F451925

General Info

Members Datasets Scaffolds Average Seq Length
478 286 428 377

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0050359|Ga0466965_0050359_354_1445
Length 363
Sequence LLVTNDFPPRPGGIQSYLHALATRLPADSLVVYAPKWKGAEEFDAAQPFPVVRHPTSLMLPTPDVLARARDIARAESCEAAWFGAAAPLALLAPSLGLSRAVACTHGHEVGWSMLPVARQALRAIGSGVDVVTYVSRYTRSRFAAAFGPMAALEHLPSGVDTDLYRPDPAARAEIRRRYGLGDRPVVVCVSRLVPRKGQDVLIRALPLIQRSVPDAALLIVGGGPYRKTLEKLAAGNRDVVLTGSVPWEELPAHYNAGDVFAMPCRTRGRGLDVEGLGIVYLEASATGLPVVAGRSGGAPETVLNGITGNVVDGREITDVAEKVAALLADPEMAAKMGRAGREWVSENWRWDQLAHRLEGLIG

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2582580736 Prauserella sp. Am3 Isolate Unclassified
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
8 2643221692 Nocardia sp. Root136 Isolate Unclassified
9 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
10 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
11 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
12 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
13 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
14 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
15 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
16 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
17 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
18 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
19 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
20 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
21 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
22 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
23 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
24 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
25 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
26 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
27 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
28 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
29 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
30 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
31 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
32 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
33 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
34 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
35 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
36 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
37 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
38 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
39 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
40 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
41 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
42 2922554459 Rhodococcus sp. 66b Isolate Unclassified
43 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
44 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
45 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
46 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
47 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
48 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
49 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
286 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.54
Metatranscriptomes 0
Isolates 10.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.16
Nodule 0.21
Rhizoplane 11.92
Rhizosphere 63.81
Stem 0
Stem Tuber 0.21
Unclassified 15.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002925 3300003203 Bacteria 8054
2 rootL2_10127992 3300003322 Bacteria 1547
3 Ga0055540_1000134 3300003792 Bacteria 73612
4 Ga0055540_1002702 3300003792 Bacteria 9130
5 Ga0055540_1002706 3300003792 Bacteria 9128
6 Ga0055540_1005160 3300003792 Bacteria 5611
7 Ga0070682_100006963 3300005337 Bacteria 6359
8 Ga0068868_100004650 3300005338 Bacteria 9631
9 Ga0070689_100001922 3300005340 Bacteria 13433
10 Ga0070691_10022332 3300005341 Bacteria 2935
11 Ga0070687_100017259 3300005343 Bacteria 3314
12 Ga0070668_100004726 3300005347 Bacteria 10099
13 Ga0070668_100005072 3300005347 Bacteria 9750
14 Ga0070668_100005168 3300005347 Bacteria 9678
15 Ga0070668_100023111 3300005347 Bacteria 4700
16 Ga0070668_100037059 3300005347 Bacteria 3723
17 Ga0070669_100001818 3300005353 Bacteria 15369
18 Ga0070669_100112727 3300005353 Bacteria 2065
19 Ga0070675_100099078 3300005354 Bacteria 2453
20 Ga0070671_100004858 3300005355 Bacteria 10689
21 Ga0070674_100000581 3300005356 Bacteria 18458
22 Ga0070688_100005050 3300005365 Bacteria 6912
23 Ga0070688_100018288 3300005365 Bacteria 4042
24 Ga0070659_100073275 3300005366 Bacteria 2726
25 Ga0070659_100248021 3300005366 Bacteria 1475
26 Ga0070667_100000191 3300005367 Bacteria 73538
27 Ga0070667_100000249 3300005367 Bacteria 61169
28 Ga0070667_100110946 3300005367 Bacteria 2378
29 Ga0070714_100020706 3300005435 Bacteria 5375
30 Ga0070713_100293268 3300005436 Bacteria 1495
31 Ga0070713_100357047 3300005436 Bacteria 1357
32 Ga0070710_10004835 3300005437 Bacteria 6370
33 Ga0070710_10027001 3300005437 Bacteria 3057
34 Ga0070701_10035548 3300005438 Bacteria 2504
35 Ga0070711_100001079 3300005439 Bacteria 14561
36 Ga0070705_100004751 3300005440 Bacteria 6615
37 Ga0070663_100000664 3300005455 Bacteria 18510
38 Ga0070663_100040639 3300005455 Bacteria 3258
39 Ga0070662_100054175 3300005457 Bacteria 2906
40 Ga0068867_100009541 3300005459 Bacteria 6841
41 Ga0068853_100012717 3300005539 Bacteria 6853
42 Ga0070696_100004718 3300005546 Bacteria 9115
43 Ga0070665_100003487 3300005548 Bacteria 16749
44 Ga0070665_100007328 3300005548 Bacteria 11222
45 Ga0070665_100037085 3300005548 Bacteria 4903
46 Ga0070665_100071884 3300005548 Bacteria 3467
47 Ga0070704_100000677 3300005549 Bacteria 16532
48 Ga0070704_100015278 3300005549 Bacteria 4820
49 Ga0068855_100192704 3300005563 Bacteria 2298
50 Ga0068854_100006312 3300005578 Bacteria 7540
51 Ga0068856_100302217 3300005614 Bacteria 1618
52 Ga0070702_100005596 3300005615 Bacteria 5875
53 Ga0068852_100170274 3300005616 Bacteria 2041
54 Ga0068859_100000266 3300005617 Bacteria 52170
55 Ga0068859_100007439 3300005617 Bacteria 11113
56 Ga0068864_100060439 3300005618 Bacteria 3281
57 Ga0068866_10000520 3300005718 Bacteria 17787
58 Ga0068861_100003598 3300005719 Bacteria 10321
59 Ga0068861_100021255 3300005719 Bacteria 4664
60 Ga0068863_100006960 3300005841 Bacteria 11090
61 Ga0068863_100010519 3300005841 Bacteria 8986
62 Ga0068863_100220597 3300005841 Bacteria 1827
63 Ga0068858_100006097 3300005842 Bacteria 11762
64 Ga0068858_100035333 3300005842 Bacteria 4636
65 Ga0068860_100000166 3300005843 Bacteria 108310
66 Ga0068860_100006908 3300005843 Bacteria 11380
67 Ga0068860_100380656 3300005843 Bacteria 1393
68 Ga0068862_100000003 3300005844 Bacteria 369793
69 Ga0068862_100004016 3300005844 Bacteria 12473
70 Ga0081455_10000443 3300005937 Bacteria 54547
71 Ga0081455_10014353 3300005937 Bacteria 7772
72 Ga0081539_10000242 3300005985 Bacteria 127897
73 Ga0070717_10234631 3300006028 Bacteria 1616
74 Ga0075365_10017879 3300006038 Bacteria 4350
75 Ga0075365_10194532 3300006038 Bacteria 1420
76 Ga0075363_100011700 3300006048 Bacteria 4210
77 Ga0075364_10002046 3300006051 Bacteria 11255
78 Ga0075364_10030735 3300006051 Bacteria 3449
79 Ga0070715_10041136 3300006163 Bacteria 1935
80 Ga0070716_100005387 3300006173 Bacteria 6193
81 Ga0070716_100009449 3300006173 Bacteria 4861
82 Ga0070712_100001110 3300006175 Bacteria 16202
83 Ga0070712_100052477 3300006175 Bacteria 2843
84 Ga0075362_10012581 3300006177 Bacteria 3365
85 Ga0075369_10019019 3300006186 Bacteria 2801
86 Ga0075369_10023020 3300006186 Bacteria 2572
87 Ga0075369_10027773 3300006186 Bacteria 2367
88 Ga0075369_10049109 3300006186 Bacteria 1822
89 Ga0075369_10051661 3300006186 Bacteria 1780
90 Ga0075370_10046283 3300006353 Bacteria 2462
91 Ga0075370_10077775 3300006353 Bacteria 1904
92 Ga0075428_100001482 3300006844 Bacteria 25105
93 Ga0075430_100187442 3300006846 Bacteria 1720
94 Ga0075431_100016513 3300006847 Bacteria 7493
95 Ga0068865_100004263 3300006881 Bacteria 8625
96 Ga0097620_100000266 3300006931 Bacteria 52170
97 Ga0097620_100007439 3300006931 Bacteria 11113
98 Ga0105245_10000546 3300009098 Bacteria 34304
99 Ga0105245_10427287 3300009098 Bacteria 1329
100 Ga0105245_10469921 3300009098 Bacteria 1269
101 Ga0105247_10000006 3300009101 Bacteria 416061
102 Ga0105247_10000268 3300009101 Bacteria 48320
103 Ga0114129_10034477 3300009147 Bacteria 7149
104 Ga0105243_10000329 3300009148 Bacteria 51977
105 Ga0105243_10001875 3300009148 Bacteria 17930
106 Ga0105242_10001078 3300009176 Bacteria 21421
107 Ga0105248_10000042 3300009177 Bacteria 167583
108 Ga0105237_10000175 3300009545 Bacteria 90284
109 Ga0105237_10010809 3300009545 Bacteria 9687
110 Ga0105238_10341401 3300009551 Bacteria 1486
111 Ga0105249_10000008 3300009553 Bacteria 341271
112 Ga0105239_10050872 3300010375 Bacteria 4543
113 Ga0105239_10098301 3300010375 Bacteria 3235
114 Ga0105239_10175375 3300010375 Bacteria 2398
115 Ga0157369_10246359 3300013105 Bacteria 1866
116 Ga0157374_10003900 3300013296 Bacteria 12523
117 Ga0157378_10000438 3300013297 Bacteria 40289
118 Ga0163162_10008681 3300013306 Bacteria 9890
119 Ga0157372_10200518 3300013307 Bacteria 2311
120 Ga0157372_10221681 3300013307 Bacteria 2192
121 Ga0157372_10330496 3300013307 Bacteria 1775
122 Ga0157375_10002558 3300013308 Bacteria 15793
123 Ga0163163_10153786 3300014325 Bacteria 2344
124 Ga0157380_10001136 3300014326 Bacteria 17184
125 Ga0157379_10012283 3300014968 Bacteria 7480
126 Ga0157379_10013754 3300014968 Bacteria 7094
127 Ga0157379_10123126 3300014968 Bacteria 2334
128 Ga0157376_10044661 3300014969 Bacteria 3643
129 Ga0163161_10146404 3300017792 Bacteria 1792
130 Ga0213876_10002032 3300021384 Bacteria 12040
131 Ga0213876_10039588 3300021384 Bacteria 2491
132 Ga0213876_10043583 3300021384 Bacteria 2371
133 Ga0213875_10011367 3300021388 Bacteria 4428
134 Ga0209051_1000076 3300025303 Bacteria 204355
135 Ga0209051_1001181 3300025303 Bacteria 23641
136 Ga0209051_1004067 3300025303 Bacteria 9217
137 Ga0209051_1008457 3300025303 Bacteria 5445
138 Ga0207692_10004944 3300025898 Bacteria 5303
139 Ga0207642_10000604 3300025899 Bacteria 11046
140 Ga0207710_10000114 3300025900 Bacteria 101498
141 Ga0207710_10005073 3300025900 Bacteria 5699
142 Ga0207688_10001107 3300025901 Bacteria 13835
143 Ga0207688_10001483 3300025901 Bacteria 12302
144 Ga0207688_10144780 3300025901 Bacteria 1400
145 Ga0207680_10090372 3300025903 Bacteria 1946
146 Ga0207647_10098497 3300025904 Bacteria 1737
147 Ga0207685_10001625 3300025905 Bacteria 4821
148 Ga0207685_10004683 3300025905 Bacteria 3514
149 Ga0207695_10361858 3300025913 Bacteria 1337
150 Ga0207671_10004714 3300025914 Bacteria 12887
151 Ga0207671_10014240 3300025914 Bacteria 6294
152 Ga0207693_10000694 3300025915 Bacteria 30256
153 Ga0207693_10002045 3300025915 Bacteria 17662
154 Ga0207663_10008466 3300025916 Bacteria 5379
155 Ga0207663_10014127 3300025916 Bacteria 4364
156 Ga0207681_10001429 3300025923 Bacteria 15391
157 Ga0207681_10154943 3300025923 Bacteria 1721
158 Ga0207659_10173038 3300025926 Bacteria 1705
159 Ga0207687_10000192 3300025927 Bacteria 41036
160 Ga0207687_10029043 3300025927 Bacteria 3718
161 Ga0207687_10165101 3300025927 Bacteria 1703
162 Ga0207664_10013232 3300025929 Bacteria 5913
163 Ga0207664_10071360 3300025929 Bacteria 2797
164 Ga0207664_10073728 3300025929 Bacteria 2755
165 Ga0207690_10018250 3300025932 Bacteria 4301
166 Ga0207706_10003591 3300025933 Bacteria 14812
167 Ga0207686_10024742 3300025934 Bacteria 3484
168 Ga0207709_10003124 3300025935 Bacteria 9962
169 Ga0207709_10007317 3300025935 Bacteria 6154
170 Ga0207669_10000794 3300025937 Bacteria 13541
171 Ga0207704_10001730 3300025938 Bacteria 9776
172 Ga0207665_10002960 3300025939 Bacteria 11381
173 Ga0207665_10008830 3300025939 Bacteria 6620
174 Ga0207691_10038642 3300025940 Bacteria 4417
175 Ga0207711_10004556 3300025941 Bacteria 11792
176 Ga0207689_10013574 3300025942 Bacteria 6952
177 Ga0207689_10031406 3300025942 Bacteria 4422
178 Ga0207689_10090275 3300025942 Bacteria 2517
179 Ga0207667_10195612 3300025949 Bacteria 2074
180 Ga0207712_10000011 3300025961 Bacteria 412321
181 Ga0207712_10007592 3300025961 Bacteria 6852
182 Ga0207668_10001297 3300025972 Bacteria 14853
183 Ga0207668_10012876 3300025972 Bacteria 5133
184 Ga0207668_10042918 3300025972 Bacteria 3065
185 Ga0207668_10051127 3300025972 Bacteria 2853
186 Ga0207640_10001367 3300025981 Bacteria 13196
187 Ga0207658_10000071 3300025986 Bacteria 112481
188 Ga0207658_10001438 3300025986 Bacteria 18563
189 Ga0207658_10003137 3300025986 Bacteria 11826
190 Ga0207658_10227585 3300025986 Bacteria 1572
191 Ga0207677_10015468 3300026023 Bacteria 4490
192 Ga0207677_10036045 3300026023 Bacteria 3219
193 Ga0207677_10182220 3300026023 Bacteria 1653
194 Ga0207703_10002411 3300026035 Bacteria 16246
195 Ga0207703_10030383 3300026035 Bacteria 4269
196 Ga0207639_10031997 3300026041 Bacteria 3869
197 Ga0207678_10000059 3300026067 Bacteria 85898
198 Ga0207678_10005920 3300026067 Bacteria 10892
199 Ga0207641_10001975 3300026088 Bacteria 19593
200 Ga0207641_10022274 3300026088 Bacteria 5214
201 Ga0207641_10024438 3300026088 Bacteria 4981
202 Ga0207648_10001309 3300026089 Bacteria 27704
203 Ga0207674_10202535 3300026116 Bacteria 1934
204 Ga0207675_100001516 3300026118 Bacteria 23283
205 Ga0207675_100060312 3300026118 Bacteria 3541
206 Ga0207683_10000275 3300026121 Bacteria 46018
207 Ga0268266_10003903 3300028379 Bacteria 14499
208 Ga0268266_10057217 3300028379 Bacteria 3355
209 Ga0268266_10196973 3300028379 Bacteria 1842
210 Ga0268265_10000010 3300028380 Bacteria 370129
211 Ga0268265_10002946 3300028380 Bacteria 12471
212 Ga0268264_10000007 3300028381 Bacteria 815790
213 Ga0307515_10071216 3300028794 Bacteria 4715
214 Ga0307512_10008970 3300030522 Bacteria 9689
215 Ga0265327_10000021 3300031251 Bacteria 417788
216 Ga0265327_10000071 3300031251 Bacteria 215502
217 Ga0265327_10007006 3300031251 Bacteria 8839
218 Ga0265327_10027707 3300031251 Bacteria 3255
219 Ga0307513_10119006 3300031456 Bacteria 2614
220 Ga0307518_10001333 3300031838 Bacteria 18453
221 Ga0307407_10061470 3300031903 Bacteria 2196
222 Ga0307409_100006153 3300031995 Bacteria 7019
223 Ga0307416_100019701 3300032002 Bacteria 4792
224 Ga0307411_10015906 3300032005 Bacteria 4242
225 Ga0307507_10009634 3300033179 Bacteria 12783
226 Ga0307507_10023887 3300033179 Bacteria 6687
227 Ga0373956_0016545 3300035119 Bacteria 3098
228 Ga0373931_0019848 3300035691 Bacteria 3358
229 Ga0436364_0914231 3300037853 Bacteria 12278
230 Ga0436364_1493017 3300037853 Bacteria 19850
231 Ga0436365_0634291 3300039437 Bacteria 58106
232 Ga0436365_0969503 3300039437 Bacteria 3829
233 Ga0436365_1883040 3300039437 Bacteria 17812
234 Ga0436363_1308336 3300039450 Bacteria 7687
235 Ga0436363_1368468 3300039450 Bacteria 2406
236 Ga0439466_0003129 3300041411 Bacteria 6438
237 Ga0439465_0016444 3300041413 Bacteria 2307
238 Ga0439465_0032486 3300041413 Bacteria 1666
239 Ga0451793_0567042 3300041452 Bacteria 3191
240 Ga0451797_0218048 3300041453 Bacteria 2144
241 Ga0451795_0910137 3300041456 Bacteria 2392
242 Ga0451802_1343992 3300041460 Bacteria 1451
243 Ga0451853_0133000 3300041512 Bacteria 5891
244 Ga0451853_1434083 3300041512 Bacteria 2206
245 Ga0439445_0031479 3300042004 Bacteria 1379
246 Ga0439448_0012144 3300042005 Bacteria 2573
247 Ga0439449_0004426 3300042007 Bacteria 5419
248 Ga0466972_0004630 3300044658 Bacteria 6887
249 Ga0466972_0036543 3300044658 Bacteria 2403
250 Ga0466965_0006993 3300044683 Bacteria 5163
251 Ga0466965_0050359 3300044683 Bacteria 2065
252 Ga0466966_0002708 3300044684 Bacteria 11624
253 Ga0466961_0002435 3300044693 Bacteria 11547
254 Ga0466961_0027334 3300044693 Bacteria 3669
255 Ga0466963_0000134 3300044694 Bacteria 28452
256 Ga0466963_0056673 3300044694 Bacteria 2608
257 Ga0466963_0097912 3300044694 Bacteria 2005
258 Ga0466964_0048130 3300044706 Bacteria 1743
259 Ga0466964_0052980 3300044706 Bacteria 1669
260 Ga0466971_0026841 3300044719 Bacteria 2576
261 Ga0466971_0076143 3300044719 Bacteria 1526
262 Ga0466968_0034103 3300044735 Bacteria 2123
263 Ga0466970_0045192 3300044765 Bacteria 2344
264 Ga0466970_0098333 3300044765 Bacteria 1592
265 Ga0466957_0001854 3300044842 Bacteria 11162
266 Ga0466957_0008220 3300044842 Bacteria 5927
267 Ga0466957_0097457 3300044842 Bacteria 1849
268 Ga0466960_0000304 3300044901 Bacteria 17128
269 Ga0466960_0000661 3300044901 Bacteria 11975
270 Ga0466960_0005852 3300044901 Bacteria 4899
271 Ga0466960_0078812 3300044901 Bacteria 1655
272 Ga0466959_0007484 3300045049 Bacteria 7665
273 Ga0466959_0014134 3300045049 Bacteria 5794
274 Ga0466959_0034589 3300045049 Bacteria 3737
275 Ga0466959_0105340 3300045049 Bacteria 2016
276 Ga0466958_0004820 3300045836 Bacteria 7179
277 Ga0466958_0008300 3300045836 Bacteria 5752
278 Ga0466958_0245885 3300045836 Bacteria 1143
279 Ga0466967_0015054 3300045976 Bacteria 6052
280 Ga0466967_0018363 3300045976 Bacteria 5586
281 Ga0466967_0025048 3300045976 Bacteria 4914
282 Ga0466967_0135635 3300045976 Bacteria 2289
283 Ga0466967_0227831 3300045976 Bacteria 1773
284 Ga0495629_0005217 3300046459 Bacteria 9729
285 Ga0495641_0009046 3300046461 Bacteria 5976
286 Ga0495580_0185342 3300046472 Bacteria 1437
287 Ga0495582_0013901 3300046473 Bacteria 4433
288 Ga0495607_0101958 3300046501 Bacteria 1536
289 Ga0495608_0203974 3300046511 Bacteria 1245
290 Ga0495648_0001449 3300046524 Bacteria 23191
291 Ga0495668_0038107 3300046616 Bacteria 2688
292 Ga0495634_0105384 3300046642 Bacteria 1818
293 Ga0495672_0003532 3300047320 Bacteria 13314
294 Ga0495683_0003313 3300047323 Bacteria 9409
295 Ga0495673_0000367 3300047469 Bacteria 54316
296 Ga0495686_0004603 3300047472 Bacteria 11242
297 Ga0495686_0058767 3300047472 Bacteria 2396
298 Ga0496100_0000023 3300048903 Bacteria 121977
299 Ga0496100_0023730 3300048903 Bacteria 3731
300 Ga0496100_0094307 3300048903 Bacteria 2049
301 Ga0496101_0000046 3300048904 Bacteria 155997
302 Ga0496101_0000089 3300048904 Bacteria 98287
303 Ga0496101_0000941 3300048904 Bacteria 17189
304 Ga0496101_0004942 3300048904 Bacteria 8464
305 Ga0496102_0000025 3300048905 Bacteria 227201
306 Ga0496102_0000783 3300048905 Bacteria 30938
307 Ga0496102_0000873 3300048905 Bacteria 28789
308 Ga0496102_0003346 3300048905 Bacteria 13589
309 Ga0496102_0116847 3300048905 Bacteria 2489
310 Ga0496102_0163737 3300048905 Bacteria 2092
311 Ga0496102_0164857 3300048905 Bacteria 2085
312 Ga0496103_0000022 3300048906 Bacteria 227208
313 Ga0496103_0000494 3300048906 Bacteria 32551
314 Ga0496103_0001263 3300048906 Bacteria 17262
315 Ga0496103_0001334 3300048906 Bacteria 16712
316 Ga0496103_0140039 3300048906 Bacteria 1547
317 Ga0496104_0007792 3300048907 Bacteria 9491
318 Ga0496104_0030504 3300048907 Bacteria 5011
319 Ga0496105_0017731 3300048908 Bacteria 5712
320 Ga0496106_0001191 3300048909 Bacteria 19408
321 Ga0496106_0002689 3300048909 Bacteria 13201
322 Ga0496106_0015320 3300048909 Bacteria 5673
323 Ga0496106_0036504 3300048909 Bacteria 3676
324 Ga0496106_0159346 3300048909 Bacteria 1784
325 Ga0496107_0000580 3300048910 Bacteria 20406
326 Ga0496107_0016901 3300048910 Bacteria 5128
327 Ga0496107_0029544 3300048910 Bacteria 3900
328 Ga0496107_0047398 3300048910 Bacteria 3095
329 Ga0496107_0194269 3300048910 Bacteria 1508
330 Ga0496108_0000453 3300048911 Bacteria 32720
331 Ga0496108_0002856 3300048911 Bacteria 13866
332 Ga0496108_0125073 3300048911 Bacteria 2207
333 Ga0496109_0000037 3300048912 Bacteria 151906
334 Ga0496109_0014844 3300048912 Bacteria 6779
335 Ga0496110_0000823 3300048913 Bacteria 21775
336 Ga0496110_0079943 3300048913 Bacteria 2912
337 Ga0496110_0087640 3300048913 Bacteria 2780
338 Ga0496111_0038965 3300048914 Bacteria 3406
339 Ga0496112_0003504 3300048915 Bacteria 13009
340 Ga0496112_0083632 3300048915 Bacteria 3157
341 Ga0496113_0003388 3300048916 Bacteria 9534
342 Ga0496113_0040059 3300048916 Bacteria 3451
343 Ga0496113_0171210 3300048916 Bacteria 1720
344 Ga0496114_0000360 3300048917 Bacteria 33359
345 Ga0496114_0002500 3300048917 Bacteria 14037
346 Ga0496114_0003506 3300048917 Bacteria 12041
347 Ga0496114_0111171 3300048917 Bacteria 2348
348 Ga0496114_0114588 3300048917 Bacteria 2312
349 Ga0496115_0003598 3300048918 Bacteria 11137
350 Ga0496115_0023055 3300048918 Bacteria 4828
351 Ga0496116_0000059 3300048919 Bacteria 274491
352 Ga0496117_0000055 3300048920 Bacteria 274518
353 Ga0496117_0000595 3300048920 Bacteria 59503
354 Ga0496118_0000058 3300048921 Bacteria 227245
355 Ga0496118_0000786 3300048921 Bacteria 50796
356 Ga0496118_0004813 3300048921 Bacteria 15749
357 Ga0496118_0088859 3300048921 Bacteria 2135
358 Ga0496119_0000278 3300048922 Bacteria 71878
359 Ga0496119_0011482 3300048922 Bacteria 7325
360 Ga0496120_0000384 3300048923 Bacteria 71475
361 Ga0496120_0007979 3300048923 Bacteria 7794
362 Ga0496121_0000068 3300048924 Bacteria 259210
363 Ga0496121_0000113 3300048924 Bacteria 181807
364 Ga0496121_0014051 3300048924 Bacteria 8545
365 Ga0496121_0131936 3300048924 Bacteria 1868
366 Ga0496122_0000687 3300048925 Bacteria 67409
367 Ga0496123_0018116 3300048926 Bacteria 5624
368 Ga0496124_0000065 3300048927 Bacteria 223594
369 Ga0496124_0192110 3300048927 Bacteria 1561
370 Ga0496125_0000008 3300048928 Bacteria 704677
371 Ga0496125_0151481 3300048928 Bacteria 1592
372 Ga0496126_0000062 3300048929 Bacteria 259210
373 Ga0496126_0005460 3300048929 Bacteria 14506
374 Ga0496126_0034782 3300048929 Bacteria 4727
375 Ga0496126_0034916 3300048929 Bacteria 4716
376 Ga0501032_0001215 3300049569 Bacteria 20609
377 Ga0501032_0003739 3300049569 Bacteria 11542
378 Ga0501034_0000651 3300049571 Bacteria 53413
379 Ga0501034_0005626 3300049571 Bacteria 13648
380 Ga0501034_0300802 3300049571 Bacteria 1541
381 Ga0501034_0304407 3300049571 Bacteria 1530
382 Ga0501036_0009893 3300049572 Bacteria 7852
383 Ga0501036_0075339 3300049572 Bacteria 2854
384 Ga0501037_0000222 3300049573 Bacteria 49681
385 Ga0501037_0025737 3300049573 Bacteria 4346
386 Ga0501038_0005120 3300049574 Bacteria 12175
387 Ga0501039_0035537 3300049575 Bacteria 3845
388 Ga0501043_0000225 3300049579 Bacteria 51378
389 Ga0501043_0011222 3300049579 Bacteria 7017
390 Ga0501043_0177561 3300049579 Bacteria 1660
391 Ga0501046_0012802 3300049580 Bacteria 7135
392 Ga0501047_0005492 3300049581 Bacteria 11927
393 Ga0501047_0011512 3300049581 Bacteria 8372
394 Ga0501048_0013667 3300049582 Bacteria 6023
395 Ga0501068_0069270 3300049584 Bacteria 2151
396 Ga0501069_0030120 3300049585 Bacteria 2980
397 Ga0501070_0002172 3300049586 Bacteria 17248
398 Ga0501070_0002399 3300049586 Bacteria 16439
399 Ga0501073_0021262 3300049589 Bacteria 4678
400 Ga0501080_0038976 3300049742 Bacteria 4434
401 Ga0501083_0035658 3300049744 Bacteria 3397
402 Ga0501035_0000147 3300049822 Bacteria 85803
403 Ga0501044_0000152 3300049823 Bacteria 85715
404 Ga0501044_0000601 3300049823 Bacteria 43671
405 Ga0501044_0021774 3300049823 Bacteria 6836
406 nmdc:mga03n38_80309_c1 3300050490 Bacteria 1531
407 nmdc:mga00v17_3542_c1 3300050491 Bacteria 8068
408 nmdc:mga00v17_45185_c1 3300050491 Bacteria 2660
409 nmdc:mga00v17_6246_c1 3300050491 Bacteria 6317
410 nmdc:mga00v17_85079_c1 3300050491 Bacteria 1980
411 nmdc:mga00v17_97914_c1 3300050491 Bacteria 1849
412 nmdc:mga0yw44_83702_c1 3300050492 Bacteria 2004
413 nmdc:mga0yw44_9106_c1 3300050492 Bacteria 4994
414 nmdc:mga07m45_11737_c1 3300050496 Bacteria 2139
415 nmdc:mga07m45_2227_c1 3300050496 Bacteria 9061
416 nmdc:mga05p37_280843_c1 3300050507 Bacteria 1986
417 nmdc:mga0qj67_62870_c1 3300050509 Bacteria 2951
418 nmdc:mga06r32_30_c3 3300050510 Bacteria 20656
419 nmdc:mga0sz30_1521_c1 3300050516 Bacteria 8258
420 nmdc:mga0sz30_25960_c1 3300050516 Bacteria 2398
421 nmdc:mga0sz30_7826_c1 3300050516 Bacteria 4018
422 Ga0500610_0015199 3300053079 Bacteria 3638
423 Ga0500652_004684 3300053131 Bacteria 4254
424 Ga0500559_0036280 3300053136 Bacteria 2131
425 Ga0500616_0005159 3300053153 Bacteria 8968
426 Ga0500645_001463 3300053730 Bacteria 11884
427 Ga0466962_0015562 3300061719 Bacteria 3668
428 Ga0466962_0018205 3300061719 Bacteria 3379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100004858 Ga0070671_1000048583 341
2 3300005548 Ga0070665_100007328 Ga0070665_1000073287 343
3 3300005841 Ga0068863_100010519 Ga0068863_1000105193 343
4 3300026088 Ga0207641_10022274 Ga0207641_100222742 343
5 3300028379 Ga0268266_10003903 Ga0268266_100039035 343
6 3300049571 Ga0501034_0300802 Ga0501034_0300802_275_1402 343
7 3300005347 Ga0070668_100005168 Ga0070668_1000051685 344
8 3300005367 Ga0070667_100110946 Ga0070667_1001109461 344
9 3300025986 Ga0207658_10227585 Ga0207658_102275852 344
10 3300026088 Ga0207641_10024438 Ga0207641_100244382 344
11 3300048911 Ga0496108_0125073 Ga0496108_0125073_1015_2142 344
12 3300048913 Ga0496110_0079943 Ga0496110_0079943_311_1438 344
13 3300048915 Ga0496112_0003504 Ga0496112_0003504_5976_7103 344
14 3300048916 Ga0496113_0003388 Ga0496113_0003388_2167_3294 344
15 3300006051 Ga0075364_10002046 Ga0075364_1000204611 346
16 3300006177 Ga0075362_10012581 Ga0075362_100125812 346
17 3300006186 Ga0075369_10049109 Ga0075369_100491092 346
18 3300050516 nmdc:mga0sz30_7826_c1 nmdc:mga0sz30_7826_c1_226_1353 346
19 3300045049 Ga0466959_0105340 Ga0466959_0105340_12_1070 350
20 3300045836 Ga0466958_0245885 Ga0466958_0245885_15_1073 350
21 3300044658 Ga0466972_0036543 Ga0466972_0036543_404_1531 355
22 3300025904 Ga0207647_10098497 Ga0207647_100984972 357
23 iso_pu_bacteria 2751185734 2753070311 362
24 3300044683 Ga0466965_0050359 Ga0466965_0050359_354_1445 363
25 3300006186 Ga0075369_10051661 Ga0075369_100516612 365
26 iso_pu_bacteria 2738541264 2738668039 365
27 iso_pu_bacteria 2738541356 2739147109 365
28 3300031251 Ga0265327_10027707 Ga0265327_100277073 367
29 3300005436 Ga0070713_100357047 Ga0070713_1003570471 368
30 3300025929 Ga0207664_10013232 Ga0207664_100132326 368
31 3300032005 Ga0307411_10015906 Ga0307411_100159062 368
32 3300042007 Ga0439449_0004426 Ga0439449_0004426_2833_3951 368
33 iso_pu_bacteria 2523231044 2523386910 368
34 iso_pu_bacteria 2751185725 2753038134 368
35 iso_pu_bacteria 2751185792 2753326645 368
36 iso_pu_bacteria 2842134933 2842137489 368
37 iso_pu_bacteria 2870721527 2870729884 368
38 iso_pu_bacteria 2904765812 2904769382 368
39 iso_pu_bacteria 2904770941 2904772938 368
40 iso_pu_bacteria 2908811453 2908814238 368
41 iso_pu_bacteria 2919420072 2919422696 368
42 iso_pu_bacteria 2919432681 2919435051 368
43 3300009545 Ga0105237_10000175 Ga0105237_1000017580 369
44 3300045976 Ga0466967_0015054 Ga0466967_0015054_2193_3320 369
45 3300048904 Ga0496101_0000046 Ga0496101_0000046_9980_11107 369
46 3300048905 Ga0496102_0000025 Ga0496102_0000025_56693_57820 369
47 3300048906 Ga0496103_0000022 Ga0496103_0000022_56693_57820 369
48 3300048919 Ga0496116_0000059 Ga0496116_0000059_216672_217799 369
49 3300048920 Ga0496117_0000055 Ga0496117_0000055_56693_57820 369
50 3300048921 Ga0496118_0000058 Ga0496118_0000058_56693_57820 369
51 3300048922 Ga0496119_0000278 Ga0496119_0000278_60665_61792 369
52 3300048923 Ga0496120_0000384 Ga0496120_0000384_9684_10811 369
53 3300048924 Ga0496121_0000113 Ga0496121_0000113_170695_171822 369
54 3300048929 Ga0496126_0034916 Ga0496126_0034916_1667_2794 369
55 iso_pu_bacteria 2551306166 2552107086 369
56 iso_pu_bacteria 2565956761 2566993545 369
57 iso_pu_bacteria 2643221692 2644514492 369
58 iso_pu_bacteria 2738541308 2738887000 369
59 iso_pu_bacteria 2738543011 2739238250 369
60 iso_pu_bacteria 2889300758 2889302208 369
61 iso_pu_bacteria 2902799365 2902803986 369
62 iso_pu_bacteria 2922554459 2922560585 369
63 iso_pu_bacteria 2928142448 2928146097 369
64 iso_pu_bacteria 2939743619 2939748892 369
65 3300014325 Ga0163163_10153786 Ga0163163_101537862 370
66 3300041452 Ga0451793_0567042 Ga0451793_0567042_1736_2848 370
67 3300041453 Ga0451797_0218048 Ga0451797_0218048_267_1379 370
68 3300041456 Ga0451795_0910137 Ga0451795_0910137_549_1661 370
69 3300041460 Ga0451802_1343992 Ga0451802_1343992_262_1374 370
70 3300041512 Ga0451853_1434083 Ga0451853_1434083_484_1596 370
71 iso_pu_bacteria 2643221687 2644488844 370
72 iso_pu_bacteria 2643221715 2644635279 370
73 iso_pu_bacteria 2791354901 2791912613 370
74 iso_pu_bacteria 2795385470 2795784371 370
75 iso_pu_bacteria 2899370129 2899371746 370
76 iso_pu_bacteria 2902792274 2902797046 370
77 iso_pu_bacteria 2902837492 2902838718 370
78 iso_pu_bacteria 8047710418 8047711751 370
79 3300031838 Ga0307518_10001333 Ga0307518_100013339 371
80 3300050510 nmdc:mga06r32_30_c3 nmdc:mga06r32_30_c3_11733_12848 371
81 iso_pu_bacteria 2932398195 2932398748 371
82 iso_pu_bacteria 2939582691 2939588379 371
83 3300003792 Ga0055540_1000134 Ga0055540_100013461 372
84 3300005338 Ga0068868_100004650 Ga0068868_1000046507 372
85 3300005340 Ga0070689_100001922 Ga0070689_10000192210 372
86 3300005341 Ga0070691_10022332 Ga0070691_100223323 372
87 3300005343 Ga0070687_100017259 Ga0070687_1000172591 372
88 3300005347 Ga0070668_100005072 Ga0070668_1000050726 372
89 3300005347 Ga0070668_100037059 Ga0070668_1000370592 372
90 3300005353 Ga0070669_100112727 Ga0070669_1001127272 372
91 3300005354 Ga0070675_100099078 Ga0070675_1000990782 372
92 3300005356 Ga0070674_100000581 Ga0070674_10000058110 372
93 3300005365 Ga0070688_100005050 Ga0070688_1000050502 372
94 3300005365 Ga0070688_100018288 Ga0070688_1000182882 372
95 3300005366 Ga0070659_100073275 Ga0070659_1000732753 372
96 3300005367 Ga0070667_100000249 Ga0070667_10000024934 372
97 3300005437 Ga0070710_10004835 Ga0070710_100048352 372
98 3300005437 Ga0070710_10027001 Ga0070710_100270011 372
99 3300005438 Ga0070701_10035548 Ga0070701_100355482 372
100 3300005439 Ga0070711_100001079 Ga0070711_10000107910 372
101 3300005440 Ga0070705_100004751 Ga0070705_1000047512 372
102 3300005455 Ga0070663_100040639 Ga0070663_1000406392 372
103 3300005457 Ga0070662_100054175 Ga0070662_1000541752 372
104 3300005459 Ga0068867_100009541 Ga0068867_1000095413 372
105 3300005539 Ga0068853_100012717 Ga0068853_1000127173 372
106 3300005546 Ga0070696_100004718 Ga0070696_1000047183 372
107 3300005548 Ga0070665_100037085 Ga0070665_1000370853 372
108 3300005548 Ga0070665_100071884 Ga0070665_1000718843 372
109 3300005549 Ga0070704_100000677 Ga0070704_1000006778 372
110 3300005549 Ga0070704_100015278 Ga0070704_1000152783 372
111 3300005578 Ga0068854_100006312 Ga0068854_1000063126 372
112 3300005614 Ga0068856_100302217 Ga0068856_1003022172 372
113 3300005615 Ga0070702_100005596 Ga0070702_1000055965 372
114 3300005616 Ga0068852_100170274 Ga0068852_1001702742 372
115 3300005617 Ga0068859_100007439 Ga0068859_10000743910 372
116 3300005718 Ga0068866_10000520 Ga0068866_100005205 372
117 3300005719 Ga0068861_100003598 Ga0068861_1000035988 372
118 3300005719 Ga0068861_100021255 Ga0068861_1000212552 372
119 3300005842 Ga0068858_100035333 Ga0068858_1000353333 372
120 3300005843 Ga0068860_100006908 Ga0068860_1000069087 372
121 3300005844 Ga0068862_100004016 Ga0068862_1000040165 372
122 3300005937 Ga0081455_10014353 Ga0081455_100143533 372
123 3300006038 Ga0075365_10017879 Ga0075365_100178795 372
124 3300006038 Ga0075365_10194532 Ga0075365_101945322 372
125 3300006048 Ga0075363_100011700 Ga0075363_1000117005 372
126 3300006051 Ga0075364_10030735 Ga0075364_100307353 372
127 3300006163 Ga0070715_10041136 Ga0070715_100411363 372
128 3300006173 Ga0070716_100005387 Ga0070716_1000053873 372
129 3300006173 Ga0070716_100009449 Ga0070716_1000094494 372
130 3300006175 Ga0070712_100001110 Ga0070712_10000111010 372
131 3300006175 Ga0070712_100052477 Ga0070712_1000524773 372
132 3300006186 Ga0075369_10019019 Ga0075369_100190192 372
133 3300006186 Ga0075369_10027773 Ga0075369_100277733 372
134 3300006353 Ga0075370_10077775 Ga0075370_100777752 372
135 3300006844 Ga0075428_100001482 Ga0075428_10000148214 372
136 3300006846 Ga0075430_100187442 Ga0075430_1001874422 372
137 3300006847 Ga0075431_100016513 Ga0075431_1000165135 372
138 3300006881 Ga0068865_100004263 Ga0068865_1000042633 372
139 3300006931 Ga0097620_100007439 Ga0097620_1000074392 372
140 3300009098 Ga0105245_10000546 Ga0105245_1000054610 372
141 3300009098 Ga0105245_10469921 Ga0105245_104699211 372
142 3300009101 Ga0105247_10000268 Ga0105247_1000026810 372
143 3300009147 Ga0114129_10034477 Ga0114129_100344771 372
144 3300009148 Ga0105243_10001875 Ga0105243_100018759 372
145 3300009176 Ga0105242_10001078 Ga0105242_1000107815 372
146 3300009545 Ga0105237_10010809 Ga0105237_100108096 372
147 3300009551 Ga0105238_10341401 Ga0105238_103414011 372
148 3300010375 Ga0105239_10050872 Ga0105239_100508721 372
149 3300010375 Ga0105239_10098301 Ga0105239_100983012 372
150 3300010375 Ga0105239_10175375 Ga0105239_101753752 372
151 3300013105 Ga0157369_10246359 Ga0157369_102463592 372
152 3300013296 Ga0157374_10003900 Ga0157374_100039008 372
153 3300013297 Ga0157378_10000438 Ga0157378_100004387 372
154 3300013306 Ga0163162_10008681 Ga0163162_100086812 372
155 3300013307 Ga0157372_10221681 Ga0157372_102216812 372
156 3300013307 Ga0157372_10330496 Ga0157372_103304961 372
157 3300013308 Ga0157375_10002558 Ga0157375_100025588 372
158 3300014326 Ga0157380_10001136 Ga0157380_1000113614 372
159 3300014968 Ga0157379_10012283 Ga0157379_100122838 372
160 3300014969 Ga0157376_10044661 Ga0157376_100446613 372
161 3300017792 Ga0163161_10146404 Ga0163161_101464042 372
162 3300025303 Ga0209051_1000076 Ga0209051_100007661 372
163 3300025898 Ga0207692_10004944 Ga0207692_100049445 372
164 3300025899 Ga0207642_10000604 Ga0207642_100006042 372
165 3300025900 Ga0207710_10005073 Ga0207710_100050735 372
166 3300025901 Ga0207688_10001107 Ga0207688_1000110711 372
167 3300025901 Ga0207688_10001483 Ga0207688_100014837 372
168 3300025903 Ga0207680_10090372 Ga0207680_100903722 372
169 3300025905 Ga0207685_10001625 Ga0207685_100016252 372
170 3300025905 Ga0207685_10004683 Ga0207685_100046831 372
171 3300025913 Ga0207695_10361858 Ga0207695_103618582 372
172 3300025914 Ga0207671_10014240 Ga0207671_100142402 372
173 3300025915 Ga0207693_10000694 Ga0207693_1000069427 372
174 3300025915 Ga0207693_10002045 Ga0207693_1000204510 372
175 3300025916 Ga0207663_10008466 Ga0207663_100084663 372
176 3300025916 Ga0207663_10014127 Ga0207663_100141272 372
177 3300025923 Ga0207681_10154943 Ga0207681_101549432 372
178 3300025926 Ga0207659_10173038 Ga0207659_101730382 372
179 3300025927 Ga0207687_10000192 Ga0207687_1000019239 372
180 3300025927 Ga0207687_10029043 Ga0207687_100290433 372
181 3300025932 Ga0207690_10018250 Ga0207690_100182502 372
182 3300025933 Ga0207706_10003591 Ga0207706_1000359110 372
183 3300025934 Ga0207686_10024742 Ga0207686_100247422 372
184 3300025935 Ga0207709_10003124 Ga0207709_100031245 372
185 3300025937 Ga0207669_10000794 Ga0207669_100007942 372
186 3300025938 Ga0207704_10001730 Ga0207704_1000173011 372
187 3300025939 Ga0207665_10002960 Ga0207665_1000296010 372
188 3300025939 Ga0207665_10008830 Ga0207665_100088306 372
189 3300025940 Ga0207691_10038642 Ga0207691_100386424 372
190 3300025942 Ga0207689_10013574 Ga0207689_100135747 372
191 3300025942 Ga0207689_10031406 Ga0207689_100314063 372
192 3300025949 Ga0207667_10195612 Ga0207667_101956122 372
193 3300025961 Ga0207712_10007592 Ga0207712_100075925 372
194 3300025972 Ga0207668_10001297 Ga0207668_100012972 372
195 3300025972 Ga0207668_10051127 Ga0207668_100511273 372
196 3300025981 Ga0207640_10001367 Ga0207640_100013672 372
197 3300025986 Ga0207658_10001438 Ga0207658_1000143816 372
198 3300025986 Ga0207658_10003137 Ga0207658_100031373 372
199 3300026023 Ga0207677_10015468 Ga0207677_100154684 372
200 3300026023 Ga0207677_10036045 Ga0207677_100360453 372
201 3300026035 Ga0207703_10002411 Ga0207703_100024115 372
202 3300026041 Ga0207639_10031997 Ga0207639_100319972 372
203 3300026067 Ga0207678_10005920 Ga0207678_1000592010 372
204 3300026089 Ga0207648_10001309 Ga0207648_1000130918 372
205 3300026118 Ga0207675_100001516 Ga0207675_10000151615 372
206 3300026118 Ga0207675_100060312 Ga0207675_1000603123 372
207 3300026121 Ga0207683_10000275 Ga0207683_1000027510 372
208 3300028379 Ga0268266_10057217 Ga0268266_100572172 372
209 3300028379 Ga0268266_10196973 Ga0268266_101969731 372
210 3300028380 Ga0268265_10002946 Ga0268265_100029462 372
211 3300031251 Ga0265327_10007006 Ga0265327_100070066 372
212 3300031903 Ga0307407_10061470 Ga0307407_100614702 372
213 3300031995 Ga0307409_100006153 Ga0307409_1000061532 372
214 3300032002 Ga0307416_100019701 Ga0307416_1000197013 372
215 3300035691 Ga0373931_0019848 Ga0373931_0019848_353_1480 372
216 3300041413 Ga0439465_0016444 Ga0439465_0016444_159_1295 372
217 3300041413 Ga0439465_0032486 Ga0439465_0032486_504_1631 372
218 3300042004 Ga0439445_0031479 Ga0439445_0031479_59_1195 372
219 3300042005 Ga0439448_0012144 Ga0439448_0012144_1071_2240 372
220 3300044693 Ga0466961_0027334 Ga0466961_0027334_814_1941 372
221 3300044706 Ga0466964_0052980 Ga0466964_0052980_476_1627 372
222 3300044719 Ga0466971_0076143 Ga0466971_0076143_39_1166 372
223 3300044735 Ga0466968_0034103 Ga0466968_0034103_878_2005 372
224 3300044765 Ga0466970_0098333 Ga0466970_0098333_393_1520 372
225 3300044842 Ga0466957_0097457 Ga0466957_0097457_98_1225 372
226 3300045049 Ga0466959_0014134 Ga0466959_0014134_823_1950 372
227 3300045976 Ga0466967_0135635 Ga0466967_0135635_892_2028 372
228 3300048903 Ga0496100_0000023 Ga0496100_0000023_51524_52663 372
229 3300048903 Ga0496100_0094307 Ga0496100_0094307_641_1777 372
230 3300048904 Ga0496101_0000089 Ga0496101_0000089_95581_96720 372
231 3300048904 Ga0496101_0004942 Ga0496101_0004942_2981_4117 372
232 3300048905 Ga0496102_0000873 Ga0496102_0000873_8913_10049 372
233 3300048905 Ga0496102_0003346 Ga0496102_0003346_4348_5475 372
234 3300048905 Ga0496102_0163737 Ga0496102_0163737_209_1336 372
235 3300048906 Ga0496103_0000494 Ga0496103_0000494_27107_28243 372
236 3300048906 Ga0496103_0001263 Ga0496103_0001263_9204_10343 372
237 3300048907 Ga0496104_0030504 Ga0496104_0030504_1079_2206 372
238 3300048909 Ga0496106_0002689 Ga0496106_0002689_669_1805 372
239 3300048909 Ga0496106_0036504 Ga0496106_0036504_262_1401 372
240 3300048910 Ga0496107_0000580 Ga0496107_0000580_16035_17171 372
241 3300048910 Ga0496107_0029544 Ga0496107_0029544_1234_2373 372
242 3300048910 Ga0496107_0047398 Ga0496107_0047398_559_1686 372
243 3300048911 Ga0496108_0000453 Ga0496108_0000453_19331_20458 372
244 3300048911 Ga0496108_0002856 Ga0496108_0002856_782_1921 372
245 3300048912 Ga0496109_0000037 Ga0496109_0000037_55188_56327 372
246 3300048912 Ga0496109_0014844 Ga0496109_0014844_1083_2210 372
247 3300048913 Ga0496110_0000823 Ga0496110_0000823_742_1881 372
248 3300048913 Ga0496110_0087640 Ga0496110_0087640_1622_2749 372
249 3300048914 Ga0496111_0038965 Ga0496111_0038965_2008_3147 372
250 3300048915 Ga0496112_0083632 Ga0496112_0083632_1322_2449 372
251 3300048917 Ga0496114_0000360 Ga0496114_0000360_26729_27865 372
252 3300048917 Ga0496114_0002500 Ga0496114_0002500_9555_10694 372
253 3300048917 Ga0496114_0114588 Ga0496114_0114588_658_1785 372
254 3300048918 Ga0496115_0003598 Ga0496115_0003598_9500_10636 372
255 3300048921 Ga0496118_0088859 Ga0496118_0088859_444_1583 372
256 3300048924 Ga0496121_0000068 Ga0496121_0000068_95580_96719 372
257 3300048925 Ga0496122_0000687 Ga0496122_0000687_9725_10864 372
258 3300048926 Ga0496123_0018116 Ga0496123_0018116_3914_5053 372
259 3300048927 Ga0496124_0000065 Ga0496124_0000065_126876_128015 372
260 3300048928 Ga0496125_0000008 Ga0496125_0000008_607959_609098 372
261 3300048929 Ga0496126_0000062 Ga0496126_0000062_95580_96719 372
262 3300049571 Ga0501034_0304407 Ga0501034_0304407_236_1363 372
263 3300050490 nmdc:mga03n38_80309_c1 nmdc:mga03n38_80309_c1_207_1334 372
264 3300050491 nmdc:mga00v17_3542_c1 nmdc:mga00v17_3542_c1_2384_3511 372
265 3300050491 nmdc:mga00v17_45185_c1 nmdc:mga00v17_45185_c1_272_1399 372
266 3300050491 nmdc:mga00v17_85079_c1 nmdc:mga00v17_85079_c1_484_1611 372
267 3300050491 nmdc:mga00v17_97914_c1 nmdc:mga00v17_97914_c1_125_1252 372
268 3300050492 nmdc:mga0yw44_83702_c1 nmdc:mga0yw44_83702_c1_456_1583 372
269 3300050492 nmdc:mga0yw44_9106_c1 nmdc:mga0yw44_9106_c1_116_1243 372
270 3300050496 nmdc:mga07m45_2227_c1 nmdc:mga07m45_2227_c1_339_1466 372
271 3300050507 nmdc:mga05p37_280843_c1 nmdc:mga05p37_280843_c1_148_1275 372
272 3300050509 nmdc:mga0qj67_62870_c1 nmdc:mga0qj67_62870_c1_1539_2666 372
273 3300050516 nmdc:mga0sz30_1521_c1 nmdc:mga0sz30_1521_c1_4731_5858 372
274 3300050516 nmdc:mga0sz30_25960_c1 nmdc:mga0sz30_25960_c1_416_1579 372
275 iso_pu_bacteria 2547132424 2548694595 372
276 iso_pu_bacteria 2902810491 2902812844 372
277 iso_pu_bacteria 2919713450 2919718710 372
278 iso_pu_bacteria 2929212328 2929216291 372
279 3300003322 rootL2_10127992 rootL2_101279921 373
280 3300005843 Ga0068860_100380656 Ga0068860_1003806562 373
281 3300009148 Ga0105243_10000329 Ga0105243_100003293 373
282 3300021384 Ga0213876_10043583 Ga0213876_100435831 373
283 3300025935 Ga0207709_10007317 Ga0207709_100073175 373
284 3300031251 Ga0265327_10000021 Ga0265327_10000021180 373
285 3300033179 Ga0307507_10023887 Ga0307507_100238872 373
286 3300039437 Ga0436365_0969503 Ga0436365_0969503_381_1511 373
287 3300039437 Ga0436365_1883040 Ga0436365_1883040_6341_7480 373
288 3300044901 Ga0466960_0000661 Ga0466960_0000661_635_1774 373
289 3300045976 Ga0466967_0025048 Ga0466967_0025048_1349_2488 373
290 3300048905 Ga0496102_0116847 Ga0496102_0116847_22_1152 373
291 3300048921 Ga0496118_0004813 Ga0496118_0004813_4070_5200 373
292 3300049569 Ga0501032_0003739 Ga0501032_0003739_8959_10089 373
293 3300049571 Ga0501034_0000651 Ga0501034_0000651_47322_48452 373
294 3300049572 Ga0501036_0075339 Ga0501036_0075339_340_1470 373
295 3300049573 Ga0501037_0025737 Ga0501037_0025737_1025_2155 373
296 3300049579 Ga0501043_0011222 Ga0501043_0011222_4248_5378 373
297 3300049580 Ga0501046_0012802 Ga0501046_0012802_4962_6092 373
298 3300049581 Ga0501047_0005492 Ga0501047_0005492_5708_6838 373
299 3300049582 Ga0501048_0013667 Ga0501048_0013667_3345_4475 373
300 3300049585 Ga0501069_0030120 Ga0501069_0030120_1470_2600 373
301 3300049586 Ga0501070_0002399 Ga0501070_0002399_1682_2812 373
302 3300049589 Ga0501073_0021262 Ga0501073_0021262_1375_2505 373
303 3300049742 Ga0501080_0038976 Ga0501080_0038976_1635_2765 373
304 3300049744 Ga0501083_0035658 Ga0501083_0035658_30_1160 373
305 3300049823 Ga0501044_0000601 Ga0501044_0000601_35100_36230 373
306 iso_pu_bacteria 2582580736 2583150622 373
307 iso_pu_bacteria 2585427649 2586059514 373
308 iso_pu_bacteria 2738541274 2738703910 373
309 iso_pu_bacteria 2738543028 2739330784 373
310 iso_pu_bacteria 2795385472 2795794134 373
311 iso_pu_bacteria 2808606522 2809591719 373
312 iso_pu_bacteria 2866612099 2866615695 373
313 iso_pu_bacteria 2891326441 2891331949 373
314 iso_pu_bacteria 2899359706 2899363480 373
315 iso_pu_bacteria 2915768154 2915771819 373
316 iso_pu_bacteria 2917736166 2917741125 373
317 iso_pu_bacteria 3001119090 3001119585 373
318 iso_pu_bacteria 8003314358 8003321893 373
319 3300003792 Ga0055540_1002702 Ga0055540_10027027 374
320 3300003792 Ga0055540_1002706 Ga0055540_10027063 374
321 3300003792 Ga0055540_1005160 Ga0055540_10051603 374
322 3300005337 Ga0070682_100006963 Ga0070682_1000069632 374
323 3300005347 Ga0070668_100023111 Ga0070668_1000231112 374
324 3300005353 Ga0070669_100001818 Ga0070669_10000181814 374
325 3300005366 Ga0070659_100248021 Ga0070659_1002480212 374
326 3300005367 Ga0070667_100000191 Ga0070667_10000019110 374
327 3300005435 Ga0070714_100020706 Ga0070714_1000207066 374
328 3300005548 Ga0070665_100003487 Ga0070665_1000034874 374
329 3300005563 Ga0068855_100192704 Ga0068855_1001927042 374
330 3300005617 Ga0068859_100000266 Ga0068859_10000026644 374
331 3300005841 Ga0068863_100006960 Ga0068863_1000069602 374
332 3300005841 Ga0068863_100220597 Ga0068863_1002205972 374
333 3300005842 Ga0068858_100006097 Ga0068858_1000060975 374
334 3300005843 Ga0068860_100000166 Ga0068860_10000016611 374
335 3300005844 Ga0068862_100000003 Ga0068862_10000000315 374
336 3300006028 Ga0070717_10234631 Ga0070717_102346312 374
337 3300006353 Ga0075370_10046283 Ga0075370_100462833 374
338 3300006931 Ga0097620_100000266 Ga0097620_10000026644 374
339 3300009101 Ga0105247_10000006 Ga0105247_10000006311 374
340 3300009177 Ga0105248_10000042 Ga0105248_1000004259 374
341 3300009553 Ga0105249_10000008 Ga0105249_10000008106 374
342 3300014968 Ga0157379_10013754 Ga0157379_100137545 374
343 3300014968 Ga0157379_10123126 Ga0157379_101231262 374
344 3300021384 Ga0213876_10002032 Ga0213876_100020323 374
345 3300021388 Ga0213875_10011367 Ga0213875_100113672 374
346 3300025303 Ga0209051_1001181 Ga0209051_10011814 374
347 3300025303 Ga0209051_1004067 Ga0209051_10040674 374
348 3300025900 Ga0207710_10000114 Ga0207710_1000011476 374
349 3300025914 Ga0207671_10004714 Ga0207671_100047142 374
350 3300025923 Ga0207681_10001429 Ga0207681_100014292 374
351 3300025941 Ga0207711_10004556 Ga0207711_100045565 374
352 3300025961 Ga0207712_10000011 Ga0207712_10000011214 374
353 3300025972 Ga0207668_10012876 Ga0207668_100128765 374
354 3300025986 Ga0207658_10000071 Ga0207658_1000007142 374
355 3300026035 Ga0207703_10030383 Ga0207703_100303832 374
356 3300026088 Ga0207641_10001975 Ga0207641_1000197520 374
357 3300028380 Ga0268265_10000010 Ga0268265_1000001016 374
358 3300028381 Ga0268264_10000007 Ga0268264_10000007550 374
359 3300037853 Ga0436364_0914231 Ga0436364_0914231_3324_4457 374
360 3300037853 Ga0436364_1493017 Ga0436364_1493017_5351_6484 374
361 3300039437 Ga0436365_0634291 Ga0436365_0634291_49618_50751 374
362 3300039450 Ga0436363_1308336 Ga0436363_1308336_6080_7213 374
363 3300039450 Ga0436363_1368468 Ga0436363_1368468_479_1615 374
364 3300044684 Ga0466966_0002708 Ga0466966_0002708_6560_7696 374
365 3300044693 Ga0466961_0002435 Ga0466961_0002435_6554_7690 374
366 3300044694 Ga0466963_0056673 Ga0466963_0056673_786_1922 374
367 3300045049 Ga0466959_0007484 Ga0466959_0007484_2679_3815 374
368 3300045836 Ga0466958_0004820 Ga0466958_0004820_2141_3277 374
369 3300045836 Ga0466958_0008300 Ga0466958_0008300_2690_3826 374
370 3300045976 Ga0466967_0018363 Ga0466967_0018363_848_1993 374
371 3300046459 Ga0495629_0005217 Ga0495629_0005217_2817_3962 374
372 3300046461 Ga0495641_0009046 Ga0495641_0009046_827_1972 374
373 3300046472 Ga0495580_0185342 Ga0495580_0185342_288_1418 374
374 3300046473 Ga0495582_0013901 Ga0495582_0013901_1280_2425 374
375 3300046511 Ga0495608_0203974 Ga0495608_0203974_23_1162 374
376 3300046524 Ga0495648_0001449 Ga0495648_0001449_21097_22239 374
377 3300046616 Ga0495668_0038107 Ga0495668_0038107_360_1502 374
378 3300046642 Ga0495634_0105384 Ga0495634_0105384_240_1385 374
379 3300047320 Ga0495672_0003532 Ga0495672_0003532_4033_5175 374
380 3300047469 Ga0495673_0000367 Ga0495673_0000367_19445_20587 374
381 3300047472 Ga0495686_0058767 Ga0495686_0058767_1181_2323 374
382 3300048903 Ga0496100_0023730 Ga0496100_0023730_2298_3440 374
383 3300048904 Ga0496101_0000941 Ga0496101_0000941_809_1951 374
384 3300048905 Ga0496102_0000783 Ga0496102_0000783_725_1867 374
385 3300048905 Ga0496102_0164857 Ga0496102_0164857_279_1421 374
386 3300048906 Ga0496103_0001334 Ga0496103_0001334_5611_6753 374
387 3300048906 Ga0496103_0140039 Ga0496103_0140039_279_1424 374
388 3300048907 Ga0496104_0007792 Ga0496104_0007792_3688_4830 374
389 3300048908 Ga0496105_0017731 Ga0496105_0017731_2363_3505 374
390 3300048909 Ga0496106_0001191 Ga0496106_0001191_8692_9834 374
391 3300048909 Ga0496106_0015320 Ga0496106_0015320_4378_5511 374
392 3300048909 Ga0496106_0159346 Ga0496106_0159346_631_1773 374
393 3300048910 Ga0496107_0016901 Ga0496107_0016901_809_1951 374
394 3300048910 Ga0496107_0194269 Ga0496107_0194269_218_1360 374
395 3300048916 Ga0496113_0171210 Ga0496113_0171210_196_1341 374
396 3300048917 Ga0496114_0003506 Ga0496114_0003506_8590_9732 374
397 3300048917 Ga0496114_0111171 Ga0496114_0111171_30_1154 374
398 3300048918 Ga0496115_0023055 Ga0496115_0023055_1264_2406 374
399 3300048920 Ga0496117_0000595 Ga0496117_0000595_47846_48988 374
400 3300048921 Ga0496118_0000786 Ga0496118_0000786_6345_7487 374
401 3300048922 Ga0496119_0011482 Ga0496119_0011482_1733_2875 374
402 3300048923 Ga0496120_0007979 Ga0496120_0007979_922_2064 374
403 3300048924 Ga0496121_0014051 Ga0496121_0014051_784_1926 374
404 3300048924 Ga0496121_0131936 Ga0496121_0131936_223_1365 374
405 3300048927 Ga0496124_0192110 Ga0496124_0192110_288_1436 374
406 3300048929 Ga0496126_0034782 Ga0496126_0034782_3502_4644 374
407 3300049569 Ga0501032_0001215 Ga0501032_0001215_9780_10919 374
408 3300049571 Ga0501034_0005626 Ga0501034_0005626_6800_7939 374
409 3300049572 Ga0501036_0009893 Ga0501036_0009893_4720_5859 374
410 3300049573 Ga0501037_0000222 Ga0501037_0000222_36821_37960 374
411 3300049574 Ga0501038_0005120 Ga0501038_0005120_8316_9455 374
412 3300049575 Ga0501039_0035537 Ga0501039_0035537_17_1156 374
413 3300049579 Ga0501043_0000225 Ga0501043_0000225_29758_30897 374
414 3300049579 Ga0501043_0177561 Ga0501043_0177561_120_1256 374
415 3300049581 Ga0501047_0011512 Ga0501047_0011512_196_1332 374
416 3300049584 Ga0501068_0069270 Ga0501068_0069270_196_1335 374
417 3300049586 Ga0501070_0002172 Ga0501070_0002172_1190_2329 374
418 3300049822 Ga0501035_0000147 Ga0501035_0000147_84574_85710 374
419 3300049823 Ga0501044_0000152 Ga0501044_0000152_84460_85596 374
420 3300049823 Ga0501044_0021774 Ga0501044_0021774_4357_5496 374
421 3300050491 nmdc:mga00v17_6246_c1 nmdc:mga00v17_6246_c1_1357_2499 374
422 3300050496 nmdc:mga07m45_11737_c1 nmdc:mga07m45_11737_c1_608_1750 374
423 3300053079 Ga0500610_0015199 Ga0500610_0015199_1156_2298 374
424 3300053131 Ga0500652_004684 Ga0500652_004684_1234_2376 374
425 3300053136 Ga0500559_0036280 Ga0500559_0036280_538_1674 374
426 3300053153 Ga0500616_0005159 Ga0500616_0005159_2590_3732 374
427 3300061719 Ga0466962_0018205 Ga0466962_0018205_1573_2715 374
428 3300031456 Ga0307513_10119006 Ga0307513_101190063 375
429 3300035119 Ga0373956_0016545 Ga0373956_0016545_274_1434 375
430 3300005436 Ga0070713_100293268 Ga0070713_1002932682 376
431 3300006186 Ga0075369_10023020 Ga0075369_100230202 376
432 3300009098 Ga0105245_10427287 Ga0105245_104272871 376
433 3300021384 Ga0213876_10039588 Ga0213876_100395882 376
434 3300025303 Ga0209051_1008457 Ga0209051_10084573 376
435 3300025901 Ga0207688_10144780 Ga0207688_101447801 376
436 3300025929 Ga0207664_10071360 Ga0207664_100713603 376
437 3300025929 Ga0207664_10073728 Ga0207664_100737282 376
438 3300025942 Ga0207689_10090275 Ga0207689_100902751 376
439 3300026023 Ga0207677_10182220 Ga0207677_101822201 376
440 3300031251 Ga0265327_10000071 Ga0265327_1000007170 376
441 3300041411 Ga0439466_0003129 Ga0439466_0003129_1878_3020 376
442 3300041512 Ga0451853_0133000 Ga0451853_0133000_3726_4922 376
443 3300044658 Ga0466972_0004630 Ga0466972_0004630_5363_6523 376
444 3300044683 Ga0466965_0006993 Ga0466965_0006993_3570_4730 376
445 3300044694 Ga0466963_0000134 Ga0466963_0000134_24592_25806 376
446 3300044719 Ga0466971_0026841 Ga0466971_0026841_1338_2552 376
447 3300044765 Ga0466970_0045192 Ga0466970_0045192_709_1863 376
448 3300044842 Ga0466957_0001854 Ga0466957_0001854_8600_9814 376
449 3300044842 Ga0466957_0008220 Ga0466957_0008220_3867_5021 376
450 3300044901 Ga0466960_0000304 Ga0466960_0000304_4822_5982 376
451 3300044901 Ga0466960_0005852 Ga0466960_0005852_1027_2181 376
452 3300045049 Ga0466959_0034589 Ga0466959_0034589_1311_2465 376
453 3300045976 Ga0466967_0227831 Ga0466967_0227831_371_1525 376
454 3300046501 Ga0495607_0101958 Ga0495607_0101958_261_1424 376
455 3300047323 Ga0495683_0003313 Ga0495683_0003313_1044_2207 376
456 3300047472 Ga0495686_0004603 Ga0495686_0004603_6683_7843 376
457 3300048916 Ga0496113_0040059 Ga0496113_0040059_839_1993 376
458 3300048928 Ga0496125_0151481 Ga0496125_0151481_166_1314 376
459 3300048929 Ga0496126_0005460 Ga0496126_0005460_10763_11917 376
460 3300053730 Ga0500645_001463 Ga0500645_001463_9388_10536 376
461 3300061719 Ga0466962_0015562 Ga0466962_0015562_223_1437 376
462 3300003203 JGI25406J46586_10002925 JGI25406J46586_100029252 377
463 3300005347 Ga0070668_100004726 Ga0070668_1000047264 377
464 3300005455 Ga0070663_100000664 Ga0070663_10000066417 377
465 3300005618 Ga0068864_100060439 Ga0068864_1000604391 377
466 3300005937 Ga0081455_10000443 Ga0081455_1000044321 377
467 3300005985 Ga0081539_10000242 Ga0081539_1000024241 377
468 3300013307 Ga0157372_10200518 Ga0157372_102005182 377
469 3300025927 Ga0207687_10165101 Ga0207687_101651012 377
470 3300025972 Ga0207668_10042918 Ga0207668_100429183 377
471 3300026067 Ga0207678_10000059 Ga0207678_1000005945 377
472 3300026116 Ga0207674_10202535 Ga0207674_102025352 377
473 3300028794 Ga0307515_10071216 Ga0307515_100712162 377
474 3300030522 Ga0307512_10008970 Ga0307512_1000897010 377
475 3300033179 Ga0307507_10009634 Ga0307507_100096345 377
476 3300044694 Ga0466963_0097912 Ga0466963_0097912_374_1540 377
477 3300044706 Ga0466964_0048130 Ga0466964_0048130_254_1411 377
478 3300044901 Ga0466960_0078812 Ga0466960_0078812_309_1466 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

171

344

0.96

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

184

330

0.91

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

11

164

0.79

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

202

360

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oka-assembly1.cif.gz_A crystal structure of corynebacterium glutamicum pimb' in complex with gdp-man (triclinic crystal form) 0.9394 1 372
3oka-assembly1.cif.gz_A crystal structure of corynebacterium glutamicum pimb' in complex with gdp-man (triclinic crystal form) 0.925 1 372
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8648 193 358
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.8522 2 374
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8489 193 358
ID Description Score Start End Superfamily
3okcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9516 1 166 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9495 195 359 3.40.50.2000
af_P9WMZ3_4_195_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.948 5 189 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9384 195 359 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9281 189 355 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A095X8G0-F1-model_v4 GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase 0.9573 1 372 GO:0009058
GO:0016758
AF-A0A7W0XRP9-F1-model_v4 Glycosyltransferase family 4 protein 0.9491 131 372 GO:0016758
AF-A0A7J9WIX1-F1-model_v4 Glycosyltransferase 0.943 1 376 GO:0009058
GO:0016758
AF-A0A095X8G0-F1-model_v4 GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase 0.9425 1 372 GO:0009058
GO:0016758
AF-A0A2V7CAM3-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9364 179 375 GO:0016757

Feature Viewer

pLDDT pTM Quality
91.91 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map