F451983

General Info

Members Datasets Scaffolds Average Seq Length
479 258 427 391

Family's Representative Sequence

Representative Sequence 3300003761|Ga0055535_1001910|Ga0055535_10019101
Length 465
Sequence MKRREFLLAAATAAVAAPALSFSGKLFAAPANSPRFLLVFLRGGYDCNNLLVPYSSDFYYESRPTLAIAKPDAYNTNSAIGLDSNWGLNPVLRDSIYPLWQKRQVAFVPFAGTDDMSRSHFETQDNIESGEQTDQRNNYRSGFMARLSGQMSGVPSIAFTDALPLSFQGSSRDIPNISLRGNPKPVYDERQANILAGMYRNTTLASAAADGLELRQTVSKELQEEMMKANRGAPNAKNFADETQRIATMMRDQYRLGFVDVGGWDTHVNQGSTTGQLANNLANLGKGIAAYADALGDEWNNTVVVVVSEFGRTFRENGNKGTDHGHGTVYWVLGGKVNGGRIAGQQVAVNAQSLLQNRDYPVLNNYRDMLGGLLGRMWGLSGSQLHSVFPGAHPVNAIKPKPLTNMRASGKDDAIQLTPATKFSLEQALDFIDDDELVEVTPKEIRMRKKHLTENDRKKASRGVA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
7 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
8 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
9 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
10 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
11 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
12 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
13 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
14 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
15 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
16 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
17 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
18 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
19 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
20 2643221640 Caulobacter sp. Root342 Isolate Unclassified
21 2643221642 Caulobacter sp. Root343 Isolate Unclassified
22 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
23 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
24 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
25 2734482264 Dyella sp. AD052 Isolate Unclassified
26 2738543009 Luteibacter sp. OK325 Isolate Unclassified
27 2739367700 Dyella sp. YR388 Isolate Unclassified
28 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
29 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
30 2818991457 Xanthomonas translucens 569 Isolate Unclassified
31 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
32 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
33 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
34 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
35 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
36 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
37 2884411467 Dyella sp. AD56 Isolate Rhizosphere
38 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
39 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
40 2919085039 Luteibacter sp. 1214 Isolate Unclassified
41 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
42 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
43 2928963466 Dyella japonica 1073 Isolate Unclassified
44 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
45 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
46 2941471342 Luteibacter sp. 621 Isolate Unclassified
47 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
48 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
49 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
53 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
54 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
55 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
56 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
57 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
58 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
59 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
63 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
64 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
65 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
66 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
67 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
68 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
69 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
93 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
166 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
230 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
246 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
250 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
251 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
252 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
256 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
257 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
258 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.52
Metatranscriptomes 0.63
Isolates 10.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.84
Nodule 0
Rhizoplane 7.1
Rhizosphere 49.06
Stem 0
Stem Tuber 0
Unclassified 19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001101 3300001904 Bacteria 4947
2 JGI24740J21852_10008155 3300001979 Bacteria 4199
3 JGI24739J22299_10000076 3300001989 Bacteria 27668
4 JGI24737J22298_10000304 3300001990 Bacteria 16452
5 JGI24737J22298_10045938 3300001990 Bacteria 1333
6 JGI24738J21930_10000238 3300002075 Bacteria 14950
7 JGI25156J39149_1007901 3300002705 Bacteria 2736
8 JGI25156J39149_1017980 3300002705 Bacteria 1320
9 JGI25162J39368_1000054 3300002737 Bacteria 147779
10 JGI25162J39368_1000132 3300002737 Bacteria 80803
11 JGI25162J39368_1000260 3300002737 Bacteria 50536
12 JGI25162J39368_1000595 3300002737 Bacteria 26219
13 JGI25162J39368_1000979 3300002737 Bacteria 18126
14 JGI25162J39368_1002803 3300002737 Bacteria 6127
15 JGI25162J39368_1003520 3300002737 Unclassified 4440
16 JGI25157J39369_1000364 3300002741 Bacteria 31214
17 JGI25157J39369_1000867 3300002741 Bacteria 14653
18 JGI25157J39369_1002864 3300002741 Bacteria 3880
19 JGI25157J39369_1004922 3300002741 Bacteria 2292
20 JGI25163J39215_1000075 3300002771 Bacteria 44331
21 JGI25163J39215_1000335 3300002771 Bacteria 15610
22 JGI25163J39215_1002334 3300002771 Bacteria 2025
23 JGI25164J39214_1000029 3300002772 Bacteria 147779
24 JGI25164J39214_1000035 3300002772 Bacteria 139987
25 JGI25164J39214_1000106 3300002772 Bacteria 80803
26 JGI25164J39214_1000133 3300002772 Bacteria 71595
27 JGI25164J39214_1000213 3300002772 Bacteria 47862
28 JGI25164J39214_1000256 3300002772 Bacteria 40098
29 JGI25165J46597_1000111 3300003214 Bacteria 147779
30 JGI25165J46597_1000217 3300003214 Bacteria 80803
31 JGI25165J46597_1000255 3300003214 Bacteria 71595
32 JGI25165J46597_1000397 3300003214 Bacteria 46032
33 JGI25165J46597_1000698 3300003214 Bacteria 26762
34 JGI25165J46597_1004667 3300003214 Bacteria 2858
35 rootH2_10162478 3300003320 Bacteria 2172
36 Ga0006562J51391_1062523 3300003578 Bacteria 4270
37 Ga0006562J51391_1062526 3300003578 Bacteria 1810
38 Ga0055538_1000340 3300003751 Bacteria 20779
39 Ga0055533_1001312 3300003756 Bacteria 6757
40 Ga0055525_1000089 3300003759 Bacteria 142096
41 Ga0055527_1000084 3300003760 Bacteria 74303
42 Ga0055527_1000503 3300003760 Bacteria 13896
43 Ga0055527_1001799 3300003760 Bacteria 4090
44 Ga0055527_1004950 3300003760 Bacteria 1781
45 Ga0055535_1000317 3300003761 Bacteria 48674
46 Ga0055535_1000349 3300003761 Bacteria 45885
47 Ga0055535_1000579 3300003761 Bacteria 30773
48 Ga0055535_1000944 3300003761 Bacteria 19266
49 Ga0055535_1001910 3300003761 Bacteria 8751
50 Ga0055535_1001965 3300003761 Bacteria 8529
51 Ga0055542_1000082 3300003762 Bacteria 128120
52 Ga0055542_1000195 3300003762 Bacteria 74303
53 Ga0055542_1000327 3300003762 Bacteria 50536
54 Ga0055542_1000375 3300003762 Bacteria 45897
55 Ga0055542_1000600 3300003762 Bacteria 30773
56 Ga0055542_1000933 3300003762 Bacteria 19266
57 Ga0055529_1000228 3300003763 Bacteria 71595
58 Ga0055529_1000254 3300003763 Bacteria 64036
59 Ga0055529_1000507 3300003763 Bacteria 35026
60 Ga0055529_1000800 3300003763 Bacteria 19266
61 Ga0055529_1001360 3300003763 Bacteria 8004
62 Ga0058692_1000097 3300003856 Bacteria 58810
63 Ga0065165_1000566 3300005262 Bacteria 54948
64 Ga0065165_1004080 3300005262 Bacteria 9458
65 Ga0070658_10011494 3300005327 Bacteria 7100
66 Ga0070670_100001128 3300005331 Bacteria 21227
67 Ga0070689_100004531 3300005340 Bacteria 9407
68 Ga0070669_100141336 3300005353 Bacteria 1856
69 Ga0070714_100026675 3300005435 Bacteria 4777
70 Ga0070714_100187986 3300005435 Bacteria 1883
71 Ga0070713_100001782 3300005436 Bacteria 13876
72 Ga0068855_100004050 3300005563 Bacteria 17881
73 Ga0068857_100000300 3300005577 Bacteria 34132
74 Ga0068854_100000343 3300005578 Bacteria 29961
75 Ga0068854_100002114 3300005578 Bacteria 12177
76 Ga0068856_100057216 3300005614 Bacteria 3849
77 Ga0068852_100010857 3300005616 Bacteria 6825
78 Ga0068858_100096487 3300005842 Bacteria 2755
79 Ga0068860_100024960 3300005843 Bacteria 5771
80 Ga0105251_10000421 3300009011 Bacteria 41190
81 Ga0105251_10000771 3300009011 Bacteria 29136
82 Ga0105244_10025832 3300009036 Bacteria 3185
83 Ga0105240_10001721 3300009093 Bacteria 36937
84 Ga0105240_10007869 3300009093 Bacteria 15381
85 Ga0105240_10009439 3300009093 Bacteria 13810
86 Ga0105240_10051502 3300009093 Bacteria 5178
87 Ga0105240_10069743 3300009093 Bacteria 4350
88 Ga0105240_10289045 3300009093 Bacteria 1880
89 Ga0105247_10010140 3300009101 Bacteria 5707
90 Ga0105243_10000144 3300009148 Bacteria 81484
91 Ga0105243_10002137 3300009148 Bacteria 16716
92 Ga0105243_10132297 3300009148 Bacteria 2118
93 Ga0105237_10000063 3300009545 Bacteria 141759
94 Ga0105238_10020657 3300009551 Bacteria 6708
95 Ga0105239_10000043 3300010375 Bacteria 196600
96 Ga0105239_10014668 3300010375 Bacteria 8691
97 Ga0105239_10132420 3300010375 Bacteria 2774
98 Ga0157314_1000259 3300012500 Bacteria 5714
99 Ga0157347_1001500 3300012502 Bacteria 1843
100 Ga0157371_10000230 3300013102 Bacteria 80303
101 Ga0157370_10000407 3300013104 Bacteria 54357
102 Ga0157370_10001634 3300013104 Bacteria 27668
103 Ga0157370_10013778 3300013104 Bacteria 8308
104 Ga0157370_10208461 3300013104 Bacteria 1812
105 Ga0157369_10000080 3300013105 Bacteria 133011
106 Ga0157369_10014854 3300013105 Bacteria 8788
107 Ga0163162_10001186 3300013306 Bacteria 24300
108 Ga0163162_10073551 3300013306 Bacteria 3474
109 Ga0182008_10000790 3300014497 Bacteria 22189
110 Ga0182008_10004294 3300014497 Bacteria 8348
111 Ga0182006_1000430 3300015261 Bacteria 33536
112 Ga0182006_1000676 3300015261 Bacteria 23945
113 Ga0182006_1010359 3300015261 Bacteria 4146
114 Ga0182007_10002476 3300015262 Bacteria 9153
115 Ga0182005_1000028 3300015265 Bacteria 221889
116 Ga0182005_1000736 3300015265 Bacteria 14997
117 Ga0182005_1003663 3300015265 Bacteria 5152
118 Ga0183369_1009 3300015685 Bacteria 346348
119 Ga0163161_10021567 3300017792 Bacteria 4526
120 Ga0224712_10006317 3300022467 Bacteria 3369
121 Ga0209760_100015 3300025207 Bacteria 176281
122 Ga0209760_100047 3300025207 Bacteria 107520
123 Ga0209760_100727 3300025207 Bacteria 4910
124 Ga0209784_100133 3300025224 Bacteria 72169
125 Ga0209566_102250 3300025225 Bacteria 3775
126 Ga0209674_100148 3300025226 Bacteria 98100
127 Ga0209674_100269 3300025226 Bacteria 39856
128 Ga0209674_100439 3300025226 Bacteria 19443
129 Ga0209674_102759 3300025226 Bacteria 3558
130 Ga0209672_100007 3300025228 Bacteria 959482
131 Ga0209672_100029 3300025228 Bacteria 339298
132 Ga0209672_100058 3300025228 Bacteria 211992
133 Ga0209672_100841 3300025228 Bacteria 14165
134 Ga0209672_102342 3300025228 Bacteria 4783
135 Ga0209672_105200 3300025228 Bacteria 2266
136 Ga0209563_100051 3300025230 Bacteria 340545
137 Ga0207427_100001 3300025231 Bacteria 1410763
138 Ga0207427_100013 3300025231 Bacteria 581419
139 Ga0207427_100029 3300025231 Bacteria 376678
140 Ga0207427_100033 3300025231 Bacteria 338459
141 Ga0207427_100221 3300025231 Bacteria 49111
142 Ga0207427_100463 3300025231 Bacteria 22338
143 Ga0209437_100003 3300025233 Bacteria 1517827
144 Ga0209437_100009 3300025233 Bacteria 915954
145 Ga0209437_100015 3300025233 Bacteria 713457
146 Ga0209437_100020 3300025233 Bacteria 656374
147 Ga0209437_100079 3300025233 Bacteria 275948
148 Ga0209437_100106 3300025233 Bacteria 219071
149 Ga0209437_100352 3300025233 Bacteria 52711
150 Ga0209258_100046 3300025242 Bacteria 369794
151 Ga0209258_100053 3300025242 Bacteria 339233
152 Ga0209258_100095 3300025242 Bacteria 223270
153 Ga0209258_100413 3300025242 Bacteria 51260
154 Ga0209258_100444 3300025242 Bacteria 46475
155 Ga0209258_100991 3300025242 Bacteria 13111
156 Ga0209646_1001493 3300025246 Bacteria 6223
157 Ga0209646_1002278 3300025246 Bacteria 4385
158 Ga0209026_1000051 3300025250 Bacteria 250792
159 Ga0209026_1000074 3300025250 Bacteria 203820
160 Ga0209026_1000092 3300025250 Bacteria 170960
161 Ga0209026_1001965 3300025250 Bacteria 8246
162 Ga0209148_1000002 3300025254 Bacteria 2399500
163 Ga0209148_1000009 3300025254 Bacteria 1395625
164 Ga0209148_1000010 3300025254 Bacteria 1265567
165 Ga0209148_1000039 3300025254 Bacteria 482479
166 Ga0209148_1000087 3300025254 Bacteria 260905
167 Ga0209148_1000098 3300025254 Bacteria 233172
168 Ga0209148_1003324 3300025254 Bacteria 4531
169 Ga0209759_1000110 3300025256 Bacteria 144917
170 Ga0209759_1000278 3300025256 Bacteria 71965
171 Ga0209759_1000353 3300025256 Bacteria 59779
172 Ga0209759_1003639 3300025256 Bacteria 6066
173 Ga0209759_1008632 3300025256 Bacteria 3158
174 Ga0209233_1000007 3300025261 Bacteria 1411234
175 Ga0209233_1000009 3300025261 Bacteria 1265567
176 Ga0209233_1000020 3300025261 Bacteria 798224
177 Ga0209233_1000032 3300025261 Bacteria 623596
178 Ga0209233_1000080 3300025261 Bacteria 338459
179 Ga0209233_1000121 3300025261 Bacteria 233309
180 Ga0209233_1014060 3300025261 Bacteria 2267
181 Ga0209455_1000010 3300025272 Bacteria 959482
182 Ga0209455_1000034 3300025272 Bacteria 483129
183 Ga0209455_1000060 3300025272 Bacteria 339298
184 Ga0209455_1000120 3300025272 Bacteria 173966
185 Ga0209455_1010962 3300025272 Bacteria 2264
186 Ga0209758_1001152 3300025297 Bacteria 33838
187 Ga0209758_1014740 3300025297 Bacteria 4124
188 Ga0209256_1022342 3300025299 Bacteria 1917
189 Ga0207655_1000021 3300025728 Bacteria 518596
190 Ga0207713_1000175 3300025735 Bacteria 92467
191 Ga0207713_1003462 3300025735 Bacteria 10747
192 Ga0207680_10000005 3300025903 Bacteria 660983
193 Ga0207647_10000342 3300025904 Bacteria 37701
194 Ga0207647_10000504 3300025904 Bacteria 31238
195 Ga0207695_10001058 3300025913 Bacteria 48255
196 Ga0207695_10001605 3300025913 Bacteria 36692
197 Ga0207695_10002167 3300025913 Bacteria 29675
198 Ga0207695_10037705 3300025913 Bacteria 5213
199 Ga0207695_10066645 3300025913 Bacteria 3696
200 Ga0207671_10000021 3300025914 Bacteria 300409
201 Ga0207694_10044992 3300025924 Bacteria 3409
202 Ga0207650_10001154 3300025925 Bacteria 19376
203 Ga0207700_10003288 3300025928 Bacteria 9357
204 Ga0207709_10000250 3300025935 Bacteria 65488
205 Ga0207709_10000993 3300025935 Bacteria 21128
206 Ga0207709_10074843 3300025935 Bacteria 2162
207 Ga0207670_10005647 3300025936 Bacteria 6882
208 Ga0207667_10000142 3300025949 Bacteria 109610
209 Ga0207667_10000198 3300025949 Bacteria 87446
210 Ga0207640_10000014 3300025981 Bacteria 219683
211 Ga0207640_10000016 3300025981 Bacteria 208390
212 Ga0207640_10003593 3300025981 Bacteria 8360
213 Ga0207703_10092752 3300026035 Bacteria 2542
214 Ga0207702_10011516 3300026078 Bacteria 7369
215 Ga0207674_10000623 3300026116 Bacteria 46466
216 Ga0209371_1000209 3300027312 Bacteria 81879
217 Ga0268264_10083996 3300028381 Bacteria 2729
218 Ga0265319_1005829 3300028563 Bacteria 5815
219 Ga0265318_10000878 3300028577 Bacteria 19643
220 Ga0265338_10008934 3300028800 Bacteria 12058
221 Ga0265338_10054170 3300028800 Bacteria 3580
222 Ga0268256_1000167 3300030500 Bacteria 81875
223 Ga0265330_10002606 3300031235 Bacteria 9801
224 Ga0265332_10002933 3300031238 Bacteria 8391
225 Ga0265328_10000254 3300031239 Bacteria 24536
226 Ga0265328_10000321 3300031239 Bacteria 22427
227 Ga0265320_10002076 3300031240 Bacteria 14103
228 Ga0265320_10062639 3300031240 Bacteria 1770
229 Ga0265329_10005103 3300031242 Bacteria 5355
230 Ga0265339_10003964 3300031249 Bacteria 10230
231 Ga0265339_10051066 3300031249 Bacteria 2258
232 Ga0265331_10000762 3300031250 Bacteria 26873
233 Ga0265316_10003383 3300031344 Bacteria 16155
234 Ga0265313_10011614 3300031595 Bacteria 5460
235 Ga0265314_10006313 3300031711 Bacteria 10513
236 Ga0265314_10017420 3300031711 Bacteria 5640
237 Ga0265342_10003566 3300031712 Bacteria 12730
238 Ga0265342_10004501 3300031712 Bacteria 10937
239 Ga0307510_10002640 3300033180 Bacteria 20467
240 Ga0395899_0000369 3300037312 Bacteria 54244
241 Ga0395900_0002478 3300037418 Bacteria 20291
242 Ga0395900_0007174 3300037418 Bacteria 11550
243 Ga0395900_0016319 3300037418 Bacteria 7569
244 Ga0395900_0071455 3300037418 Bacteria 3567
245 Ga0395898_0000144 3300037466 Bacteria 187889
246 Ga0395898_0000305 3300037466 Bacteria 116565
247 Ga0395898_0044148 3300037466 Bacteria 4390
248 Ga0436364_0347636 3300037853 Bacteria 1484
249 Ga0395901_0009614 3300038443 Bacteria 9807
250 Ga0436365_0983980 3300039437 Bacteria 10324
251 Ga0439436_0000011 3300041404 Bacteria 100668
252 Ga0439465_0009587 3300041413 Bacteria 3050
253 Ga0451793_0005684 3300041452 Bacteria 3305
254 Ga0451800_0259382 3300041459 Bacteria 6248
255 Ga0451806_066390 3300041462 Bacteria 6259
256 Ga0451806_089397 3300041462 Bacteria 3130
257 Ga0451804_1082700 3300041463 Bacteria 3927
258 Ga0451807_0200971 3300041486 Bacteria 4447
259 Ga0451807_1908561 3300041486 Bacteria 6354
260 Ga0450908_000110 3300042184 Bacteria 16756
261 Ga0466969_0003624 3300044656 Bacteria 8219
262 Ga0466969_0019629 3300044656 Bacteria 3510
263 Ga0466969_0028914 3300044656 Bacteria 2832
264 Ga0466969_0033496 3300044656 Bacteria 2608
265 Ga0466982_0000004 3300044672 Bacteria 386724
266 Ga0466966_0011778 3300044684 Bacteria 5794
267 Ga0466966_0065192 3300044684 Bacteria 2291
268 Ga0466961_0000942 3300044693 Bacteria 18007
269 Ga0466961_0000946 3300044693 Bacteria 17985
270 Ga0466961_0006538 3300044693 Bacteria 7411
271 Ga0466961_0016996 3300044693 Bacteria 4673
272 Ga0466961_0058218 3300044693 Bacteria 2458
273 Ga0466971_0004845 3300044719 Bacteria 5822
274 Ga0466968_0033802 3300044735 Bacteria 2131
275 Ga0466970_0011075 3300044765 Bacteria 4591
276 Ga0466970_0031396 3300044765 Bacteria 2805
277 Ga0466970_0042233 3300044765 Bacteria 2424
278 Ga0466957_0000516 3300044842 Bacteria 19357
279 Ga0466959_0020483 3300045049 Bacteria 4873
280 Ga0466959_0027787 3300045049 Bacteria 4195
281 Ga0466959_0051227 3300045049 Bacteria 3029
282 Ga0466959_0096970 3300045049 Bacteria 2113
283 Ga0466958_0008344 3300045836 Bacteria 5740
284 Ga0466958_0063415 3300045836 Bacteria 2254
285 Ga0466958_0078491 3300045836 Bacteria 2029
286 Ga0495617_000427 3300046452 Bacteria 22691
287 Ga0495617_001466 3300046452 Bacteria 10334
288 Ga0495627_015023 3300046453 Bacteria 2682
289 Ga0495638_0000065 3300046460 Bacteria 170849
290 Ga0495638_0000094 3300046460 Bacteria 142168
291 Ga0495638_0000383 3300046460 Bacteria 54789
292 Ga0495650_0000078 3300046471 Bacteria 245487
293 Ga0495650_0000889 3300046471 Bacteria 35236
294 Ga0495584_0000634 3300046491 Bacteria 23450
295 Ga0495585_0000474 3300046492 Bacteria 38414
296 Ga0495607_0000211 3300046501 Bacteria 62291
297 Ga0495607_0001322 3300046501 Bacteria 22095
298 Ga0495607_0004681 3300046501 Bacteria 10013
299 Ga0495583_0082444 3300046506 Bacteria 1395
300 Ga0495606_0000227 3300046507 Bacteria 99782
301 Ga0495606_0001012 3300046507 Bacteria 40883
302 Ga0495606_0001507 3300046507 Bacteria 30968
303 Ga0495606_0004567 3300046507 Bacteria 13751
304 Ga0495610_0002369 3300046512 Bacteria 15921
305 Ga0495616_0000036 3300046513 Bacteria 128264
306 Ga0495616_0016081 3300046513 Bacteria 4145
307 Ga0495620_0000867 3300046515 Bacteria 18724
308 Ga0495620_0008023 3300046515 Bacteria 5687
309 Ga0495631_0000017 3300046518 Bacteria 98047
310 Ga0495631_0000302 3300046518 Bacteria 34239
311 Ga0495632_0000004 3300046519 Bacteria 381372
312 Ga0495632_0002854 3300046519 Bacteria 12750
313 Ga0495637_0007141 3300046520 Bacteria 5561
314 Ga0495648_0000596 3300046524 Bacteria 38657
315 Ga0495648_0010463 3300046524 Bacteria 7063
316 Ga0495609_0001641 3300046538 Bacteria 14575
317 Ga0495597_0060340 3300046542 Bacteria 1655
318 Ga0495611_0000001 3300046648 Bacteria 2628469
319 Ga0495611_0000022 3300046648 Bacteria 122452
320 Ga0495625_0000022 3300046660 Bacteria 278823
321 Ga0495625_0005584 3300046660 Bacteria 11409
322 Ga0495625_0010667 3300046660 Bacteria 7573
323 Ga0495625_0014112 3300046660 Bacteria 6393
324 Ga0495625_0026251 3300046660 Bacteria 4404
325 Ga0495661_0002334 3300046665 Bacteria 14638
326 Ga0495670_0000730 3300046691 Bacteria 15694
327 Ga0495670_0013748 3300046691 Bacteria 3979
328 Ga0495671_0001871 3300046692 Bacteria 13526
329 Ga0495649_0015687 3300046694 Bacteria 4307
330 Ga0495589_0000059 3300046794 Bacteria 107171
331 Ga0495660_0000732 3300046810 Bacteria 24961
332 Ga0495679_000004 3300047446 Bacteria 748056
333 Ga0495673_0000004 3300047469 Bacteria 1354526
334 Ga0495673_0000048 3300047469 Bacteria 265950
335 Ga0495673_0008009 3300047469 Bacteria 5987
336 Ga0495681_0002612 3300047470 Bacteria 12795
337 Ga0495686_0000017 3300047472 Bacteria 435554
338 Ga0495686_0001175 3300047472 Bacteria 30567
339 Ga0495686_0011496 3300047472 Bacteria 6234
340 Ga0495686_0035573 3300047472 Bacteria 3200
341 Ga0495686_0104577 3300047472 Bacteria 1704
342 Ga0496100_0001485 3300048903 Bacteria 11468
343 Ga0496100_0171960 3300048903 Bacteria 1561
344 Ga0496101_0001076 3300048904 Bacteria 16152
345 Ga0496102_0105218 3300048905 Bacteria 2625
346 Ga0496104_0065909 3300048907 Bacteria 3438
347 Ga0496104_0164587 3300048907 Bacteria 2127
348 Ga0496105_0005421 3300048908 Bacteria 9678
349 Ga0496106_0005074 3300048909 Bacteria 9746
350 Ga0496106_0141206 3300048909 Bacteria 1894
351 Ga0496113_0090038 3300048916 Bacteria 2363
352 Ga0496115_0005442 3300048918 Bacteria 9261
353 Ga0496115_0020292 3300048918 Bacteria 5125
354 Ga0496116_0000126 3300048919 Bacteria 160425
355 Ga0496117_0000623 3300048920 Bacteria 57364
356 Ga0496117_0010696 3300048920 Bacteria 8302
357 Ga0496117_0022723 3300048920 Bacteria 5023
358 Ga0496117_0045311 3300048920 Bacteria 3178
359 Ga0496118_0000859 3300048921 Bacteria 48226
360 Ga0496118_0000880 3300048921 Bacteria 47321
361 Ga0496118_0000955 3300048921 Bacteria 45248
362 Ga0496118_0001685 3300048921 Bacteria 32286
363 Ga0496118_0003125 3300048921 Bacteria 21217
364 Ga0496118_0029221 3300048921 Bacteria 4627
365 Ga0496119_0000131 3300048922 Bacteria 105813
366 Ga0496119_0000681 3300048922 Bacteria 45369
367 Ga0496119_0004641 3300048922 Bacteria 13558
368 Ga0496119_0014277 3300048922 Bacteria 6235
369 Ga0496120_0000674 3300048923 Bacteria 50098
370 Ga0496120_0008466 3300048923 Bacteria 7464
371 Ga0496120_0013980 3300048923 Bacteria 5371
372 Ga0496121_0000142 3300048924 Bacteria 160072
373 Ga0496121_0000372 3300048924 Bacteria 92348
374 Ga0496121_0000813 3300048924 Bacteria 56914
375 Ga0496121_0002559 3300048924 Bacteria 27533
376 Ga0496121_0005455 3300048924 Bacteria 16291
377 Ga0496121_0012908 3300048924 Bacteria 9032
378 Ga0496121_0073867 3300048924 Bacteria 2730
379 Ga0496122_0002347 3300048925 Bacteria 27272
380 Ga0496122_0005499 3300048925 Bacteria 15069
381 Ga0496122_0020315 3300048925 Bacteria 6009
382 Ga0496122_0023921 3300048925 Bacteria 5364
383 Ga0496123_0000434 3300048926 Bacteria 75349
384 Ga0496123_0004325 3300048926 Bacteria 15072
385 Ga0496123_0004626 3300048926 Bacteria 14292
386 Ga0496124_0000289 3300048927 Bacteria 95056
387 Ga0496124_0001096 3300048927 Bacteria 42580
388 Ga0496124_0002418 3300048927 Bacteria 24496
389 Ga0496124_0116504 3300048927 Bacteria 2142
390 Ga0496125_0000338 3300048928 Bacteria 89749
391 Ga0496125_0044046 3300048928 Bacteria 3780
392 Ga0496125_0196272 3300048928 Bacteria 1327
393 Ga0496126_0007218 3300048929 Bacteria 12222
394 Ga0496126_0025667 3300048929 Bacteria 5663
395 Ga0496126_0059165 3300048929 Bacteria 3451
396 Ga0496126_0101027 3300048929 Bacteria 2523
397 Ga0496126_0204515 3300048929 Bacteria 1665
398 Ga0495678_001184 3300049459 Bacteria 21486
399 Ga0495682_0000134 3300049460 Bacteria 64409
400 Ga0495682_0001128 3300049460 Bacteria 15518
401 Ga0495682_0006477 3300049460 Bacteria 4730
402 Ga0501031_0130398 3300049568 Bacteria 1643
403 Ga0501032_0011286 3300049569 Bacteria 6416
404 Ga0501039_0128685 3300049575 Bacteria 1987
405 Ga0501043_0084938 3300049579 Bacteria 2488
406 Ga0501046_0013243 3300049580 Bacteria 6989
407 Ga0501047_0212634 3300049581 Bacteria 1792
408 Ga0501048_0169200 3300049582 Bacteria 1548
409 Ga0501080_0010465 3300049742 Bacteria 8492
410 Ga0501035_0026033 3300049822 Bacteria 5358
411 Ga0501035_0249592 3300049822 Bacteria 1507
412 Ga0495601_0227837 3300053077 Bacteria 1217
413 Ga0500643_000020 3300053087 Bacteria 290328
414 Ga0500647_0095012 3300053091 Bacteria 1426
415 Ga0500651_0000788 3300053093 Bacteria 15475
416 Ga0500641_0037249 3300053096 Bacteria 1949
417 Ga0500555_000885 3300053103 Bacteria 10655
418 Ga0500655_000021 3300053133 Bacteria 43984
419 Ga0500590_000264 3300053148 Bacteria 16437
420 Ga0500622_0000984 3300053156 Bacteria 24183
421 Ga0500622_0022743 3300053156 Bacteria 3320
422 Ga0500633_0000191 3300053160 Bacteria 8577
423 Ga0500634_0000066 3300053161 Bacteria 43652
424 Ga0500639_021542 3300053163 Bacteria 3406
425 Ga0500570_003532 3300053724 Bacteria 8062
426 Ga0500645_002721 3300053730 Bacteria 7681
427 Ga0466962_0004616 3300061719 Bacteria 6613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0082444 Ga0495583_0082444_12_1136 366
2 3300053096 Ga0500641_0037249 Ga0500641_0037249_337_1518 368
3 3300053133 Ga0500655_000021 Ga0500655_000021_26335_27516 368
4 3300053148 Ga0500590_000264 Ga0500590_000264_9277_10458 369
5 3300002741 JGI25157J39369_1002864 JGI25157J39369_10028642 370
6 3300009093 Ga0105240_10289045 Ga0105240_102890452 370
7 3300013105 Ga0157369_10014854 Ga0157369_100148544 370
8 3300047472 Ga0495686_0104577 Ga0495686_0104577_27_1166 370
9 3300009093 Ga0105240_10069743 Ga0105240_100697432 372
10 3300025913 Ga0207695_10066645 Ga0207695_100666453 372
11 3300013104 Ga0157370_10013778 Ga0157370_100137786 373
12 3300005262 Ga0065165_1004080 Ga0065165_10040805 374
13 3300025297 Ga0209758_1014740 Ga0209758_10147403 374
14 3300009551 Ga0105238_10020657 Ga0105238_100206572 375
15 3300013104 Ga0157370_10001634 Ga0157370_1000163415 375
16 3300025924 Ga0207694_10044992 Ga0207694_100449922 375
17 3300046542 Ga0495597_0060340 Ga0495597_0060340_432_1625 375
18 3300046660 Ga0495625_0010667 Ga0495625_0010667_2424_3617 375
19 3300049822 Ga0501035_0026033 Ga0501035_0026033_1364_2650 375
20 3300053091 Ga0500647_0095012 Ga0500647_0095012_47_1252 376
21 3300053156 Ga0500622_0022743 Ga0500622_0022743_1521_2726 376
22 3300053163 Ga0500639_021542 Ga0500639_021542_776_1981 376
23 3300053724 Ga0500570_003532 Ga0500570_003532_166_1371 376
24 3300003320 rootH2_10162478 rootH2_101624781 377
25 3300005327 Ga0070658_10011494 Ga0070658_100114946 377
26 3300005843 Ga0068860_100024960 Ga0068860_1000249604 377
27 3300013306 Ga0163162_10001186 Ga0163162_1000118619 377
28 3300028381 Ga0268264_10083996 Ga0268264_100839962 377
29 3300048903 Ga0496100_0171960 Ga0496100_0171960_74_1276 377
30 3300048928 Ga0496125_0044046 Ga0496125_0044046_2286_3485 377
31 3300048929 Ga0496126_0007218 Ga0496126_0007218_6138_7337 377
32 3300001990 JGI24737J22298_10045938 JGI24737J22298_100459381 378
33 3300003756 Ga0055533_1001312 Ga0055533_10013125 378
34 3300009093 Ga0105240_10001721 Ga0105240_100017218 378
35 3300010375 Ga0105239_10000043 Ga0105239_10000043167 378
36 3300025226 Ga0209674_100269 Ga0209674_10026922 378
37 3300025913 Ga0207695_10001605 Ga0207695_100016058 378
38 3300048907 Ga0496104_0065909 Ga0496104_0065909_2071_3273 378
39 3300048908 Ga0496105_0005421 Ga0496105_0005421_5655_6857 378
40 3300048922 Ga0496119_0000131 Ga0496119_0000131_100333_101535 378
41 3300048923 Ga0496120_0008466 Ga0496120_0008466_4265_5467 378
42 3300025903 Ga0207680_10000005 Ga0207680_10000005533 379
43 3300033180 Ga0307510_10002640 Ga0307510_100026401 379
44 3300041462 Ga0451806_089397 Ga0451806_089397_1709_2869 379
45 3300041486 Ga0451807_0200971 Ga0451807_0200971_1060_2220 379
46 3300048909 Ga0496106_0141206 Ga0496106_0141206_87_1289 379
47 3300048920 Ga0496117_0010696 Ga0496117_0010696_562_1764 379
48 3300048920 Ga0496117_0045311 Ga0496117_0045311_103_1305 379
49 3300048921 Ga0496118_0000880 Ga0496118_0000880_41969_43171 379
50 3300048921 Ga0496118_0000955 Ga0496118_0000955_9168_10370 379
51 3300048922 Ga0496119_0004641 Ga0496119_0004641_10713_11915 379
52 3300048923 Ga0496120_0013980 Ga0496120_0013980_2533_3735 379
53 3300048924 Ga0496121_0000813 Ga0496121_0000813_32068_33270 379
54 3300048929 Ga0496126_0025667 Ga0496126_0025667_4361_5563 379
55 3300001990 JGI24737J22298_10000304 JGI24737J22298_1000030414 380
56 3300002705 JGI25156J39149_1017980 JGI25156J39149_10179801 380
57 3300002741 JGI25157J39369_1000364 JGI25157J39369_10003643 380
58 3300003759 Ga0055525_1000089 Ga0055525_100008944 380
59 3300003760 Ga0055527_1000503 Ga0055527_10005033 380
60 3300003761 Ga0055535_1000579 Ga0055535_100057915 380
61 3300003762 Ga0055542_1000600 Ga0055542_100060011 380
62 3300003763 Ga0055529_1001360 Ga0055529_10013603 380
63 3300005435 Ga0070714_100187986 Ga0070714_1001879861 380
64 3300005614 Ga0068856_100057216 Ga0068856_1000572162 380
65 3300025225 Ga0209566_102250 Ga0209566_1022504 380
66 3300025226 Ga0209674_100148 Ga0209674_10014813 380
67 3300025228 Ga0209672_100007 Ga0209672_1000079 380
68 3300025230 Ga0209563_100051 Ga0209563_100051242 380
69 3300025242 Ga0209258_100046 Ga0209258_100046328 380
70 3300025250 Ga0209026_1000074 Ga0209026_100007496 380
71 3300025254 Ga0209148_1000098 Ga0209148_1000098199 380
72 3300025256 Ga0209759_1000110 Ga0209759_100011096 380
73 3300025256 Ga0209759_1008632 Ga0209759_10086322 380
74 3300025272 Ga0209455_1000010 Ga0209455_10000109 380
75 3300026078 Ga0207702_10011516 Ga0207702_100115166 380
76 3300037312 Ga0395899_0000369 Ga0395899_0000369_1937_3136 380
77 3300037418 Ga0395900_0002478 Ga0395900_0002478_6399_7598 380
78 3300037466 Ga0395898_0000305 Ga0395898_0000305_64258_65457 380
79 3300044656 Ga0466969_0003624 Ga0466969_0003624_2819_4018 380
80 3300044656 Ga0466969_0019629 Ga0466969_0019629_1083_2282 380
81 3300044656 Ga0466969_0028914 Ga0466969_0028914_405_1604 380
82 3300044684 Ga0466966_0065192 Ga0466966_0065192_1073_2272 380
83 3300044693 Ga0466961_0000942 Ga0466961_0000942_43_1242 380
84 3300044693 Ga0466961_0000946 Ga0466961_0000946_15591_16790 380
85 3300044693 Ga0466961_0006538 Ga0466961_0006538_2452_3651 380
86 3300044693 Ga0466961_0058218 Ga0466961_0058218_1196_2395 380
87 3300044765 Ga0466970_0011075 Ga0466970_0011075_1196_2395 380
88 3300044765 Ga0466970_0031396 Ga0466970_0031396_466_1665 380
89 3300044765 Ga0466970_0042233 Ga0466970_0042233_1196_2395 380
90 3300045049 Ga0466959_0020483 Ga0466959_0020483_856_2055 380
91 3300045049 Ga0466959_0027787 Ga0466959_0027787_1952_3151 380
92 3300045049 Ga0466959_0096970 Ga0466959_0096970_627_1826 380
93 3300045836 Ga0466958_0063415 Ga0466958_0063415_933_2132 380
94 3300045836 Ga0466958_0078491 Ga0466958_0078491_779_1978 380
95 3300047470 Ga0495681_0002612 Ga0495681_0002612_6438_7634 380
96 3300001979 JGI24740J21852_10008155 JGI24740J21852_100081553 381
97 3300001989 JGI24739J22299_10000076 JGI24739J22299_1000007625 381
98 3300002737 JGI25162J39368_1000979 JGI25162J39368_10009795 381
99 3300002741 JGI25157J39369_1004922 JGI25157J39369_10049222 381
100 3300002772 JGI25164J39214_1000035 JGI25164J39214_100003594 381
101 3300003214 JGI25165J46597_1000397 JGI25165J46597_100039714 381
102 3300003578 Ga0006562J51391_1062523 Ga0006562J51391_10625234 381
103 3300003578 Ga0006562J51391_1062526 Ga0006562J51391_10625262 381
104 3300003760 Ga0055527_1000084 Ga0055527_100008413 381
105 3300003760 Ga0055527_1001799 Ga0055527_10017992 381
106 3300003761 Ga0055535_1000317 Ga0055535_100031729 381
107 3300003761 Ga0055535_1000944 Ga0055535_10009441 381
108 3300003762 Ga0055542_1000195 Ga0055542_100019560 381
109 3300003762 Ga0055542_1000933 Ga0055542_100093314 381
110 3300003763 Ga0055529_1000254 Ga0055529_100025451 381
111 3300003763 Ga0055529_1000507 Ga0055529_100050716 381
112 3300003763 Ga0055529_1000800 Ga0055529_100080014 381
113 3300005577 Ga0068857_100000300 Ga0068857_10000030025 381
114 3300005578 Ga0068854_100002114 Ga0068854_1000021145 381
115 3300005616 Ga0068852_100010857 Ga0068852_1000108572 381
116 3300005842 Ga0068858_100096487 Ga0068858_1000964872 381
117 3300009093 Ga0105240_10007869 Ga0105240_100078692 381
118 3300009545 Ga0105237_10000063 Ga0105237_10000063135 381
119 3300010375 Ga0105239_10132420 Ga0105239_101324202 381
120 3300012500 Ga0157314_1000259 Ga0157314_10002592 381
121 3300012502 Ga0157347_1001500 Ga0157347_10015002 381
122 3300022467 Ga0224712_10006317 Ga0224712_100063171 381
123 3300025228 Ga0209672_100029 Ga0209672_100029317 381
124 3300025228 Ga0209672_100058 Ga0209672_100058137 381
125 3300025231 Ga0207427_100033 Ga0207427_10003361 381
126 3300025233 Ga0209437_100352 Ga0209437_10035229 381
127 3300025242 Ga0209258_100053 Ga0209258_10005313 381
128 3300025242 Ga0209258_100095 Ga0209258_1000951 381
129 3300025246 Ga0209646_1002278 Ga0209646_10022782 381
130 3300025250 Ga0209026_1001965 Ga0209026_10019655 381
131 3300025254 Ga0209148_1000009 Ga0209148_1000009317 381
132 3300025254 Ga0209148_1000039 Ga0209148_1000039213 381
133 3300025256 Ga0209759_1000353 Ga0209759_100035314 381
134 3300025256 Ga0209759_1003639 Ga0209759_10036395 381
135 3300025261 Ga0209233_1000080 Ga0209233_100008061 381
136 3300025272 Ga0209455_1000034 Ga0209455_1000034214 381
137 3300025272 Ga0209455_1000060 Ga0209455_1000060317 381
138 3300025297 Ga0209758_1001152 Ga0209758_100115211 381
139 3300025904 Ga0207647_10000504 Ga0207647_1000050425 381
140 3300025913 Ga0207695_10002167 Ga0207695_1000216722 381
141 3300025914 Ga0207671_10000021 Ga0207671_10000021239 381
142 3300025949 Ga0207667_10000198 Ga0207667_1000019827 381
143 3300025981 Ga0207640_10003593 Ga0207640_100035935 381
144 3300026035 Ga0207703_10092752 Ga0207703_100927522 381
145 3300026116 Ga0207674_10000623 Ga0207674_100006236 381
146 3300044693 Ga0466961_0016996 Ga0466961_0016996_496_1686 381
147 3300044842 Ga0466957_0000516 Ga0466957_0000516_303_1493 381
148 3300045836 Ga0466958_0008344 Ga0466958_0008344_1913_3103 381
149 3300048924 Ga0496121_0012908 Ga0496121_0012908_7798_8997 381
150 3300048928 Ga0496125_0000338 Ga0496125_0000338_15367_16566 381
151 3300049568 Ga0501031_0130398 Ga0501031_0130398_110_1312 381
152 3300049582 Ga0501048_0169200 Ga0501048_0169200_34_1236 381
153 3300002737 JGI25162J39368_1000595 JGI25162J39368_100059521 382
154 3300002772 JGI25164J39214_1000256 JGI25164J39214_10002569 382
155 3300003214 JGI25165J46597_1000698 JGI25165J46597_10006989 382
156 3300005435 Ga0070714_100026675 Ga0070714_1000266752 382
157 3300005436 Ga0070713_100001782 Ga0070713_1000017827 382
158 3300009093 Ga0105240_10009439 Ga0105240_100094398 382
159 3300015262 Ga0182007_10002476 Ga0182007_100024767 382
160 3300015685 Ga0183369_1009 Ga0183369_1009312 382
161 3300025226 Ga0209674_102759 Ga0209674_1027592 382
162 3300025231 Ga0207427_100463 Ga0207427_10046310 382
163 3300025233 Ga0209437_100079 Ga0209437_100079149 382
164 3300025250 Ga0209026_1000051 Ga0209026_100005173 382
165 3300025261 Ga0209233_1000121 Ga0209233_1000121106 382
166 3300025913 Ga0207695_10001058 Ga0207695_1000105831 382
167 3300025928 Ga0207700_10003288 Ga0207700_100032889 382
168 3300049822 Ga0501035_0249592 Ga0501035_0249592_36_1238 382
169 3300005331 Ga0070670_100001128 Ga0070670_10000112820 383
170 3300005353 Ga0070669_100141336 Ga0070669_1001413361 383
171 3300009011 Ga0105251_10000771 Ga0105251_100007716 383
172 3300025735 Ga0207713_1000175 Ga0207713_100017596 383
173 3300025925 Ga0207650_10001154 Ga0207650_100011547 383
174 3300037418 Ga0395900_0007174 Ga0395900_0007174_1349_2548 383
175 3300037466 Ga0395898_0044148 Ga0395898_0044148_2733_3932 383
176 3300038443 Ga0395901_0009614 Ga0395901_0009614_2625_3824 383
177 3300045049 Ga0466959_0051227 Ga0466959_0051227_1562_2755 383
178 3300047472 Ga0495686_0000017 Ga0495686_0000017_246269_247459 383
179 3300048920 Ga0496117_0022723 Ga0496117_0022723_1058_2248 383
180 3300048921 Ga0496118_0000859 Ga0496118_0000859_36135_37328 383
181 3300048921 Ga0496118_0001685 Ga0496118_0001685_17587_18777 383
182 3300048922 Ga0496119_0000681 Ga0496119_0000681_29286_30584 383
183 3300048923 Ga0496120_0000674 Ga0496120_0000674_14786_16084 383
184 3300048925 Ga0496122_0005499 Ga0496122_0005499_264_1562 383
185 3300048926 Ga0496123_0004325 Ga0496123_0004325_264_1562 383
186 3300048927 Ga0496124_0002418 Ga0496124_0002418_13604_14902 383
187 3300049579 Ga0501043_0084938 Ga0501043_0084938_113_1315 383
188 3300049581 Ga0501047_0212634 Ga0501047_0212634_506_1690 383
189 3300002075 JGI24738J21930_10000238 JGI24738J21930_100002388 384
190 3300005262 Ga0065165_1000566 Ga0065165_100056628 384
191 3300005563 Ga0068855_100004050 Ga0068855_10000405012 384
192 3300005578 Ga0068854_100000343 Ga0068854_10000034317 384
193 3300009093 Ga0105240_10051502 Ga0105240_100515026 384
194 3300009101 Ga0105247_10010140 Ga0105247_100101402 384
195 3300014497 Ga0182008_10004294 Ga0182008_100042942 384
196 3300015261 Ga0182006_1000430 Ga0182006_100043032 384
197 3300015261 Ga0182006_1000676 Ga0182006_100067620 384
198 3300015261 Ga0182006_1010359 Ga0182006_10103592 384
199 3300015265 Ga0182005_1000736 Ga0182005_10007368 384
200 3300015265 Ga0182005_1003663 Ga0182005_10036633 384
201 3300025913 Ga0207695_10037705 Ga0207695_100377056 384
202 3300025949 Ga0207667_10000142 Ga0207667_1000014275 384
203 3300025981 Ga0207640_10000014 Ga0207640_10000014129 384
204 3300025981 Ga0207640_10000016 Ga0207640_10000016129 384
205 3300037418 Ga0395900_0071455 Ga0395900_0071455_1436_2635 384
206 3300041404 Ga0439436_0000011 Ga0439436_0000011_7173_8363 384
207 3300041413 Ga0439465_0009587 Ga0439465_0009587_436_1626 384
208 3300044656 Ga0466969_0033496 Ga0466969_0033496_748_1947 384
209 3300044672 Ga0466982_0000004 Ga0466982_0000004_268543_269742 384
210 3300044684 Ga0466966_0011778 Ga0466966_0011778_1259_2458 384
211 3300044719 Ga0466971_0004845 Ga0466971_0004845_79_1278 384
212 3300046491 Ga0495584_0000634 Ga0495584_0000634_19721_20911 384
213 3300046501 Ga0495607_0000211 Ga0495607_0000211_16223_17413 384
214 3300046507 Ga0495606_0000227 Ga0495606_0000227_82027_83217 384
215 3300046512 Ga0495610_0002369 Ga0495610_0002369_7138_8328 384
216 3300046519 Ga0495632_0000004 Ga0495632_0000004_117188_118378 384
217 3300046691 Ga0495670_0000730 Ga0495670_0000730_8820_10010 384
218 3300048922 Ga0496119_0014277 Ga0496119_0014277_2390_3580 384
219 3300048924 Ga0496121_0002559 Ga0496121_0002559_12863_14053 384
220 3300048924 Ga0496121_0005455 Ga0496121_0005455_6679_7869 384
221 3300061719 Ga0466962_0004616 Ga0466962_0004616_5078_6277 384
222 3300025254 Ga0209148_1003324 Ga0209148_10033242 385
223 3300037418 Ga0395900_0016319 Ga0395900_0016319_2350_3549 385
224 3300046453 Ga0495627_015023 Ga0495627_015023_1448_2647 385
225 3300046660 Ga0495625_0005584 Ga0495625_0005584_818_2008 385
226 3300048905 Ga0496102_0105218 Ga0496102_0105218_528_1718 385
227 3300053161 Ga0500634_0000066 Ga0500634_0000066_7827_9026 385
228 3300009148 Ga0105243_10002137 Ga0105243_1000213713 386
229 3300025935 Ga0207709_10000993 Ga0207709_100009937 386
230 3300046471 Ga0495650_0000889 Ga0495650_0000889_23858_25048 387
231 3300046507 Ga0495606_0001507 Ga0495606_0001507_10367_11557 387
232 3300046507 Ga0495606_0004567 Ga0495606_0004567_3254_4444 387
233 3300046513 Ga0495616_0000036 Ga0495616_0000036_12070_13260 387
234 3300046515 Ga0495620_0008023 Ga0495620_0008023_1832_3022 387
235 3300046518 Ga0495631_0000302 Ga0495631_0000302_20990_22180 387
236 3300046519 Ga0495632_0002854 Ga0495632_0002854_335_1525 387
237 3300046524 Ga0495648_0010463 Ga0495648_0010463_391_1581 387
238 3300046648 Ga0495611_0000022 Ga0495611_0000022_108493_109683 387
239 3300047469 Ga0495673_0000048 Ga0495673_0000048_121622_122812 387
240 3300047472 Ga0495686_0001175 Ga0495686_0001175_16609_17799 387
241 3300047472 Ga0495686_0011496 Ga0495686_0011496_4979_6169 387
242 3300048909 Ga0496106_0005074 Ga0496106_0005074_5053_6243 387
243 3300048924 Ga0496121_0073867 Ga0496121_0073867_648_1838 387
244 3300053160 Ga0500633_0000191 Ga0500633_0000191_6074_7264 387
245 3300046452 Ga0495617_001466 Ga0495617_001466_3833_5023 388
246 3300046460 Ga0495638_0000383 Ga0495638_0000383_38312_39502 388
247 3300046492 Ga0495585_0000474 Ga0495585_0000474_17665_18855 388
248 3300046518 Ga0495631_0000017 Ga0495631_0000017_13594_14784 388
249 3300046520 Ga0495637_0007141 Ga0495637_0007141_33_1223 388
250 3300046524 Ga0495648_0000596 Ga0495648_0000596_21879_23069 388
251 3300046538 Ga0495609_0001641 Ga0495609_0001641_5129_6319 388
252 3300046648 Ga0495611_0000001 Ga0495611_0000001_2209432_2210622 388
253 3300046665 Ga0495661_0002334 Ga0495661_0002334_136_1326 388
254 3300046691 Ga0495670_0013748 Ga0495670_0013748_1801_2991 388
255 3300046692 Ga0495671_0001871 Ga0495671_0001871_1197_2387 388
256 3300046794 Ga0495589_0000059 Ga0495589_0000059_96198_97388 388
257 3300047446 Ga0495679_000004 Ga0495679_000004_320204_321394 388
258 3300047469 Ga0495673_0008009 Ga0495673_0008009_2292_3482 388
259 3300049460 Ga0495682_0001128 Ga0495682_0001128_9593_10783 388
260 3300049460 Ga0495682_0006477 Ga0495682_0006477_2108_3298 388
261 3300053087 Ga0500643_000020 Ga0500643_000020_65838_67028 388
262 3300053103 Ga0500555_000885 Ga0500555_000885_4999_6189 388
263 3300053730 Ga0500645_002721 Ga0500645_002721_6176_7366 388
264 iso_pu_bacteria 2554235341 2555668400 388
265 iso_pu_bacteria 2599185160 2599355400 388
266 iso_pu_bacteria 2599185161 2599360781 388
267 iso_pu_bacteria 2599185162 2599367103 388
268 iso_pu_bacteria 2599185163 2599373893 388
269 iso_pu_bacteria 2599185164 2599380506 388
270 iso_pu_bacteria 2599185165 2599386953 388
271 iso_pu_bacteria 2599185166 2599392751 388
272 iso_pu_bacteria 2599185168 2599404518 388
273 iso_pu_bacteria 2599185181 2599462234 388
274 iso_pu_bacteria 2599185182 2599466724 388
275 iso_pu_bacteria 2599185186 2599490674 388
276 iso_pu_bacteria 2599185356 2600214856 388
277 iso_pu_bacteria 2600255313 2601774439 388
278 iso_pu_bacteria 2667528171 2671098002 388
279 iso_pu_bacteria 2818991464 2819703087 388
280 iso_pu_bacteria 2917070673 2917072168 388
281 iso_pu_bacteria 2935353572 2935354339 388
282 iso_pu_bacteria 637000220 637318762 388
283 3300002737 JGI25162J39368_1000132 JGI25162J39368_100013244 389
284 3300002771 JGI25163J39215_1000335 JGI25163J39215_10003353 389
285 3300002772 JGI25164J39214_1000106 JGI25164J39214_100010643 389
286 3300003214 JGI25165J46597_1000217 JGI25165J46597_100021744 389
287 3300025207 Ga0209760_100047 Ga0209760_10004766 389
288 3300025231 Ga0207427_100029 Ga0207427_100029142 389
289 3300025233 Ga0209437_100009 Ga0209437_100009397 389
290 3300025261 Ga0209233_1000032 Ga0209233_1000032397 389
291 3300037466 Ga0395898_0000144 Ga0395898_0000144_2464_3663 389
292 3300046810 Ga0495660_0000732 Ga0495660_0000732_11689_12879 389
293 3300047469 Ga0495673_0000004 Ga0495673_0000004_154193_155383 389
294 iso_pu_bacteria 8021622325 8021626099 389
295 iso_pu_bacteria 8021648035 8021649345 389
296 3300042184 Ga0450908_000110 Ga0450908_000110_8657_9847 390
297 iso_pu_bacteria 2582581305 2585260644 390
298 iso_pu_bacteria 2844665904 2844668914 390
299 3300048921 Ga0496118_0003125 Ga0496118_0003125_12882_14072 391
300 3300048927 Ga0496124_0116504 Ga0496124_0116504_121_1311 391
301 3300049575 Ga0501039_0128685 Ga0501039_0128685_244_1425 391
302 iso_pu_bacteria 2537561836 2538832382 391
303 iso_pu_bacteria 2687453130 2687582304 391
304 iso_pu_bacteria 2739367700 2739730556 391
305 iso_pu_bacteria 2747842501 2748018438 391
306 iso_pu_bacteria 2818991457 2819661677 391
307 iso_pu_bacteria 2852684882 2852688268 391
308 iso_pu_bacteria 2884411467 2884413284 391
309 iso_pu_bacteria 2919130084 2919134103 391
310 iso_pu_bacteria 2928531327 2928533563 391
311 iso_pu_bacteria 2928963466 2928964379 391
312 iso_pu_bacteria 2929195423 2929199684 391
313 iso_pu_bacteria 3007419365 3007425007 391
314 iso_pu_bacteria 8021626552 8021628506 391
315 3300002737 JGI25162J39368_1000054 JGI25162J39368_1000054109 392
316 3300002771 JGI25163J39215_1000075 JGI25163J39215_100007514 392
317 3300002772 JGI25164J39214_1000029 JGI25164J39214_100002935 392
318 3300003214 JGI25165J46597_1000111 JGI25165J46597_1000111109 392
319 3300009148 Ga0105243_10000144 Ga0105243_1000014447 392
320 3300013102 Ga0157371_10000230 Ga0157371_1000023047 392
321 3300014497 Ga0182008_10000790 Ga0182008_100007907 392
322 3300025207 Ga0209760_100015 Ga0209760_100015106 392
323 3300025231 Ga0207427_100001 Ga0207427_100001591 392
324 3300025233 Ga0209437_100003 Ga0209437_100003781 392
325 3300025261 Ga0209233_1000007 Ga0209233_1000007591 392
326 3300025935 Ga0207709_10000250 Ga0207709_1000025031 392
327 3300048919 Ga0496116_0000126 Ga0496116_0000126_123076_124263 392
328 3300048920 Ga0496117_0000623 Ga0496117_0000623_48379_49566 392
329 3300048924 Ga0496121_0000142 Ga0496121_0000142_122738_123925 392
330 3300048925 Ga0496122_0002347 Ga0496122_0002347_25876_27063 392
331 3300048926 Ga0496123_0000434 Ga0496123_0000434_13941_15128 392
332 3300048928 Ga0496125_0196272 Ga0496125_0196272_103_1290 392
333 3300049569 Ga0501032_0011286 Ga0501032_0011286_1764_2948 392
334 3300049580 Ga0501046_0013243 Ga0501046_0013243_2781_3965 392
335 3300049742 Ga0501080_0010465 Ga0501080_0010465_5547_6731 392
336 iso_pu_bacteria 2585428106 2587918631 392
337 iso_pu_bacteria 2593339238 2595446171 392
338 iso_pu_bacteria 2643221562 2643830400 392
339 iso_pu_bacteria 2643221640 2644224804 392
340 iso_pu_bacteria 2643221642 2644234262 392
341 iso_pu_bacteria 2718218334 2721026478 392
342 iso_pu_bacteria 2734482264 2735833524 392
343 iso_pu_bacteria 2738543009 2739229658 392
344 iso_pu_bacteria 2818991440 2819563999 392
345 iso_pu_bacteria 2842914999 2842917550 392
346 iso_pu_bacteria 2842918807 2842919919 392
347 iso_pu_bacteria 2884338543 2884341525 392
348 iso_pu_bacteria 2904463128 2904464635 392
349 iso_pu_bacteria 2919085039 2919088282 392
350 iso_pu_bacteria 2941471342 2941472972 392
351 iso_pu_bacteria 2953994433 2953995217 392
352 3300046660 Ga0495625_0014112 Ga0495625_0014112_2328_3512 393
353 3300009011 Ga0105251_10000421 Ga0105251_1000042138 394
354 3300009036 Ga0105244_10025832 Ga0105244_100258323 394
355 3300009148 Ga0105243_10132297 Ga0105243_101322971 394
356 3300025728 Ga0207655_1000021 Ga0207655_1000021184 394
357 3300025735 Ga0207713_1003462 Ga0207713_100346210 394
358 3300025935 Ga0207709_10074843 Ga0207709_100748432 394
359 3300028563 Ga0265319_1005829 Ga0265319_10058294 394
360 3300028577 Ga0265318_10000878 Ga0265318_1000087814 394
361 3300028800 Ga0265338_10008934 Ga0265338_100089343 394
362 3300028800 Ga0265338_10054170 Ga0265338_100541702 394
363 3300031235 Ga0265330_10002606 Ga0265330_100026068 394
364 3300031238 Ga0265332_10002933 Ga0265332_100029337 394
365 3300031239 Ga0265328_10000254 Ga0265328_100002543 394
366 3300031239 Ga0265328_10000321 Ga0265328_100003215 394
367 3300031240 Ga0265320_10002076 Ga0265320_100020762 394
368 3300031240 Ga0265320_10062639 Ga0265320_100626392 394
369 3300031242 Ga0265329_10005103 Ga0265329_100051032 394
370 3300031249 Ga0265339_10003964 Ga0265339_100039644 394
371 3300031249 Ga0265339_10051066 Ga0265339_100510662 394
372 3300031250 Ga0265331_10000762 Ga0265331_1000076217 394
373 3300031344 Ga0265316_10003383 Ga0265316_100033834 394
374 3300031595 Ga0265313_10011614 Ga0265313_100116142 394
375 3300031711 Ga0265314_10006313 Ga0265314_100063138 394
376 3300031711 Ga0265314_10017420 Ga0265314_100174202 394
377 3300031712 Ga0265342_10003566 Ga0265342_100035669 394
378 3300031712 Ga0265342_10004501 Ga0265342_100045014 394
379 3300037853 Ga0436364_0347636 Ga0436364_0347636_194_1384 394
380 3300039437 Ga0436365_0983980 Ga0436365_0983980_79_1269 394
381 3300048907 Ga0496104_0164587 Ga0496104_0164587_221_1411 394
382 3300048916 Ga0496113_0090038 Ga0496113_0090038_809_1999 394
383 3300049460 Ga0495682_0000134 Ga0495682_0000134_12072_13271 394
384 3300053077 Ga0495601_0227837 Ga0495601_0227837_14_1204 394
385 3300002705 JGI25156J39149_1007901 JGI25156J39149_10079012 395
386 3300002737 JGI25162J39368_1000260 JGI25162J39368_100026049 395
387 3300002737 JGI25162J39368_1002803 JGI25162J39368_10028033 395
388 3300002737 JGI25162J39368_1003520 JGI25162J39368_10035201 395
389 3300002741 JGI25157J39369_1000867 JGI25157J39369_100086712 395
390 3300002771 JGI25163J39215_1002334 JGI25163J39215_10023341 395
391 3300002772 JGI25164J39214_1000133 JGI25164J39214_100013325 395
392 3300002772 JGI25164J39214_1000213 JGI25164J39214_100021315 395
393 3300003214 JGI25165J46597_1000255 JGI25165J46597_100025525 395
394 3300003214 JGI25165J46597_1004667 JGI25165J46597_10046674 395
395 3300003751 Ga0055538_1000340 Ga0055538_100034017 395
396 3300003760 Ga0055527_1004950 Ga0055527_10049502 395
397 3300003761 Ga0055535_1000349 Ga0055535_100034926 395
398 3300003761 Ga0055535_1001910 Ga0055535_10019101 395
399 3300003761 Ga0055535_1001965 Ga0055535_10019659 395
400 3300003762 Ga0055542_1000082 Ga0055542_1000082125 395
401 3300003762 Ga0055542_1000327 Ga0055542_100032749 395
402 3300003762 Ga0055542_1000375 Ga0055542_100037526 395
403 3300003763 Ga0055529_1000228 Ga0055529_100022825 395
404 3300003856 Ga0058692_1000097 Ga0058692_100009724 395
405 3300005340 Ga0070689_100004531 Ga0070689_1000045315 395
406 3300013306 Ga0163162_10073551 Ga0163162_100735512 395
407 3300025207 Ga0209760_100727 Ga0209760_1007276 395
408 3300025224 Ga0209784_100133 Ga0209784_10013349 395
409 3300025228 Ga0209672_100841 Ga0209672_10084118 395
410 3300025228 Ga0209672_102342 Ga0209672_1023425 395
411 3300025228 Ga0209672_105200 Ga0209672_1052002 395
412 3300025231 Ga0207427_100013 Ga0207427_100013234 395
413 3300025231 Ga0207427_100221 Ga0207427_10022134 395
414 3300025233 Ga0209437_100015 Ga0209437_100015303 395
415 3300025233 Ga0209437_100020 Ga0209437_100020259 395
416 3300025233 Ga0209437_100106 Ga0209437_100106201 395
417 3300025242 Ga0209258_100413 Ga0209258_1004139 395
418 3300025242 Ga0209258_100444 Ga0209258_10044415 395
419 3300025242 Ga0209258_100991 Ga0209258_1009916 395
420 3300025246 Ga0209646_1001493 Ga0209646_10014935 395
421 3300025250 Ga0209026_1000092 Ga0209026_100009249 395
422 3300025254 Ga0209148_1000002 Ga0209148_10000021729 395
423 3300025254 Ga0209148_1000010 Ga0209148_1000010611 395
424 3300025254 Ga0209148_1000087 Ga0209148_100008726 395
425 3300025256 Ga0209759_1000278 Ga0209759_100027825 395
426 3300025261 Ga0209233_1000009 Ga0209233_1000009560 395
427 3300025261 Ga0209233_1000020 Ga0209233_1000020366 395
428 3300025261 Ga0209233_1014060 Ga0209233_10140602 395
429 3300025272 Ga0209455_1000120 Ga0209455_100012010 395
430 3300025272 Ga0209455_1010962 Ga0209455_10109622 395
431 3300025299 Ga0209256_1022342 Ga0209256_10223422 395
432 3300025936 Ga0207670_10005647 Ga0207670_100056473 395
433 3300027312 Ga0209371_1000209 Ga0209371_100020932 395
434 3300030500 Ga0268256_1000167 Ga0268256_100016742 395
435 3300041452 Ga0451793_0005684 Ga0451793_0005684_330_1520 395
436 3300041459 Ga0451800_0259382 Ga0451800_0259382_267_1457 395
437 3300041462 Ga0451806_066390 Ga0451806_066390_4822_6012 395
438 3300041463 Ga0451804_1082700 Ga0451804_1082700_330_1520 395
439 3300041486 Ga0451807_1908561 Ga0451807_1908561_330_1520 395
440 3300046460 Ga0495638_0000065 Ga0495638_0000065_4783_5985 395
441 3300046460 Ga0495638_0000094 Ga0495638_0000094_137708_138910 395
442 3300046471 Ga0495650_0000078 Ga0495650_0000078_6337_7539 395
443 3300046507 Ga0495606_0001012 Ga0495606_0001012_14330_15532 395
444 3300046660 Ga0495625_0026251 Ga0495625_0026251_50_1252 395
445 3300046694 Ga0495649_0015687 Ga0495649_0015687_1842_3044 395
446 3300047472 Ga0495686_0035573 Ga0495686_0035573_139_1368 395
447 3300048918 Ga0496115_0005442 Ga0496115_0005442_4690_5892 395
448 3300048918 Ga0496115_0020292 Ga0496115_0020292_1184_2386 395
449 3300048921 Ga0496118_0029221 Ga0496118_0029221_2837_4027 395
450 3300048929 Ga0496126_0059165 Ga0496126_0059165_2041_3231 395
451 3300048929 Ga0496126_0101027 Ga0496126_0101027_48_1250 395
452 3300053093 Ga0500651_0000788 Ga0500651_0000788_4635_5825 395
453 3300053156 Ga0500622_0000984 Ga0500622_0000984_1729_2919 395
454 3300001904 JGI24736J21556_1001101 JGI24736J21556_10011012 396
455 3300010375 Ga0105239_10014668 Ga0105239_100146686 396
456 3300013104 Ga0157370_10000407 Ga0157370_1000040741 396
457 3300013104 Ga0157370_10208461 Ga0157370_102084612 396
458 3300013105 Ga0157369_10000080 Ga0157369_100000809 396
459 3300015265 Ga0182005_1000028 Ga0182005_100002899 396
460 3300017792 Ga0163161_10021567 Ga0163161_100215675 396
461 3300025226 Ga0209674_100439 Ga0209674_1004392 396
462 3300025904 Ga0207647_10000342 Ga0207647_1000034210 396
463 3300044735 Ga0466968_0033802 Ga0466968_0033802_706_1896 396
464 3300046452 Ga0495617_000427 Ga0495617_000427_12759_13949 396
465 3300046501 Ga0495607_0001322 Ga0495607_0001322_12489_13679 396
466 3300046501 Ga0495607_0004681 Ga0495607_0004681_939_2129 396
467 3300046513 Ga0495616_0016081 Ga0495616_0016081_341_1531 396
468 3300046515 Ga0495620_0000867 Ga0495620_0000867_11926_13116 396
469 3300046660 Ga0495625_0000022 Ga0495625_0000022_46161_47351 396
470 3300048903 Ga0496100_0001485 Ga0496100_0001485_3096_4286 396
471 3300048904 Ga0496101_0001076 Ga0496101_0001076_11914_13104 396
472 3300048924 Ga0496121_0000372 Ga0496121_0000372_84053_85243 396
473 3300048925 Ga0496122_0020315 Ga0496122_0020315_144_1334 396
474 3300048925 Ga0496122_0023921 Ga0496122_0023921_1936_3126 396
475 3300048926 Ga0496123_0004626 Ga0496123_0004626_8394_9584 396
476 3300048927 Ga0496124_0000289 Ga0496124_0000289_63747_64937 396
477 3300048927 Ga0496124_0001096 Ga0496124_0001096_12114_13304 396
478 3300048929 Ga0496126_0204515 Ga0496126_0204515_421_1611 396
479 3300049459 Ga0495678_001184 Ga0495678_001184_15521_16711 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21018

BipA_C

TypA/BipA C-terminal domain

390

454

0.96

PF07394

DUF1501

Protein of unknown function (DUF1501)

33

389

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ely-assembly1.cif.gz_B e. coli alkaline phosphatase mutant (s102c) 0.6385 234 330
4lrb-assembly1.cif.gz_A phosphopentomutase s154g variant soaked with 2,3-dideoxyribose 5-phosphate 0.6081 132 396
3uo0-assembly2.cif.gz_B phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate 0.5944 132 396
4yr1-assembly1.cif.gz_B crystal structure of e. coli alkaline phosphatase d101a/d153a in complex with inorganic phosphate 0.5836 234 330
3un3-assembly3.cif.gz_C phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate 0.5809 132 377
ID Description Score Start End Superfamily
af_Q60DG6_84_389_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.6766 231 288 3.40.800.20
2zktA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6452 30 332 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5825 30 329 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5776 30 329 3.40.720.10
af_P40367_51_359_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.568 31 377 3.40.720.10
ID Description Score Start End GO Terms
AF-E6PMG4-F1-model_v4 Protein containing DUF1501 0.9534 236 396
AF-A0A522M5D3-F1-model_v4 DUF1501 domain-containing protein 0.9496 279 396
AF-A0A522M5D3-F1-model_v4 DUF1501 domain-containing protein 0.9341 279 396
AF-E6PMG4-F1-model_v4 Protein containing DUF1501 0.9308 236 396
AF-A0A5C7A6J0-F1-model_v4 DUF1501 domain-containing protein 0.8946 11 396

Feature Viewer

pLDDT pTM Quality
79.69 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map