702_100053640
582 Ga0070702_101491045
583 Ga0068852_101795575
584 Ga0068859_100010453
585 Ga0068859_100517050
586 Ga0068864_100051110
587 Ga0068864_100061419
588 Ga0068864_100584009
589 Ga0068866_10440454
590 Ga0068861_100310955
591 Ga0068861_101827672
592 Ga0068851_10997482
593 Ga0068870_10200949
594 Ga0068870_10561822
595 Ga0068863_100651395
596 Ga0068858_101209353
597 Ga0068860_100416194
598 Ga0068862_100279326
599 Ga0068862_100407864
600 Ga0075365_10139600
601 Ga0075365_10157009
602 Ga0075368_10013588
603 Ga0075368_10043500
604 Ga0075368_10166409
605 Ga0075368_10439029
606 Ga0075363_100039848
607 Ga0075364_10004582
608 Ga0075364_10005737
609 Ga0075364_10029358
610 Ga0075364_10094340
611 Ga0075364_10795919
612 Ga0070716_101711937
613 Ga0075362_10000489
614 Ga0075367_10000798
615 Ga0075367_10002068
616 Ga0075367_10004668
617 Ga0075367_10018729
618 Ga0075367_10114443
619 Ga0075367_10127349
620 Ga0075369_10537626
621 Ga0075366_10026602
622 Ga0075366_10084435
623 Ga0075366_10203117
624 Ga0075366_10214387
625 Ga0075366_10339166
626 Ga0097621_101046311
627 Ga0075370_10002038
628 Ga0075370_10003265
629 Ga0068871_100745201
630 Ga0075428_100009413
631 Ga0075428_100010179
632 Ga0075428_100017106
633 Ga0075430_100012219
634 Ga0075430_100043419
635 Ga0075431_100008733
636 Ga0075431_100019271
637 Ga0075433_10005701
638 Ga0075433_10008001
639 Ga0075433_10045537
640 Ga0075434_100007229
641 Ga0075434_102523840
642 Ga0075429_100026645
643 Ga0075429_100112134
644 Ga0075429_100279189
645 Ga0075429_101058597
646 Ga0097620_100010455
647 Ga0097620_100517068
648 Ga0075435_101941047
649 Ga0105240_10065113
650 Ga0105240_10443682
651 Ga0111539_10023936
652 Ga0111539_10130015
653 Ga0111539_10248249
654 Ga0111539_11426064
655 Ga0111539_11559965
656 Ga0105245_11013737
657 Ga0105245_12540498
658 Ga0114129_10000288
659 Ga0114129_10011087
660 Ga0114129_10016501
661 Ga0114129_10020431
662 Ga0114129_10038076
663 Ga0114129_11270643
664 Ga0105243_10185955
665 Ga0105243_10420441
666 Ga0105243_10767571
667 Ga0105248_10112356
668 Ga0105248_10180866
669 Ga0105248_10829585
670 Ga0105248_11168156
671 Ga0105238_10343650
672 Ga0105238_12903970
673 Ga0105249_10302217
674 Ga0105249_10755278
675 Ga0105249_10810590
676 Ga0105246_10116601
677 Ga0157370_10120831
678 Ga0157378_10224108
679 Ga0157375_10381944
680 Ga0163163_10974898
681 Ga0157380_10154005
682 Ga0157380_10419391
683 Ga0157380_10574279
684 Ga0157380_11272119
685 Ga0157380_11912188
686 Ga0157377_10122918
687 Ga0157376_11170625
688 Ga0163161_10136938
689 Ga0206356_10466454
690 Ga0206353_10702851
691 Ga0154015_1013679
692 Ga0207697_10275325
693 Ga0207656_10732492
694 Ga0207653_10285253
695 Ga0207682_10042770
696 Ga0207688_10108737
697 Ga0207647_10681671
698 Ga0207645_10101369
699 Ga0207643_10064402
700 Ga0207643_10243293
701 Ga0207684_10228505
702 Ga0207684_11008308
703 Ga0207707_10972702
704 Ga0207695_10266037
705 Ga0207695_10902076
706 Ga0207660_10829744
707 Ga0207657_10265889
708 Ga0207649_10169893
709 Ga0207652_10483360
710 Ga0207646_10297375
711 Ga0207681_10448095
712 Ga0207681_10560944
713 Ga0207694_10418667
714 Ga0207650_10033880
715 Ga0207650_10138953
716 Ga0207650_11099636
717 Ga0207659_10022618
718 Ga0207659_10249108
719 Ga0207659_10679510
720 Ga0207687_11300058
721 Ga0207644_10064072
722 Ga0207644_11428254
723 Ga0207690_10405289
724 Ga0207690_10544766
725 Ga0207690_11700616
726 Ga0207706_10224906
727 Ga0207709_10187083
728 Ga0207669_10531935
729 Ga0207704_11336873
730 Ga0207665_10667401
731 Ga0207691_10024424
732 Ga0207711_10206289
733 Ga0207711_10344055
734 Ga0207689_10174187
735 Ga0207689_10513546
736 Ga0207689_10522946
737 Ga0207661_10001481
738 Ga0207679_10005395
739 Ga0207679_10692770
740 Ga0207679_11254356
741 Ga0207679_11390251
742 Ga0207667_10106183
743 Ga0207667_10970013
744 Ga0207667_11166466
745 Ga0207651_10336836
746 Ga0207651_10505417
747 Ga0207712_10078428
748 Ga0207712_10435093
749 Ga0207668_10019475
750 Ga0207640_11563900
751 Ga0207658_11211615
752 Ga0207677_10957929
753 Ga0207703_12320313
754 Ga0207639_10813442
755 Ga0207678_10704482
756 Ga0207708_10180160
757 Ga0207708_10583121
758 Ga0207702_11218609
759 Ga0207641_10309662
760 Ga0207641_10599740
761 Ga0207676_10107894
762 Ga0207674_10421689
763 Ga0207675_100036985
764 Ga0207675_101258610
765 Ga0207683_10068044
766 Ga0207698_11282138
767 Ga0209813_10029350
768 Ga0209813_10083688
769 Ga0209813_10110085
770 Ga0209813_10205088
771 Ga0207428_10001421
772 Ga0207428_11240789
773 Ga0268265_10718592
774 Ga0268265_11348655
775 Ga0268264_12352119
776 Ga0307408_100159303
777 Ga0307408_100169225
778 Ga0307408_100222812
779 Ga0307408_100287167
780 Ga0307408_100793572
781 Ga0307405_10024544
782 Ga0307405_10026523
783 Ga0307413_10224557
784 Ga0307413_11193761
785 Ga0307410_10418960
786 Ga0307410_11581357
787 Ga0307406_10071179
788 Ga0307406_11134680
789 Ga0307412_10158984
790 Ga0307412_10588492
791 Ga0307409_100064777
792 Ga0307416_100029631
793 Ga0307416_100136120
794 Ga0307416_100242692
795 Ga0307416_101576383
796 Ga0307414_10751473
797 Ga0307411_11311577
798 Ga0307415_100139869
799 Ga0373926_0008201
800 Ga0373936_0327902
801 Ga0373935_0207406
802 Ga0373935_0458537
803 Ga0373947_0188262
804 Ga0373937_1236099
805 Ga0373925_0121645
806 Ga0373925_0198555
807 Ga0395898_1332689
808 Ga0395901_0387891
809 Ga0436365_0693531
810 Ga0439453_0160800
811 Ga0451789_1019162
812 Ga0451791_0710523
813 Ga0451797_1499161
814 Ga0451798_0246949
815 Ga0451798_0594751
816 Ga0451800_1564513
817 Ga0451802_1065277
818 Ga0451807_1718721
819 Ga0451807_2155549
820 Ga0451837_0987234
821 Ga0451853_1492214
822 Ga0451853_2280574
823 Ga0451853_3264069
824 Ga0439462_0211140
825 Ga0450919_035589
826 Ga0450898_152682
827 Ga0439446_0041487
828 Ga0439446_0136393
829 Ga0439446_0378882
830 Ga0439435_0034819
831 Ga0439460_0165736
832 Ga0466957_0853597
833 Ga0466967_0660229
834 Ga0495582_0736529
835 Ga0495633_0214974
836 Ga0495667_0011613
837 Ga0495634_0510252
838 Ga0495635_0477375
839 Ga0495657_0873698
840 Ga0495600_0339055
841 Ga0496107_0743187
842 Ga0496108_0545941
843 Ga0496109_1107014
844 Ga0496109_1336722
845 Ga0496112_0805736
846 Ga0501308_045289
847 Ga0501309_055372
848 Ga0501305_072347
849 Ga0501296_042836
850 Ga0501297_045887
851 Ga0501299_124744
852 Ga0501300_034525
853 Ga0501312_043368
854 Ga0501313_072793
855 Ga0501317_069325
856 Ga0501033_1194777
857 Ga0501034_0010134
858 Ga0501036_0074517
859 Ga0501036_0609903
860 Ga0501036_0748189
861 Ga0501036_0833258
862 Ga0501040_0055007
863 Ga0501041_0306834
864 Ga0501042_0662633
865 Ga0501047_0072847
866 Ga0501048_0045903
867 Ga0501070_1155979
868 Ga0501071_0043848
869 Ga0501072_0204121
870 Ga0501074_0593491
871 Ga0501075_0025191
872 Ga0501076_0015504
873 Ga0501202_058478
874 Ga0501216_062665
875 Ga0501217_009331
876 Ga0501233_289358
877 Ga0501235_039082
878 Ga0501221_015663
879 Ga0501225_0063830
880 Ga0501080_0116878
881 Ga0501080_0241767
882 Ga0501081_0056415
883 Ga0501241_135720
884 Ga0501265_039302
885 Ga0501271_038225
886 Ga0501283_015939
887 Ga0501035_0258271
888 Ga0501045_0035210
889 nmdc:mga03683_3561_c1
890 nmdc:mga03n38_158934_c1
891 nmdc:mga03n38_21287_c1
892 nmdc:mga00v17_1024715_c1
893 nmdc:mga00v17_104763_c1
894 nmdc:mga00v17_117472_c1
895 nmdc:mga00v17_123438_c1
896 nmdc:mga00v17_3738_c2
897 nmdc:mga00v17_712955_c1
898 nmdc:mga0yw44_316113_c1
899 nmdc:mga0yw44_3469_c1
900 nmdc:mga0yw44_435621_c1
901 nmdc:mga0k408_134485_c1
902 nmdc:mga0k408_281998_c1
903 nmdc:mga0k408_50030_c1
904 nmdc:mga0k408_830468_c1
905 nmdc:mga0k408_9176_c1
906 nmdc:mga0k408_95159_c1
907 nmdc:mga06z11_15480_c1
908 nmdc:mga06z11_285355_c1
909 nmdc:mga06z11_29375_c1
910 nmdc:mga06z11_32521_c1
911 nmdc:mga06z11_439445_c1
912 nmdc:mga04h51_12974_c1
913 nmdc:mga04h51_25720_c1
914 nmdc:mga04h51_363244_c1
915 nmdc:mga04h51_70534_c1
916 nmdc:mga07m45_24731_c1
917 nmdc:mga07m45_63000_c1
918 nmdc:mga05p37_10687_c1
919 nmdc:mga05p37_1171_c1
920 nmdc:mga05p37_218512_c1
921 nmdc:mga05p37_508351_c1
922 nmdc:mga09592_275178_c1
923 nmdc:mga09592_31494_c1
924 nmdc:mga09592_65027_c1
925 nmdc:mga09592_70796_c1
926 nmdc:mga0qj67_103406_c1
927 nmdc:mga0qj67_269354_c1
928 nmdc:mga0qj67_498252_c1
929 nmdc:mga06r32_19697_c1
930 nmdc:mga06r32_209196_c1
931 nmdc:mga06r32_21085_c1
932 nmdc:mga08y16_106622_c1
933 nmdc:mga08y16_550153_c1
934 nmdc:mga0n895_89327_c1
935 nmdc:mga0a205_166953_c1
936 nmdc:mga0a205_232844_c1
937 nmdc:mga0a205_9054_c1
938 nmdc:mga0sz30_203883_c1
939 nmdc:mga0sz30_305813_c1
940 Ga0495619_0308476
941 Ga0495619_0525042
942 Ga0500646_0134633
943 Ga0500641_0000556
944 Ga0500628_002853
945 Ga0500568_0003131
946 Ga0501084_0199473
947 Ga0501084_0737288
948 Ga0587073_0263062
949 Ga0587080_065255
950 Ga0587083_0136718
951 Ga0587091_174318
952 Ga0587106_126811
953 Ga0587101_049868
954 Ga0587100_003370
955 Ga0587071_142447
956 Ga0501082_1053634
957 Ga0530510_0260160
958 Ga0530510_1119133

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00829

Ribosomal_L21p

Ribosomal prokaryotic L21 protein

17

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7u-assembly1.cif.gz_U e. faecalis 70s ribosome with p-trna, state iv 0.815 1 100
7nhn-assembly1.cif.gz_U vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.8061 1 100
6eri-assembly1.cif.gz_AR structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor 0.8016 2 100
8cgd-assembly1.cif.gz_q clindamycin bound to the 50s subunit 0.7921 1 101
4ce4-assembly1.cif.gz_V 39s large subunit of the porcine mitochondrial ribosome 0.7912 1 100
ID Description Score Start End Superfamily
af_C0H4Y5_87_186_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8114 3 98 2.40.10.190
af_Q2FXS8_1_100_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8055 1 97 2.40.10.190
af_A0A1D6H5B5_111_217_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.804 1 97 2.40.10.190
af_P9WHC3_3_102_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.7865 1 97 2.40.10.190
af_Q54IF0_61_161_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.7829 1 97 2.40.10.190
ID Description Score Start End GO Terms
AF-B1XPE0-F1-model_v4 Large ribosomal subunit protein bL21 (50S ribosomal protein L21) 0.8473 2 101 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-C4XNW0-F1-model_v4 Large ribosomal subunit protein bL21 (50S ribosomal protein L21) 0.8456 1 101 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A535TMD1-F1-model_v4 Large ribosomal subunit protein bL21 0.8455 1 101 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A535QEM6-F1-model_v4 Large ribosomal subunit protein bL21 0.845 1 100 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1M3IQY8-F1-model_v4 Large ribosomal subunit protein bL21 0.8447 1 99 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map