F451974

General Info

Members Datasets Scaffolds Average Seq Length
478 282 956 282

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8020945358|8020946606
Length 321
Sequence FDYSLETAPSKVALWGRGSRLVPSPPHAAFDFQRKGTTMQDVTLNNGMKMPIVGYGVFQIADEAECERCVVDAVQAGYRLIDTAASYKNEQAVGRGLKRCGVPRDQLFVTSKLWVEDAGYERACVAIDKSLKRLGLDYLDLFLIHQPFSDVHGAWRAMEEALRAGKLRAIGLSNFHPDRLMDIACFNEVTPAVNQIEVNPFHQQHESVDFMRGLGVQPEAWAPFAEGRNNLFDNAQLVAIAQRHGKTVGQVVLRWVVQRGIVALAKSVRKERMLENLAVFDFELSAEDMQAIATLETGTSSFFSHRDPAIVTWMSERKLGL

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
235 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
236 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
237 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
238 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
239 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
240 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
241 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
242 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
243 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
244 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
245 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
246 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
247 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
248 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
249 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
250 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
251 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
252 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
253 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
254 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
255 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
256 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
257 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
258 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
259 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
260 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
261 2636415599 Klebsiella variicola DX120E Isolate Unclassified
262 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
263 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
264 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
265 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
266 2885198086 Variovorax sp. 679 Isolate Unclassified
267 2885211737 Variovorax sp. 553 Isolate Unclassified
268 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
269 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
270 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
271 2919150387 Rahnella aceris 1817 Isolate Unclassified
272 2927143783 Rahnella sp. 2050 Isolate Unclassified
273 2928070936 Variovorax gossypii 1167 Isolate Unclassified
274 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
275 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
276 8018221730 Enterobacter sp. CM29 Isolate Unclassified
277 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
278 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
279 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
280 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
281 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
282 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.17
Metatranscriptomes 0
Isolates 9.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 1.46
Rhizoplane 4.81
Rhizosphere 80.13
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10018417 3300002067 Bacteria 2153
2 JGI25162J39368_1000002 3300002737 Bacteria 663004
3 JGI25163J39215_1000043 3300002771 Bacteria 55468
4 JGI25164J39214_1000066 3300002772 Bacteria 106367
5 Ga0055538_1000003 3300003751 Bacteria 663004
6 Ga0055539_1000003 3300003752 Bacteria 663004
7 Ga0055533_1000005 3300003756 Bacteria 663004
8 Ga0055525_1000005 3300003759 Bacteria 663004
9 Ga0055541_1000003 3300003841 Bacteria 663004
10 Ga0058692_1001201 3300003856 Bacteria 9924
11 Ga0070658_10016570 3300005327 Bacteria 5898
12 Ga0070676_10020404 3300005328 Bacteria 3699
13 Ga0068869_100205924 3300005334 Bacteria 1553
14 Ga0070666_10035604 3300005335 Bacteria 3302
15 Ga0068868_100031621 3300005338 Bacteria 4068
16 Ga0070689_100110668 3300005340 Bacteria 2184
17 Ga0070668_100035365 3300005347 Bacteria 3809
18 Ga0070669_100089040 3300005353 Bacteria 2311
19 Ga0070675_100224944 3300005354 Bacteria 1635
20 Ga0070671_100053650 3300005355 Bacteria 3351
21 Ga0070673_100125126 3300005364 Unclassified 2150
22 Ga0070667_100002412 3300005367 Bacteria 16341
23 Ga0070700_100026479 3300005441 Unclassified 3425
24 Ga0070694_100063077 3300005444 Bacteria 2533
25 Ga0070708_100080707 3300005445 Bacteria 2944
26 Ga0070678_100082154 3300005456 Bacteria 2445
27 Ga0068867_100131276 3300005459 Bacteria 1947
28 Ga0070707_100029822 3300005468 Bacteria 5191
29 Ga0070698_100356719 3300005471 Bacteria 1394
30 Ga0070699_100095955 3300005518 Bacteria 2597
31 Ga0068853_100000022 3300005539 Bacteria 142647
32 Ga0068853_100017257 3300005539 Bacteria 5958
33 Ga0070672_100067812 3300005543 Bacteria 2828
34 Ga0070693_100104703 3300005547 Bacteria 1730
35 Ga0070665_100000189 3300005548 Bacteria 109948
36 Ga0068855_100000057 3300005563 Bacteria 134898
37 Ga0068854_100006907 3300005578 Bacteria 7239
38 Ga0068854_100105446 3300005578 Bacteria 2119
39 Ga0068852_100151966 3300005616 Bacteria 2154
40 Ga0068859_100027825 3300005617 Bacteria 5671
41 Ga0068861_100058224 3300005719 Bacteria 2954
42 Ga0068851_10021213 3300005834 Bacteria 3154
43 Ga0068863_100320079 3300005841 Bacteria 1506
44 Ga0068858_100164475 3300005842 Bacteria 2090
45 Ga0068860_100085284 3300005843 Bacteria 3005
46 Ga0068860_100104191 3300005843 Bacteria 2708
47 Ga0068862_100052318 3300005844 Bacteria 3494
48 Ga0075363_100009079 3300006048 Bacteria 4666
49 Ga0075364_10002946 3300006051 Bacteria 9598
50 Ga0075362_10001544 3300006177 Bacteria 7426
51 Ga0075366_10009739 3300006195 Bacteria 5372
52 Ga0097621_100072715 3300006237 Bacteria 2845
53 Ga0097621_100277976 3300006237 Unclassified 1473
54 Ga0097621_100288107 3300006237 Bacteria 1447
55 Ga0075370_10008336 3300006353 Bacteria 5329
56 Ga0068871_100077906 3300006358 Bacteria 2740
57 Ga0075428_100000804 3300006844 Bacteria 32771
58 Ga0075431_100551272 3300006847 Unclassified 1140
59 Ga0068865_100138666 3300006881 Bacteria 1831
60 Ga0097620_100027825 3300006931 Bacteria 5671
61 Ga0079104_1000007 3300006946 Bacteria 390531
62 Ga0079104_1000357 3300006946 Bacteria 55345
63 Ga0079104_1005779 3300006946 Bacteria 4849
64 Ga0105251_10000086 3300009011 Bacteria 88725
65 Ga0105251_10000529 3300009011 Bacteria 36039
66 Ga0105251_10029351 3300009011 Bacteria 2770
67 Ga0105251_10032635 3300009011 Bacteria 2593
68 Ga0105251_10059929 3300009011 Bacteria 1794
69 Ga0105251_10059947 3300009011 Bacteria 1793
70 Ga0105244_10000137 3300009036 Bacteria 75679
71 Ga0105244_10000407 3300009036 Bacteria 40132
72 Ga0105244_10001832 3300009036 Bacteria 16628
73 Ga0105244_10006547 3300009036 Bacteria 7514
74 Ga0105244_10024205 3300009036 Bacteria 3316
75 Ga0105244_10070649 3300009036 Bacteria 1742
76 Ga0105250_10000070 3300009092 Bacteria 96227
77 Ga0105250_10000616 3300009092 Bacteria 23145
78 Ga0105250_10003238 3300009092 Bacteria 7757
79 Ga0105240_10001236 3300009093 Bacteria 44352
80 Ga0105240_10005357 3300009093 Bacteria 19140
81 Ga0105240_10063438 3300009093 Bacteria 4596
82 Ga0105240_10240310 3300009093 Bacteria 2100
83 Ga0111539_10000002 3300009094 Bacteria 983359
84 Ga0105243_10001502 3300009148 Bacteria 20406
85 Ga0105241_10167575 3300009174 Bacteria 1811
86 Ga0105248_10009543 3300009177 Bacteria 10680
87 Ga0105248_10016120 3300009177 Bacteria 8224
88 Ga0105248_10189668 3300009177 Bacteria 2316
89 Ga0105237_10005513 3300009545 Bacteria 14262
90 Ga0105237_10482631 3300009545 Bacteria 1246
91 Ga0105238_10019345 3300009551 Bacteria 6934
92 Ga0105239_10000026 3300010375 Bacteria 248302
93 Ga0105239_10000259 3300010375 Bacteria 78760
94 Ga0105239_10333479 3300010375 Bacteria 1711
95 Ga0105246_10000013 3300011119 Bacteria 67142
96 Ga0105246_10189752 3300011119 Bacteria 1590
97 Ga0157373_10000541 3300013100 Bacteria 29567
98 Ga0157373_10001081 3300013100 Bacteria 20989
99 Ga0157373_10016380 3300013100 Bacteria 5409
100 Ga0157371_10003279 3300013102 Bacteria 14838
101 Ga0157370_10000596 3300013104 Bacteria 45119
102 Ga0157369_10005711 3300013105 Bacteria 14453
103 Ga0163162_10048322 3300013306 Bacteria 4262
104 Ga0163162_10240992 3300013306 Bacteria 1939
105 Ga0157372_10004147 3300013307 Bacteria 15519
106 Ga0163163_10001459 3300014325 Bacteria 19984
107 Ga0163163_10020820 3300014325 Bacteria 6183
108 Ga0157380_10013228 3300014326 Bacteria 6011
109 Ga0157379_10008607 3300014968 Bacteria 8881
110 Ga0157376_10003954 3300014969 Bacteria 10254
111 Ga0213876_10016101 3300021384 Bacteria 3954
112 Ga0209760_100005 3300025207 Bacteria 238315
113 Ga0209784_100001 3300025224 Bacteria 3600592
114 Ga0209566_100001 3300025225 Bacteria 3600765
115 Ga0209674_100002 3300025226 Bacteria 3600592
116 Ga0209563_100002 3300025230 Bacteria 2045675
117 Ga0207427_100009 3300025231 Bacteria 663036
118 Ga0209437_100001 3300025233 Bacteria 2045675
119 Ga0209677_100002 3300025253 Bacteria 2045675
120 Ga0209759_1000739 3300025256 Bacteria 28453
121 Ga0209051_1004546 3300025303 Bacteria 8504
122 Ga0207656_10066730 3300025321 Bacteria 1591
123 Ga0207696_1000038 3300025711 Bacteria 328221
124 Ga0207696_1000409 3300025711 Bacteria 40065
125 Ga0207696_1000944 3300025711 Bacteria 17786
126 Ga0207696_1003255 3300025711 Bacteria 7495
127 Ga0207696_1032462 3300025711 Bacteria 1571
128 Ga0207696_1043234 3300025711 Bacteria 1311
129 Ga0207655_1000001 3300025728 Bacteria 1866413
130 Ga0207655_1000002 3300025728 Bacteria 1148694
131 Ga0207655_1000050 3300025728 Bacteria 294923
132 Ga0207655_1000218 3300025728 Bacteria 98543
133 Ga0207655_1000673 3300025728 Bacteria 40069
134 Ga0207655_1001263 3300025728 Bacteria 24122
135 Ga0207655_1006728 3300025728 Bacteria 7570
136 Ga0207655_1020027 3300025728 Bacteria 3465
137 Ga0207655_1032257 3300025728 Bacteria 2396
138 Ga0207655_1038342 3300025728 Bacteria 2095
139 Ga0207713_1000002 3300025735 Bacteria 1061749
140 Ga0207713_1000155 3300025735 Bacteria 102677
141 Ga0207713_1000191 3300025735 Bacteria 85634
142 Ga0207713_1002406 3300025735 Bacteria 13664
143 Ga0207713_1005935 3300025735 Bacteria 7537
144 Ga0207713_1027646 3300025735 Bacteria 2573
145 Ga0207713_1036786 3300025735 Bacteria 2095
146 Ga0207680_10012212 3300025903 Bacteria 4370
147 Ga0207684_10030210 3300025910 Bacteria 4614
148 Ga0207695_10000301 3300025913 Bacteria 121221
149 Ga0207695_10008174 3300025913 Bacteria 13145
150 Ga0207695_10067669 3300025913 Bacteria 3662
151 Ga0207695_10146124 3300025913 Bacteria 2308
152 Ga0207671_10002197 3300025914 Bacteria 21174
153 Ga0207671_10012115 3300025914 Bacteria 6963
154 Ga0207693_10165107 3300025915 Bacteria 1743
155 Ga0207663_10002715 3300025916 Bacteria 8527
156 Ga0207646_10054795 3300025922 Bacteria 3566
157 Ga0207659_10315113 3300025926 Bacteria 1289
158 Ga0207687_10015722 3300025927 Bacteria 4966
159 Ga0207644_10045866 3300025931 Bacteria 3111
160 Ga0207644_10089974 3300025931 Bacteria 2286
161 Ga0207709_10000112 3300025935 Bacteria 127357
162 Ga0207709_10121768 3300025935 Bacteria 1762
163 Ga0207691_10019751 3300025940 Bacteria 6371
164 Ga0207691_10137938 3300025940 Bacteria 2150
165 Ga0207711_10049225 3300025941 Bacteria 3608
166 Ga0207711_10089921 3300025941 Bacteria 2698
167 Ga0207689_10135598 3300025942 Bacteria 2027
168 Ga0207667_10000355 3300025949 Bacteria 62384
169 Ga0207651_10018127 3300025960 Bacteria 4181
170 Ga0207712_10085493 3300025961 Bacteria 2308
171 Ga0207668_10035907 3300025972 Bacteria 3305
172 Ga0207658_10085063 3300025986 Bacteria 2435
173 Ga0207677_10032638 3300026023 Bacteria 3350
174 Ga0207703_10047747 3300026035 Bacteria 3453
175 Ga0207703_10217067 3300026035 Bacteria 1708
176 Ga0207639_10000002 3300026041 Bacteria 903066
177 Ga0207639_10247459 3300026041 Bacteria 1553
178 Ga0207641_10275626 3300026088 Bacteria 1580
179 Ga0207648_10105139 3300026089 Bacteria 2476
180 Ga0207676_10034874 3300026095 Bacteria 3812
181 Ga0207675_100083230 3300026118 Bacteria 3001
182 Ga0207683_10093019 3300026121 Bacteria 2687
183 Ga0207683_10110767 3300026121 Bacteria 2458
184 Ga0207698_10229118 3300026142 Bacteria 1685
185 Ga0209281_1000003 3300027111 Bacteria 1260089
186 Ga0209281_1000020 3300027111 Bacteria 575972
187 Ga0209281_1000021 3300027111 Bacteria 541033
188 Ga0209281_1000630 3300027111 Bacteria 39048
189 Ga0209371_1000017 3300027312 Bacteria 625776
190 Ga0209371_1001607 3300027312 Bacteria 14687
191 Ga0207428_10000004 3300027907 Bacteria 727800
192 Ga0268266_10000180 3300028379 Bacteria 112295
193 Ga0268264_10063974 3300028381 Bacteria 3095
194 Ga0307515_10182506 3300028794 Bacteria 2042
195 Ga0268256_1000036 3300030500 Bacteria 370250
196 Ga0268256_1001390 3300030500 Bacteria 14687
197 Ga0265331_10039212 3300031250 Bacteria 2311
198 Ga0265327_10006949 3300031251 Bacteria 8895
199 Ga0307509_10118684 3300031507 Bacteria 2628
200 Ga0307508_10113099 3300031616 Bacteria 2315
201 Ga0307416_100082167 3300032002 Bacteria 2728
202 Ga0307414_10035275 3300032004 Bacteria 3327
203 Ga0307414_10056256 3300032004 Bacteria 2758
204 Ga0373935_0188116 3300035692 Bacteria 1421
205 Ga0373927_0031013 3300035695 Bacteria 3487
206 Ga0373933_0012835 3300035724 Bacteria 4633
207 Ga0373937_0150794 3300036401 Bacteria 2178
208 Ga0373925_0002283 3300037068 Bacteria 15512
209 Ga0436365_0203066 3300039437 Bacteria 111457
210 Ga0436361_1162917 3300039447 Bacteria 1356
211 Ga0453683_0063127 3300044673 Bacteria 2316
212 Ga0453684_0000065 3300044712 Bacteria 468481
213 Ga0495617_000741 3300046452 Bacteria 16051
214 Ga0495617_001256 3300046452 Bacteria 11386
215 Ga0495617_001329 3300046452 Bacteria 11000
216 Ga0495603_0123552 3300046455 Bacteria 1508
217 Ga0495603_0173915 3300046455 Bacteria 1247
218 Ga0495591_000545 3300046458 Bacteria 28926
219 Ga0495591_001032 3300046458 Bacteria 18849
220 Ga0495591_002180 3300046458 Bacteria 11208
221 Ga0495629_0041881 3300046459 Bacteria 3219
222 Ga0495638_0000477 3300046460 Bacteria 48044
223 Ga0495638_0069984 3300046460 Unclassified 2149
224 Ga0495653_0066333 3300046463 Bacteria 2715
225 Ga0495653_0079528 3300046463 Bacteria 2428
226 Ga0495650_0000031 3300046471 Bacteria 433811
227 Ga0495650_0000510 3300046471 Bacteria 57886
228 Ga0495650_0004885 3300046471 Bacteria 8968
229 Ga0495580_0004911 3300046472 Bacteria 11183
230 Ga0495580_0037276 3300046472 Bacteria 3491
231 Ga0495582_0007033 3300046473 Bacteria 6256
232 Ga0495605_0001664 3300046474 Bacteria 14288
233 Ga0495605_0003077 3300046474 Bacteria 10066
234 Ga0495605_0003782 3300046474 Bacteria 8982
235 Ga0495605_0011875 3300046474 Bacteria 4845
236 Ga0495605_0013945 3300046474 Bacteria 4413
237 Ga0495605_0022487 3300046474 Bacteria 3330
238 Ga0495605_0032449 3300046474 Bacteria 2658
239 Ga0495605_0090607 3300046474 Bacteria 1417
240 Ga0495639_0158525 3300046475 Bacteria 1094
241 Ga0495584_0000306 3300046491 Bacteria 34682
242 Ga0495584_0000761 3300046491 Bacteria 21314
243 Ga0495584_0004731 3300046491 Bacteria 7286
244 Ga0495584_0042962 3300046491 Bacteria 2282
245 Ga0495585_0020870 3300046492 Bacteria 3763
246 Ga0495585_0161457 3300046492 Bacteria 1163
247 Ga0495594_0035112 3300046499 Bacteria 2730
248 Ga0495596_0000174 3300046500 Bacteria 44820
249 Ga0495596_0001576 3300046500 Bacteria 13010
250 Ga0495596_0032846 3300046500 Bacteria 2067
251 Ga0495596_0065816 3300046500 Bacteria 1409
252 Ga0495607_0001336 3300046501 Bacteria 22014
253 Ga0495607_0018181 3300046501 Bacteria 4487
254 Ga0495607_0022979 3300046501 Bacteria 3908
255 Ga0495607_0038071 3300046501 Bacteria 2883
256 Ga0495607_0041443 3300046501 Bacteria 2735
257 Ga0495607_0052976 3300046501 Bacteria 2347
258 Ga0495583_0000014 3300046506 Bacteria 320136
259 Ga0495583_0000093 3300046506 Bacteria 158708
260 Ga0495583_0000160 3300046506 Bacteria 113560
261 Ga0495583_0010191 3300046506 Bacteria 5514
262 Ga0495606_0003718 3300046507 Bacteria 15922
263 Ga0495606_0017522 3300046507 Bacteria 5411
264 Ga0495610_0032347 3300046512 Bacteria 2718
265 Ga0495616_0014322 3300046513 Bacteria 4442
266 Ga0495616_0022853 3300046513 Bacteria 3372
267 Ga0495616_0023537 3300046513 Bacteria 3312
268 Ga0495616_0026631 3300046513 Bacteria 3074
269 Ga0495620_0001627 3300046515 Bacteria 13296
270 Ga0495620_0041513 3300046515 Bacteria 2017
271 Ga0495628_0233547 3300046516 Bacteria 1378
272 Ga0495631_0000952 3300046518 Bacteria 18022
273 Ga0495631_0006098 3300046518 Bacteria 6254
274 Ga0495631_0013727 3300046518 Bacteria 3924
275 Ga0495631_0092018 3300046518 Bacteria 1305
276 Ga0495643_0006722 3300046522 Bacteria 7526
277 Ga0495644_0000156 3300046523 Bacteria 32480
278 Ga0495644_0010940 3300046523 Bacteria 3496
279 Ga0495644_0026208 3300046523 Bacteria 2212
280 Ga0495644_0047986 3300046523 Bacteria 1603
281 Ga0495648_0000653 3300046524 Bacteria 37038
282 Ga0495648_0001000 3300046524 Bacteria 29021
283 Ga0495648_0005141 3300046524 Bacteria 10948
284 Ga0495648_0013990 3300046524 Bacteria 5902
285 Ga0495648_0031972 3300046524 Bacteria 3460
286 Ga0495648_0043334 3300046524 Bacteria 2822
287 Ga0495663_0000436 3300046525 Bacteria 15263
288 Ga0495666_0088061 3300046526 Bacteria 1466
289 Ga0495642_0024347 3300046528 Bacteria 2394
290 Ga0495642_0027303 3300046528 Bacteria 2271
291 Ga0495642_0027912 3300046528 Bacteria 2246
292 Ga0495642_0030879 3300046528 Bacteria 2146
293 Ga0495652_0125952 3300046529 Bacteria 2035
294 Ga0495654_0000069 3300046530 Bacteria 120853
295 Ga0495654_0000248 3300046530 Bacteria 49843
296 Ga0495665_0070101 3300046531 Bacteria 1847
297 Ga0495609_0000690 3300046538 Bacteria 26016
298 Ga0495609_0002554 3300046538 Bacteria 11124
299 Ga0495609_0043742 3300046538 Bacteria 2010
300 Ga0495597_0000517 3300046542 Bacteria 31992
301 Ga0495597_0002978 3300046542 Bacteria 10254
302 Ga0495597_0119334 3300046542 Bacteria 1100
303 Ga0495645_0052705 3300046543 Bacteria 2959
304 Ga0495622_0034743 3300046557 Bacteria 2352
305 Ga0495622_0036617 3300046557 Bacteria 2287
306 Ga0495622_0055760 3300046557 Bacteria 1832
307 Ga0495633_0000214 3300046558 Bacteria 72530
308 Ga0495633_0014138 3300046558 Bacteria 4183
309 Ga0495633_0030818 3300046558 Bacteria 2603
310 Ga0495668_0010746 3300046616 Bacteria 5527
311 Ga0495668_0016001 3300046616 Bacteria 4368
312 Ga0495668_0019813 3300046616 Bacteria 3871
313 Ga0495668_0023795 3300046616 Bacteria 3488
314 Ga0495611_0001169 3300046648 Bacteria 13683
315 Ga0495611_0002335 3300046648 Bacteria 8765
316 Ga0495611_0012489 3300046648 Bacteria 3610
317 Ga0495611_0029938 3300046648 Bacteria 2390
318 Ga0495625_0000728 3300046660 Bacteria 46253
319 Ga0495625_0004537 3300046660 Bacteria 13086
320 Ga0495625_0011624 3300046660 Bacteria 7161
321 Ga0495625_0086921 3300046660 Bacteria 2168
322 Ga0495625_0099524 3300046660 Bacteria 1999
323 Ga0495659_0003028 3300046664 Bacteria 5391
324 Ga0495661_0000843 3300046665 Bacteria 28565
325 Ga0495661_0012177 3300046665 Bacteria 5809
326 Ga0495661_0029679 3300046665 Bacteria 3488
327 Ga0495661_0032010 3300046665 Bacteria 3328
328 Ga0495661_0048259 3300046665 Bacteria 2588
329 Ga0495588_0013302 3300046674 Bacteria 3918
330 Ga0495588_0018301 3300046674 Bacteria 3414
331 Ga0495646_0003450 3300046680 Bacteria 9836
332 Ga0495647_0019529 3300046681 Bacteria 2424
333 Ga0495670_0013315 3300046691 Bacteria 4045
334 Ga0495670_0051764 3300046691 Bacteria 2055
335 Ga0495670_0060954 3300046691 Bacteria 1896
336 Ga0495671_0000418 3300046692 Bacteria 33868
337 Ga0495671_0000446 3300046692 Bacteria 32728
338 Ga0495671_0144987 3300046692 Bacteria 1156
339 Ga0495649_0000245 3300046694 Bacteria 47917
340 Ga0495649_0000704 3300046694 Bacteria 27306
341 Ga0495649_0002899 3300046694 Bacteria 11875
342 Ga0495649_0019004 3300046694 Bacteria 3861
343 Ga0495589_0024759 3300046794 Bacteria 3049
344 Ga0495589_0032674 3300046794 Bacteria 2616
345 Ga0495589_0038439 3300046794 Bacteria 2395
346 Ga0495600_0168444 3300046809 Bacteria 1415
347 Ga0495600_0355372 3300046809 Bacteria 917
348 Ga0495660_0000016 3300046810 Bacteria 321859
349 Ga0495660_0000153 3300046810 Bacteria 74797
350 Ga0495660_0016912 3300046810 Bacteria 4201
351 Ga0495660_0024802 3300046810 Bacteria 3413
352 Ga0495660_0050221 3300046810 Bacteria 2273
353 Ga0495604_0097530 3300047317 Bacteria 2167
354 Ga0495604_0189682 3300047317 Bacteria 1433
355 Ga0495672_0000001 3300047320 Bacteria 1458820
356 Ga0495672_0000372 3300047320 Bacteria 55920
357 Ga0495672_0013302 3300047320 Bacteria 5684
358 Ga0495683_0007096 3300047323 Bacteria 6082
359 Ga0495683_0010593 3300047323 Bacteria 4865
360 Ga0495683_0042769 3300047323 Bacteria 2284
361 Ga0495683_0050963 3300047323 Bacteria 2071
362 Ga0495687_000334 3300047443 Bacteria 60345
363 Ga0495687_000982 3300047443 Bacteria 28711
364 Ga0495687_013230 3300047443 Bacteria 4318
365 Ga0495687_044301 3300047443 Bacteria 1935
366 Ga0495677_0001353 3300047445 Bacteria 9787
367 Ga0495677_0007145 3300047445 Bacteria 4182
368 Ga0495677_0008986 3300047445 Bacteria 3696
369 Ga0495677_0020164 3300047445 Bacteria 2417
370 Ga0495677_0029611 3300047445 Bacteria 1991
371 Ga0495677_0136492 3300047445 Bacteria 940
372 Ga0495679_000590 3300047446 Bacteria 24982
373 Ga0495679_002819 3300047446 Bacteria 8622
374 Ga0495679_005937 3300047446 Bacteria 5343
375 Ga0495685_000002 3300047447 Bacteria 132680
376 Ga0495685_040216 3300047447 Bacteria 1599
377 Ga0495673_0000358 3300047469 Bacteria 56024
378 Ga0495681_0006401 3300047470 Bacteria 7749
379 Ga0495681_0044347 3300047470 Bacteria 2138
380 Ga0495684_0067219 3300047471 Bacteria 2726
381 Ga0495686_0000464 3300047472 Bacteria 60897
382 Ga0495602_0024280 3300048088 Bacteria 5883
383 Ga0495602_0109761 3300048088 Bacteria 2244
384 Ga0495602_0360220 3300048088 Bacteria 1047
385 Ga0495614_0035137 3300048089 Bacteria 2154
386 Ga0495615_0053999 3300048090 Bacteria 1042
387 Ga0495626_0011687 3300048091 Bacteria 4632
388 Ga0495626_0015626 3300048091 Bacteria 3880
389 Ga0495626_0023654 3300048091 Bacteria 3021
390 Ga0495626_0039406 3300048091 Bacteria 2236
391 Ga0496101_0052803 3300048904 Bacteria 2931
392 Ga0496102_0054640 3300048905 Bacteria 3642
393 Ga0496103_0035376 3300048906 Bacteria 3058
394 Ga0496112_0004744 3300048915 Bacteria 11586
395 Ga0496116_0000394 3300048919 Bacteria 63846
396 Ga0496117_0001290 3300048920 Bacteria 36931
397 Ga0496118_0000491 3300048921 Bacteria 65587
398 Ga0496118_0000647 3300048921 Bacteria 56808
399 Ga0496118_0028452 3300048921 Bacteria 4705
400 Ga0496119_0176086 3300048922 Bacteria 1125
401 Ga0496121_0009201 3300048924 Bacteria 11418
402 Ga0496121_0021378 3300048924 Bacteria 6340
403 Ga0496121_0025424 3300048924 Bacteria 5616
404 Ga0496122_0000145 3300048925 Bacteria 165864
405 Ga0496122_0000810 3300048925 Bacteria 59986
406 Ga0496123_0001426 3300048926 Bacteria 33426
407 Ga0496124_0000445 3300048927 Bacteria 72989
408 Ga0496125_0006167 3300048928 Bacteria 13067
409 Ga0496125_0011442 3300048928 Bacteria 8873
410 Ga0496126_0002598 3300048929 Bacteria 24076
411 Ga0496126_0037023 3300048929 Bacteria 4557
412 Ga0496126_0135354 3300048929 Bacteria 2126
413 Ga0495678_000091 3300049459 Bacteria 114504
414 Ga0495678_000689 3300049459 Bacteria 30888
415 Ga0495678_002057 3300049459 Bacteria 14380
416 Ga0495682_0000001 3300049460 Bacteria 1559116
417 Ga0495682_0000706 3300049460 Bacteria 21870
418 Ga0495682_0001155 3300049460 Bacteria 15187
419 Ga0495682_0001810 3300049460 Bacteria 10765
420 nmdc:mga03683_55941_c1 3300050489 Bacteria 1658
421 nmdc:mga00v17_4678_c1 3300050491 Bacteria 7149
422 nmdc:mga0k408_108375_c1 3300050493 Bacteria 1641
423 nmdc:mga0k408_321120_c1 3300050493 Bacteria 924
424 nmdc:mga07m45_106245_c1 3300050496 Bacteria 1615
425 nmdc:mga06r32_545437_c1 3300050510 Unclassified 1134
426 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
427 Ga0500644_0012798 3300053088 Bacteria 2330
428 Ga0500618_001065 3300053125 Bacteria 13588
429 Ga0500621_000002 3300053126 Bacteria 849473
430 Ga0500634_0074736 3300053161 Bacteria 1764
431 Ga0500637_0004989 3300053178 Bacteria 6386
432 8020946606 8020945358 Bacteria 8467355
433 2511249514 2511231003 Bacteria 5606035
434 2511381266 2511231025 Bacteria 5324661
435 2511433106 2511231035 Bacteria 5341610
436 2511437260 2511231035 Bacteria 5341610
437 2587736921 2585428058 Bacteria 6853932
438 2599409391 2599185169 Bacteria 5441380
439 2599620629 2599185214 Bacteria 8209958
440 2599673928 2599185226 Bacteria 8233575
441 2599678755 2599185227 Bacteria 8246414
442 2599690140 2599185229 Bacteria 8216126
443 2601445198 2600255229 Bacteria 1988965
444 2601643727 2600255287 Bacteria 5210468
445 2601663551 2600255291 Bacteria 5217298
446 2601696568 2600255298 Bacteria 5215185
447 2601701183 2600255299 Bacteria 5218662
448 2601721592 2600255303 Bacteria 5219315
449 2601739933 2600255307 Bacteria 5439064
450 2601750422 2600255309 Bacteria 5431045
451 2602017675 2600255392 Bacteria 5437392
452 2603660937 2602042052 Bacteria 5215873
453 2603666211 2602042053 Bacteria 5214361
454 2603697913 2602042066 Bacteria 4423871
455 2603877024 2602042111 Bacteria 5212080
456 2606070644 2603880184 Bacteria 5217896
457 2637225287 2636415599 Bacteria 5718434
458 2671107389 2667528173 Bacteria 5375747
459 2676406536 2675903046 Bacteria 5451247
460 2807176778 2806310673 Bacteria 4801221
461 2839142819 2839138175 Bacteria 6549354
462 2885202687 2885198086 Bacteria 7212419
463 2885216340 2885211737 Bacteria 7212420
464 2895429841 2895427314 Bacteria 13147766
465 2904476337 2904474040 Bacteria 5504324
466 2908673892 2908669403 Bacteria 5740494
467 2919152506 2919150387 Bacteria 5500879
468 2927145175 2927143783 Bacteria 5504251
469 2928073337 2928070936 Bacteria 8062541
470 2939573339 2939573065 Bacteria 4926053
471 2939644958 2939642701 Bacteria 4475280
472 8018222227 8018221730 Bacteria 4616064
473 8054850710 8054849141 Bacteria 5232694
474 8055090081 8055087960 Bacteria 4784273
475 8055093109 8055092621 Bacteria 4873875
476 8055421812 8055419101 Bacteria 5289643
477 8055695741 8055693939 Bacteria 4772047
478 8057306385 8057304971 Bacteria 4649742
479 JGI24735J21928_10018417
480 JGI25162J39368_1000002
481 JGI25163J39215_1000043
482 JGI25164J39214_1000066
483 Ga0055538_1000003
484 Ga0055539_1000003
485 Ga0055533_1000005
486 Ga0055525_1000005
487 Ga0055541_1000003
488 Ga0058692_1001201
489 Ga0070658_10016570
490 Ga0070676_10020404
491 Ga0068869_100205924
492 Ga0070666_10035604
493 Ga0068868_100031621
494 Ga0070689_100110668
495 Ga0070668_100035365
496 Ga0070669_100089040
497 Ga0070675_100224944
498 Ga0070671_100053650
499 Ga0070673_100125126
500 Ga0070667_100002412
501 Ga0070700_100026479
502 Ga0070694_100063077
503 Ga0070708_100080707
504 Ga0070678_100082154
505 Ga0068867_100131276
506 Ga0070707_100029822
507 Ga0070698_100356719
508 Ga0070699_100095955
509 Ga0068853_100000022
510 Ga0068853_100017257
511 Ga0070672_100067812
512 Ga0070693_100104703
513 Ga0070665_100000189
514 Ga0068855_100000057
515 Ga0068854_100006907
516 Ga0068854_100105446
517 Ga0068852_100151966
518 Ga0068859_100027825
519 Ga0068861_100058224
520 Ga0068851_10021213
521 Ga0068863_100320079
522 Ga0068858_100164475
523 Ga0068860_100085284
524 Ga0068860_100104191
525 Ga0068862_100052318
526 Ga0075363_100009079
527 Ga0075364_10002946
528 Ga0075362_10001544
529 Ga0075366_10009739
530 Ga0097621_100072715
531 Ga0097621_100277976
532 Ga0097621_100288107
533 Ga0075370_10008336
534 Ga0068871_100077906
535 Ga0075428_100000804
536 Ga0075431_100551272
537 Ga0068865_100138666
538 Ga0097620_100027825
539 Ga0079104_1000007
540 Ga0079104_1000357
541 Ga0079104_1005779
542 Ga0105251_10000086
543 Ga0105251_10000529
544 Ga0105251_10029351
545 Ga0105251_10032635
546 Ga0105251_10059929
547 Ga0105251_10059947
548 Ga0105244_10000137
549 Ga0105244_10000407
550 Ga0105244_10001832
551 Ga0105244_10006547
552 Ga0105244_10024205
553 Ga0105244_10070649
554 Ga0105250_10000070
555 Ga0105250_10000616
556 Ga0105250_10003238
557 Ga0105240_10001236
558 Ga0105240_10005357
559 Ga0105240_10063438
560 Ga0105240_10240310
561 Ga0111539_10000002
562 Ga0105243_10001502
563 Ga0105241_10167575
564 Ga0105248_10009543
565 Ga0105248_10016120
566 Ga0105248_10189668
567 Ga0105237_10005513
568 Ga0105237_10482631
569 Ga0105238_10019345
570 Ga0105239_10000026
571 Ga0105239_10000259
572 Ga0105239_10333479
573 Ga0105246_10000013
574 Ga0105246_10189752
575 Ga0157373_10000541
576 Ga0157373_10001081
577 Ga0157373_10016380
578 Ga0157371_10003279
579 Ga0157370_10000596
580 Ga0157369_10005711
581 Ga0163162_10048322
582 Ga0163162_10240992
583 Ga0157372_10004147
584 Ga0163163_10001459
585 Ga0163163_10020820
586 Ga0157380_10013228
587 Ga0157379_10008607
588 Ga0157376_10003954
589 Ga0213876_10016101
590 Ga0209760_100005
591 Ga0209784_100001
592 Ga0209566_100001
593 Ga0209674_100002
594 Ga0209563_100002
595 Ga0207427_100009
596 Ga0209437_100001
597 Ga0209677_100002
598 Ga0209759_1000739
599 Ga0209051_1004546
600 Ga0207656_10066730
601 Ga0207696_1000038
602 Ga0207696_1000409
603 Ga0207696_1000944
604 Ga0207696_1003255
605 Ga0207696_1032462
606 Ga0207696_1043234
607 Ga0207655_1000001
608 Ga0207655_1000002
609 Ga0207655_1000050
610 Ga0207655_1000218
611 Ga0207655_1000673
612 Ga0207655_1001263
613 Ga0207655_1006728
614 Ga0207655_1020027
615 Ga0207655_1032257
616 Ga0207655_1038342
617 Ga0207713_1000002
618 Ga0207713_1000155
619 Ga0207713_1000191
620 Ga0207713_1002406
621 Ga0207713_1005935
622 Ga0207713_1027646
623 Ga0207713_1036786
624 Ga0207680_10012212
625 Ga0207684_10030210
626 Ga0207695_10000301
627 Ga0207695_10008174
628 Ga0207695_10067669
629 Ga0207695_10146124
630 Ga0207671_10002197
631 Ga0207671_10012115
632 Ga0207693_10165107
633 Ga0207663_10002715
634 Ga0207646_10054795
635 Ga0207659_10315113
636 Ga0207687_10015722
637 Ga0207644_10045866
638 Ga0207644_10089974
639 Ga0207709_10000112
640 Ga0207709_10121768
641 Ga0207691_10019751
642 Ga0207691_10137938
643 Ga0207711_10049225
644 Ga0207711_10089921
645 Ga0207689_10135598
646 Ga0207667_10000355
647 Ga0207651_10018127
648 Ga0207712_10085493
649 Ga0207668_10035907
650 Ga0207658_10085063
651 Ga0207677_10032638
652 Ga0207703_10047747
653 Ga0207703_10217067
654 Ga0207639_10000002
655 Ga0207639_10247459
656 Ga0207641_10275626
657 Ga0207648_10105139
658 Ga0207676_10034874
659 Ga0207675_100083230
660 Ga0207683_10093019
661 Ga0207683_10110767
662 Ga0207698_10229118
663 Ga0209281_1000003
664 Ga0209281_1000020
665 Ga0209281_1000021
666 Ga0209281_1000630
667 Ga0209371_1000017
668 Ga0209371_1001607
669 Ga0207428_10000004
670 Ga0268266_10000180
671 Ga0268264_10063974
672 Ga0307515_10182506
673 Ga0268256_1000036
674 Ga0268256_1001390
675 Ga0265331_10039212
676 Ga0265327_10006949
677 Ga0307509_10118684
678 Ga0307508_10113099
679 Ga0307416_100082167
680 Ga0307414_10035275
681 Ga0307414_10056256
682 Ga0373935_0188116
683 Ga0373927_0031013
684 Ga0373933_0012835
685 Ga0373937_0150794
686 Ga0373925_0002283
687 Ga0436365_0203066
688 Ga0436361_1162917
689 Ga0453683_0063127
690 Ga0453684_0000065
691 Ga0495617_000741
692 Ga0495617_001256
693 Ga0495617_001329
694 Ga0495603_0123552
695 Ga0495603_0173915
696 Ga0495591_000545
697 Ga0495591_001032
698 Ga0495591_002180
699 Ga0495629_0041881
700 Ga0495638_0000477
701 Ga0495638_0069984
702 Ga0495653_0066333
703 Ga0495653_0079528
704 Ga0495650_0000031
705 Ga0495650_0000510
706 Ga0495650_0004885
707 Ga0495580_0004911
708 Ga0495580_0037276
709 Ga0495582_0007033
710 Ga0495605_0001664
711 Ga0495605_0003077
712 Ga0495605_0003782
713 Ga0495605_0011875
714 Ga0495605_0013945
715 Ga0495605_0022487
716 Ga0495605_0032449
717 Ga0495605_0090607
718 Ga0495639_0158525
719 Ga0495584_0000306
720 Ga0495584_0000761
721 Ga0495584_0004731
722 Ga0495584_0042962
723 Ga0495585_0020870
724 Ga0495585_0161457
725 Ga0495594_0035112
726 Ga0495596_0000174
727 Ga0495596_0001576
728 Ga0495596_0032846
729 Ga0495596_0065816
730 Ga0495607_0001336
731 Ga0495607_0018181
732 Ga0495607_0022979
733 Ga0495607_0038071
734 Ga0495607_0041443
735 Ga0495607_0052976
736 Ga0495583_0000014
737 Ga0495583_0000093
738 Ga0495583_0000160
739 Ga0495583_0010191
740 Ga0495606_0003718
741 Ga0495606_0017522
742 Ga0495610_0032347
743 Ga0495616_0014322
744 Ga0495616_0022853
745 Ga0495616_0023537
746 Ga0495616_0026631
747 Ga0495620_0001627
748 Ga0495620_0041513
749 Ga0495628_0233547
750 Ga0495631_0000952
751 Ga0495631_0006098
752 Ga0495631_0013727
753 Ga0495631_0092018
754 Ga0495643_0006722
755 Ga0495644_0000156
756 Ga0495644_0010940
757 Ga0495644_0026208
758 Ga0495644_0047986
759 Ga0495648_0000653
760 Ga0495648_0001000
761 Ga0495648_0005141
762 Ga0495648_0013990
763 Ga0495648_0031972
764 Ga0495648_0043334
765 Ga0495663_0000436
766 Ga0495666_0088061
767 Ga0495642_0024347
768 Ga0495642_0027303
769 Ga0495642_0027912
770 Ga0495642_0030879
771 Ga0495652_0125952
772 Ga0495654_0000069
773 Ga0495654_0000248
774 Ga0495665_0070101
775 Ga0495609_0000690
776 Ga0495609_0002554
777 Ga0495609_0043742
778 Ga0495597_0000517
779 Ga0495597_0002978
780 Ga0495597_0119334
781 Ga0495645_0052705
782 Ga0495622_0034743
783 Ga0495622_0036617
784 Ga0495622_0055760
785 Ga0495633_0000214
786 Ga0495633_0014138
787 Ga0495633_0030818
788 Ga0495668_0010746
789 Ga0495668_0016001
790 Ga0495668_0019813
791 Ga0495668_0023795
792 Ga0495611_0001169
793 Ga0495611_0002335
794 Ga0495611_0012489
795 Ga0495611_0029938
796 Ga0495625_0000728
797 Ga0495625_0004537
798 Ga0495625_0011624
799 Ga0495625_0086921
800 Ga0495625_0099524
801 Ga0495659_0003028
802 Ga0495661_0000843
803 Ga0495661_0012177
804 Ga0495661_0029679
805 Ga0495661_0032010
806 Ga0495661_0048259
807 Ga0495588_0013302
808 Ga0495588_0018301
809 Ga0495646_0003450
810 Ga0495647_0019529
811 Ga0495670_0013315
812 Ga0495670_0051764
813 Ga0495670_0060954
814 Ga0495671_0000418
815 Ga0495671_0000446
816 Ga0495671_0144987
817 Ga0495649_0000245
818 Ga0495649_0000704
819 Ga0495649_0002899
820 Ga0495649_0019004
821 Ga0495589_0024759
822 Ga0495589_0032674
823 Ga0495589_0038439
824 Ga0495600_0168444
825 Ga0495600_0355372
826 Ga0495660_0000016
827 Ga0495660_0000153
828 Ga0495660_0016912
829 Ga0495660_0024802
830 Ga0495660_0050221
831 Ga0495604_0097530
832 Ga0495604_0189682
833 Ga0495672_0000001
834 Ga0495672_0000372
835 Ga0495672_0013302
836 Ga0495683_0007096
837 Ga0495683_0010593
838 Ga0495683_0042769
839 Ga0495683_0050963
840 Ga0495687_000334
841 Ga0495687_000982
842 Ga0495687_013230
843 Ga0495687_044301
844 Ga0495677_0001353
845 Ga0495677_0007145
846 Ga0495677_0008986
847 Ga0495677_0020164
848 Ga0495677_0029611
849 Ga0495677_0136492
850 Ga0495679_000590
851 Ga0495679_002819
852 Ga0495679_005937
853 Ga0495685_000002
854 Ga0495685_040216
855 Ga0495673_0000358
856 Ga0495681_0006401
857 Ga0495681_0044347
858 Ga0495684_0067219
859 Ga0495686_0000464
860 Ga0495602_0024280
861 Ga0495602_0109761
862 Ga0495602_0360220
863 Ga0495614_0035137
864 Ga0495615_0053999
865 Ga0495626_0011687
866 Ga0495626_0015626
867 Ga0495626_0023654
868 Ga0495626_0039406
869 Ga0496101_0052803
870 Ga0496102_0054640
871 Ga0496103_0035376
872 Ga0496112_0004744
873 Ga0496116_0000394
874 Ga0496117_0001290
875 Ga0496118_0000491
876 Ga0496118_0000647
877 Ga0496118_0028452
878 Ga0496119_0176086
879 Ga0496121_0009201
880 Ga0496121_0021378
881 Ga0496121_0025424
882 Ga0496122_0000145
883 Ga0496122_0000810
884 Ga0496123_0001426
885 Ga0496124_0000445
886 Ga0496125_0006167
887 Ga0496125_0011442
888 Ga0496126_0002598
889 Ga0496126_0037023
890 Ga0496126_0135354
891 Ga0495678_000091
892 Ga0495678_000689
893 Ga0495678_002057
894 Ga0495682_0000001
895 Ga0495682_0000706
896 Ga0495682_0001155
897 Ga0495682_0001810
898 nmdc:mga03683_55941_c1
899 nmdc:mga00v17_4678_c1
900 nmdc:mga0k408_108375_c1
901 nmdc:mga0k408_321120_c1
902 nmdc:mga07m45_106245_c1
903 nmdc:mga06r32_545437_c1
904 nmdc:mga08y16_2_c1
905 Ga0500644_0012798
906 Ga0500618_001065
907 Ga0500621_000002
908 Ga0500634_0074736
909 Ga0500637_0004989
910 8020946606
911 2511249514
912 2511381266
913 2511433106
914 2511437260
915 2587736921
916 2599409391
917 2599620629
918 2599673928
919 2599678755
920 2599690140
921 2601445198
922 2601643727
923 2601663551
924 2601696568
925 2601701183
926 2601721592
927 2601739933
928 2601750422
929 2602017675
930 2603660937
931 2603666211
932 2603697913
933 2603877024
934 2606070644
935 2637225287
936 2671107389
937 2676406536
938 2807176778
939 2839142819
940 2885202687
941 2885216340
942 2895429841
943 2904476337
944 2908673892
945 2919152506
946 2927145175
947 2928073337
948 2939573339
949 2939644958
950 8018222227
951 8054850710
952 8055090081
953 8055093109
954 8055421812
955 8055695741
956 8057306385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

52

297

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mhb-assembly1.cif.gz_A structure of a putative reductase from yersinia pestis 0.9898 1 283
4mhb-assembly4.cif.gz_D structure of a putative reductase from yersinia pestis 0.9895 1 283
4mhb-assembly4.cif.gz_D structure of a putative reductase from yersinia pestis 0.986 1 283
1vp5-assembly2.cif.gz_B crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution 0.9804 2 277
4q3m-assembly3.cif.gz_E crystal structure of mgs-m4, an aldo-keto reductase enzyme from a medee basin deep-sea metagenome library 0.9758 4 269
ID Description Score Start End Superfamily
af_Q2FW57_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9862 1 283 3.20.20.100
af_Q2FW57_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9828 1 283 3.20.20.100
af_Q4DJ07_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9751 3 269 3.20.20.100
af_Q9NAI5_1_316_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9632 2 262 3.20.20.100
af_I1J6Z7_4_313_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9617 3 258 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A6A8LR71-F1-model_v4 Aldo/keto reductase 0.9911 40 244 GO:0004033
GO:0044281
AF-A0A4U7NDA3-F1-model_v4 deleted 0.9908 1 120
AF-A0A0S4RZG2-F1-model_v4 Aldo/keto reductase family oxidoreductase (EC 1.-.-.-) 0.988 1 278 GO:0004033
GO:0044281
AF-W1YL81-F1-model_v4 Aldo/keto reductase 0.9874 51 153 GO:0004033
AF-A0A8A8TJY5-F1-model_v4 deleted 0.9865 1 277

Map