F451904

General Info

Members Datasets Scaffolds Average Seq Length
478 216 956 153

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_101179126|Ga0307409_1011791261
Length 169
Sequence MGGALVAPPVERGPPMQVTVVVVGKVREPLATAVAEYETRAGRYWPLAVHEVREESARGNTPPDTVRQREGERLLERVPAAAHLVVCDERGIGLSSEQFAAWLADRRDRAQDVAFALGGAFGLDGALRSRAGTLIALAPWTLPHELARLVLAEQLYRAGTLLRGEPYHK

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_101179126 3300031995 Bacteria 789
2 Ga0065715_10154132 3300005293 Bacteria 1696
3 Ga0065707_10085069 3300005295 Bacteria 6492
4 Ga0070658_10006065 3300005327 Bacteria 9800
5 Ga0070658_10077288 3300005327 Bacteria 2730
6 Ga0070658_10150642 3300005327 Bacteria 1947
7 Ga0070658_10212973 3300005327 Bacteria 1632
8 Ga0070658_10403134 3300005327 Bacteria 1175
9 Ga0070683_100026639 3300005329 Bacteria 5208
10 Ga0070683_100060837 3300005329 Bacteria 3510
11 Ga0070683_100117749 3300005329 Bacteria 2508
12 Ga0070683_100186795 3300005329 Bacteria 1967
13 Ga0070690_100212610 3300005330 Bacteria 1351
14 Ga0070670_100017277 3300005331 Bacteria 6188
15 Ga0070670_100190622 3300005331 Bacteria 1781
16 Ga0070670_100814934 3300005331 Unclassified 843
17 Ga0068869_100001089 3300005334 Bacteria 15841
18 Ga0070666_10254885 3300005335 Bacteria 1243
19 Ga0070680_100018586 3300005336 Bacteria 5494
20 Ga0070680_100055756 3300005336 Bacteria 3230
21 Ga0070682_100142403 3300005337 Bacteria 1636
22 Ga0070682_100564404 3300005337 Bacteria 893
23 Ga0068868_100042815 3300005338 Bacteria 3536
24 Ga0070660_100005894 3300005339 Bacteria 8478
25 Ga0070660_100041127 3300005339 Bacteria 3522
26 Ga0070660_100055577 3300005339 Bacteria 3059
27 Ga0070660_100086616 3300005339 Bacteria 2465
28 Ga0070660_100246441 3300005339 Bacteria 1456
29 Ga0070660_100390310 3300005339 Unclassified 1150
30 Ga0070660_100721012 3300005339 Bacteria 837
31 Ga0070660_101335115 3300005339 Bacteria 609
32 Ga0070689_100001085 3300005340 Bacteria 17060
33 Ga0070689_100304296 3300005340 Bacteria 1328
34 Ga0070691_10017175 3300005341 Bacteria 3330
35 Ga0070691_10115992 3300005341 Bacteria 1344
36 Ga0070691_10326147 3300005341 Bacteria 846
37 Ga0070687_100086679 3300005343 Bacteria 1722
38 Ga0070687_100185955 3300005343 Bacteria 1248
39 Ga0070661_100013207 3300005344 Bacteria 5798
40 Ga0070661_100013882 3300005344 Bacteria 5660
41 Ga0070661_100022773 3300005344 Bacteria 4485
42 Ga0070661_100060226 3300005344 Bacteria 2786
43 Ga0070661_100126557 3300005344 Bacteria 1917
44 Ga0070661_100160273 3300005344 Bacteria 1704
45 Ga0070661_100418501 3300005344 Bacteria 1062
46 Ga0070692_10015881 3300005345 Bacteria 3570
47 Ga0070668_100001891 3300005347 Bacteria 15310
48 Ga0070669_100000657 3300005353 Bacteria 25549
49 Ga0070675_100004160 3300005354 Bacteria 10989
50 Ga0070675_100685074 3300005354 Bacteria 933
51 Ga0070674_100088771 3300005356 Bacteria 2226
52 Ga0070673_100186017 3300005364 Bacteria 1781
53 Ga0070688_100029698 3300005365 Bacteria 3276
54 Ga0070659_100016388 3300005366 Bacteria 5564
55 Ga0070659_100019413 3300005366 Bacteria 5151
56 Ga0070659_101104412 3300005366 Bacteria 699
57 Ga0070667_100006856 3300005367 Bacteria 9461
58 Ga0070714_100255827 3300005435 Bacteria 1620
59 Ga0070701_10014459 3300005438 Bacteria 3620
60 Ga0070700_100025724 3300005441 Bacteria 3468
61 Ga0070694_100009972 3300005444 Bacteria 5838
62 Ga0070663_100004367 3300005455 Bacteria 8297
63 Ga0070663_100203312 3300005455 Bacteria 1547
64 Ga0070663_101570601 3300005455 Bacteria 586
65 Ga0070662_100000394 3300005457 Bacteria 26141
66 Ga0070681_10008311 3300005458 Bacteria 10164
67 Ga0070681_10088558 3300005458 Bacteria 3047
68 Ga0070681_10450101 3300005458 Bacteria 1200
69 Ga0068867_100015743 3300005459 Bacteria 5367
70 Ga0070685_10142005 3300005466 Bacteria 1513
71 Ga0070685_10697764 3300005466 Unclassified 740
72 Ga0070707_100105038 3300005468 Bacteria 2739
73 Ga0070707_100771588 3300005468 Bacteria 925
74 Ga0070698_100108021 3300005471 Bacteria 2750
75 Ga0070698_100296895 3300005471 Bacteria 1547
76 Ga0070698_100501357 3300005471 Bacteria 1152
77 Ga0070699_100031397 3300005518 Bacteria 4585
78 Ga0070699_100310623 3300005518 Unclassified 1415
79 Ga0070679_100061151 3300005530 Bacteria 3754
80 Ga0070679_100149323 3300005530 Bacteria 2314
81 Ga0070679_100168097 3300005530 Bacteria 2166
82 Ga0070679_100266123 3300005530 Unclassified 1669
83 Ga0070679_100317630 3300005530 Unclassified 1507
84 Ga0070679_100488834 3300005530 Bacteria 1175
85 Ga0070684_100057028 3300005535 Bacteria 3410
86 Ga0070684_100078374 3300005535 Bacteria 2919
87 Ga0070684_100103116 3300005535 Bacteria 2551
88 Ga0070684_100161365 3300005535 Bacteria 2034
89 Ga0070684_100273730 3300005535 Unclassified 1546
90 Ga0070684_101096872 3300005535 Bacteria 748
91 Ga0068853_100011969 3300005539 Bacteria 7055
92 Ga0068853_100050948 3300005539 Bacteria 3562
93 Ga0068853_100209559 3300005539 Bacteria 1776
94 Ga0068853_100487470 3300005539 Bacteria 1163
95 Ga0070672_100096814 3300005543 Bacteria 2388
96 Ga0070672_101314160 3300005543 Bacteria 646
97 Ga0070695_100554988 3300005545 Bacteria 896
98 Ga0070696_100010871 3300005546 Bacteria 6099
99 Ga0070696_100755755 3300005546 Bacteria 797
100 Ga0070693_100651555 3300005547 Bacteria 766
101 Ga0070665_100103326 3300005548 Bacteria 2853
102 Ga0068855_100051245 3300005563 Bacteria 4862
103 Ga0068855_100112878 3300005563 Bacteria 3118
104 Ga0068855_100160049 3300005563 Bacteria 2556
105 Ga0068855_100222778 3300005563 Bacteria 2114
106 Ga0068855_101358668 3300005563 Bacteria 733
107 Ga0070664_100003200 3300005564 Bacteria 13233
108 Ga0070664_100057445 3300005564 Bacteria 3308
109 Ga0070664_100097473 3300005564 Bacteria 2553
110 Ga0070664_101257137 3300005564 Bacteria 699
111 Ga0068857_100029224 3300005577 Bacteria 4864
112 Ga0068857_100045417 3300005577 Bacteria 3897
113 Ga0068857_100376884 3300005577 Bacteria 1317
114 Ga0068854_100174117 3300005578 Bacteria 1676
115 Ga0068854_100245071 3300005578 Bacteria 1429
116 Ga0068854_101047031 3300005578 Bacteria 725
117 Ga0068856_100126204 3300005614 Bacteria 2562
118 Ga0068852_100174649 3300005616 Bacteria 2016
119 Ga0068852_100232787 3300005616 Unclassified 1757
120 Ga0068852_100470091 3300005616 Bacteria 1248
121 Ga0068852_100574325 3300005616 Bacteria 1130
122 Ga0068852_100661668 3300005616 Bacteria 1052
123 Ga0068852_101150744 3300005616 Bacteria 796
124 Ga0068859_100018921 3300005617 Bacteria 6918
125 Ga0068864_101418207 3300005618 Bacteria 696
126 Ga0068866_10016039 3300005718 Bacteria 3341
127 Ga0068866_10106489 3300005718 Unclassified 1556
128 Ga0068861_100002080 3300005719 Bacteria 12972
129 Ga0068851_10058514 3300005834 Bacteria 1970
130 Ga0068851_10060524 3300005834 Bacteria 1939
131 Ga0068851_10170178 3300005834 Bacteria 1202
132 Ga0068851_10183790 3300005834 Bacteria 1159
133 Ga0068851_10632910 3300005834 Bacteria 653
134 Ga0068870_10740202 3300005840 Bacteria 682
135 Ga0068863_100003523 3300005841 Bacteria 15444
136 Ga0068863_100420109 3300005841 Bacteria 1310
137 Ga0068860_100007611 3300005843 Bacteria 10837
138 Ga0068860_102068607 3300005843 Archaea 591
139 Ga0068862_100002084 3300005844 Bacteria 18031
140 Ga0070712_100338337 3300006175 Bacteria 1228
141 Ga0075428_100073164 3300006844 Bacteria 3742
142 Ga0075428_100130248 3300006844 Bacteria 2737
143 Ga0075428_101336353 3300006844 Unclassified 753
144 Ga0075428_101437889 3300006844 Unclassified 723
145 Ga0075430_100048697 3300006846 Bacteria 3578
146 Ga0075431_100444034 3300006847 Bacteria 1294
147 Ga0075431_100986534 3300006847 Unclassified 810
148 Ga0075433_10008084 3300006852 Bacteria 8376
149 Ga0075433_10276188 3300006852 Bacteria 1489
150 Ga0075433_10296436 3300006852 Bacteria 1432
151 Ga0075434_100003899 3300006871 Bacteria 13354
152 Ga0075434_100034123 3300006871 Bacteria 5024
153 Ga0075434_100940307 3300006871 Unclassified 879
154 Ga0068865_100011960 3300006881 Bacteria 5451
155 Ga0075436_100005153 3300006914 Bacteria 8997
156 Ga0097620_100018921 3300006931 Bacteria 6918
157 Ga0075435_100786351 3300007076 Bacteria 828
158 Ga0105240_10009714 3300009093 Bacteria 13584
159 Ga0105240_10023780 3300009093 Bacteria 8094
160 Ga0105240_10140691 3300009093 Bacteria 2886
161 Ga0105240_10238742 3300009093 Bacteria 2108
162 Ga0105240_10492430 3300009093 Bacteria 1365
163 Ga0105240_11138195 3300009093 Bacteria 829
164 Ga0111539_10021367 3300009094 Bacteria 7968
165 Ga0111539_10221217 3300009094 Bacteria 2205
166 Ga0111539_10606790 3300009094 Bacteria 1275
167 Ga0111539_10756514 3300009094 Bacteria 1131
168 Ga0111539_10786251 3300009094 Bacteria 1108
169 Ga0105245_10131270 3300009098 Bacteria 2350
170 Ga0114129_10083027 3300009147 Bacteria 4452
171 Ga0114129_10115199 3300009147 Bacteria 3706
172 Ga0114129_10116576 3300009147 Bacteria 3680
173 Ga0114129_10356276 3300009147 Bacteria 1937
174 Ga0114129_12449063 3300009147 Unclassified 624
175 Ga0105241_10468717 3300009174 Bacteria 1117
176 Ga0105242_10007227 3300009176 Bacteria 8561
177 Ga0105248_10012306 3300009177 Bacteria 9436
178 Ga0105248_10335623 3300009177 Bacteria 1702
179 Ga0105237_10025409 3300009545 Bacteria 6058
180 Ga0105237_10323857 3300009545 Bacteria 1545
181 Ga0105238_10337285 3300009551 Bacteria 1495
182 Ga0105238_11792583 3300009551 Bacteria 646
183 Ga0105249_10000993 3300009553 Bacteria 25145
184 Ga0105239_10009724 3300010375 Bacteria 10809
185 Ga0105239_11288311 3300010375 Bacteria 843
186 Ga0105239_12822809 3300010375 Bacteria 567
187 Ga0157373_10037750 3300013100 Bacteria 3462
188 Ga0157373_10237994 3300013100 Bacteria 1287
189 Ga0157371_10006109 3300013102 Bacteria 10016
190 Ga0157371_10009291 3300013102 Bacteria 7750
191 Ga0157371_10033191 3300013102 Bacteria 3710
192 Ga0157371_10113741 3300013102 Bacteria 1922
193 Ga0157371_10133238 3300013102 Bacteria 1768
194 Ga0157371_11525733 3300013102 Bacteria 522
195 Ga0157370_10035687 3300013104 Bacteria 4830
196 Ga0157370_10052787 3300013104 Bacteria 3880
197 Ga0157370_10067689 3300013104 Bacteria 3375
198 Ga0157370_10317140 3300013104 Unclassified 1438
199 Ga0157370_10341615 3300013104 Bacteria 1380
200 Ga0157369_10002055 3300013105 Bacteria 24275
201 Ga0157369_10042582 3300013105 Bacteria 4952
202 Ga0157369_10055321 3300013105 Bacteria 4284
203 Ga0157369_10079765 3300013105 Bacteria 3505
204 Ga0157369_10140062 3300013105 Bacteria 2560
205 Ga0157369_10638843 3300013105 Bacteria 1098
206 Ga0157369_10974864 3300013105 Bacteria 868
207 Ga0157369_11868184 3300013105 Bacteria 610
208 Ga0157374_10058244 3300013296 Bacteria 3610
209 Ga0157374_10148253 3300013296 Bacteria 2280
210 Ga0163162_10003362 3300013306 Bacteria 15302
211 Ga0157372_10002592 3300013307 Bacteria 19566
212 Ga0157372_10008785 3300013307 Bacteria 10731
213 Ga0157372_10008900 3300013307 Bacteria 10666
214 Ga0157372_10020758 3300013307 Bacteria 7092
215 Ga0157372_10023531 3300013307 Bacteria 6679
216 Ga0157372_10171328 3300013307 Bacteria 2511
217 Ga0157372_10173367 3300013307 Bacteria 2496
218 Ga0157372_10348291 3300013307 Bacteria 1726
219 Ga0157372_10580977 3300013307 Bacteria 1306
220 Ga0157372_11028565 3300013307 Bacteria 954
221 Ga0157372_12315031 3300013307 Unclassified 617
222 Ga0157375_10007152 3300013308 Bacteria 9757
223 Ga0163163_10032559 3300014325 Bacteria 5035
224 Ga0157380_10255928 3300014326 Bacteria 1587
225 Ga0157377_10003354 3300014745 Bacteria 7246
226 Ga0157379_10004274 3300014968 Bacteria 12200
227 Ga0157376_11092877 3300014969 Bacteria 823
228 Ga0182007_10068823 3300015262 Bacteria 1160
229 Ga0163161_10002635 3300017792 Bacteria 12763
230 Ga0206356_10713939 3300020070 Bacteria 2793
231 Ga0206353_11977875 3300020082 Bacteria 997
232 Ga0206353_12066650 3300020082 Bacteria 807
233 Ga0207697_10001863 3300025315 Bacteria 11256
234 Ga0207656_10041522 3300025321 Bacteria 1955
235 Ga0207656_10223307 3300025321 Bacteria 916
236 Ga0207642_10246145 3300025899 Unclassified 1012
237 Ga0207688_10044403 3300025901 Bacteria 2477
238 Ga0207680_10238664 3300025903 Bacteria 1252
239 Ga0207647_10029530 3300025904 Bacteria 3547
240 Ga0207685_10381642 3300025905 Bacteria 718
241 Ga0207645_10000455 3300025907 Bacteria 33910
242 Ga0207705_10000925 3300025909 Bacteria 24001
243 Ga0207705_10073032 3300025909 Bacteria 2489
244 Ga0207705_10160123 3300025909 Bacteria 1691
245 Ga0207705_10200953 3300025909 Bacteria 1510
246 Ga0207705_10572188 3300025909 Bacteria 878
247 Ga0207705_10591051 3300025909 Bacteria 863
248 Ga0207654_10206109 3300025911 Bacteria 1297
249 Ga0207707_10012044 3300025912 Bacteria 7521
250 Ga0207707_10294513 3300025912 Bacteria 1404
251 Ga0207707_10310607 3300025912 Bacteria 1362
252 Ga0207707_10475337 3300025912 Bacteria 1068
253 Ga0207707_10527312 3300025912 Bacteria 1005
254 Ga0207695_10001616 3300025913 Bacteria 36557
255 Ga0207695_10003988 3300025913 Bacteria 20370
256 Ga0207695_10047434 3300025913 Bacteria 4547
257 Ga0207695_10107779 3300025913 Bacteria 2771
258 Ga0207695_10492148 3300025913 Bacteria 1108
259 Ga0207671_10079104 3300025914 Bacteria 2463
260 Ga0207671_10521136 3300025914 Unclassified 948
261 Ga0207693_10472243 3300025915 Bacteria 980
262 Ga0207660_10036708 3300025917 Bacteria 3408
263 Ga0207660_10334608 3300025917 Bacteria 1211
264 Ga0207660_10449246 3300025917 Bacteria 1042
265 Ga0207662_10017497 3300025918 Bacteria 4057
266 Ga0207657_10000432 3300025919 Bacteria 44554
267 Ga0207657_10031567 3300025919 Bacteria 4797
268 Ga0207657_10050433 3300025919 Bacteria 3623
269 Ga0207657_10154501 3300025919 Bacteria 1867
270 Ga0207649_10009208 3300025920 Bacteria 5399
271 Ga0207649_10033758 3300025920 Bacteria 3060
272 Ga0207649_10063864 3300025920 Bacteria 2326
273 Ga0207649_10072894 3300025920 Bacteria 2198
274 Ga0207649_10165602 3300025920 Bacteria 1535
275 Ga0207649_10293400 3300025920 Bacteria 1186
276 Ga0207652_10121134 3300025921 Bacteria 2327
277 Ga0207652_10124375 3300025921 Unclassified 2297
278 Ga0207652_11154322 3300025921 Unclassified 676
279 Ga0207681_10027149 3300025923 Bacteria 3699
280 Ga0207694_10299682 3300025924 Unclassified 1323
281 Ga0207650_10013534 3300025925 Bacteria 5650
282 Ga0207650_10086809 3300025925 Bacteria 2382
283 Ga0207650_10616083 3300025925 Bacteria 913
284 Ga0207659_10010696 3300025926 Bacteria 5770
285 Ga0207664_10066342 3300025929 Bacteria 2893
286 Ga0207664_10543278 3300025929 Bacteria 1042
287 Ga0207664_10721553 3300025929 Bacteria 896
288 Ga0207644_10104626 3300025931 Archaea 2131
289 Ga0207690_10023185 3300025932 Bacteria 3872
290 Ga0207690_10025433 3300025932 Bacteria 3717
291 Ga0207690_10252676 3300025932 Bacteria 1362
292 Ga0207690_11049958 3300025932 Bacteria 678
293 Ga0207706_10000217 3300025933 Bacteria 63442
294 Ga0207686_10074625 3300025934 Bacteria 2192
295 Ga0207670_10078613 3300025936 Bacteria 2301
296 Ga0207669_10160102 3300025937 Bacteria 1589
297 Ga0207669_10747320 3300025937 Bacteria 807
298 Ga0207691_10000474 3300025940 Bacteria 39819
299 Ga0207691_11089225 3300025940 Bacteria 665
300 Ga0207691_11096693 3300025940 Bacteria 662
301 Ga0207711_10118585 3300025941 Bacteria 2361
302 Ga0207689_10024756 3300025942 Bacteria 5032
303 Ga0207661_10040018 3300025944 Bacteria 3683
304 Ga0207661_10234146 3300025944 Bacteria 1627
305 Ga0207661_10344273 3300025944 Unclassified 1344
306 Ga0207679_10004026 3300025945 Bacteria 9125
307 Ga0207679_10035929 3300025945 Bacteria 3510
308 Ga0207679_10065024 3300025945 Bacteria 2728
309 Ga0207667_10049422 3300025949 Bacteria 4441
310 Ga0207667_10072398 3300025949 Bacteria 3582
311 Ga0207667_10143833 3300025949 Archaea 2455
312 Ga0207667_10373862 3300025949 Bacteria 1452
313 Ga0207667_10580606 3300025949 Bacteria 1132
314 Ga0207667_10884666 3300025949 Unclassified 886
315 Ga0207712_10000761 3300025961 Bacteria 24208
316 Ga0207640_10029290 3300025981 Bacteria 3378
317 Ga0207640_10049414 3300025981 Bacteria 2723
318 Ga0207640_10291462 3300025981 Bacteria 1287
319 Ga0207640_10502875 3300025981 Bacteria 1010
320 Ga0207658_10065799 3300025986 Bacteria 2724
321 Ga0207677_10021012 3300026023 Bacteria 3980
322 Ga0207703_10070512 3300026035 Bacteria 2884
323 Ga0207639_10084902 3300026041 Bacteria 2516
324 Ga0207639_10385865 3300026041 Bacteria 1259
325 Ga0207639_10446309 3300026041 Bacteria 1174
326 Ga0207639_10717162 3300026041 Unclassified 928
327 Ga0207678_10000338 3300026067 Bacteria 42189
328 Ga0207678_10183098 3300026067 Bacteria 1789
329 Ga0207678_11818726 3300026067 Bacteria 533
330 Ga0207708_10004799 3300026075 Bacteria 9958
331 Ga0207702_10295555 3300026078 Bacteria 1536
332 Ga0207641_10002186 3300026088 Bacteria 18404
333 Ga0207641_11165520 3300026088 Bacteria 770
334 Ga0207648_10003278 3300026089 Bacteria 17025
335 Ga0207674_10001464 3300026116 Bacteria 30508
336 Ga0207674_10005418 3300026116 Bacteria 15165
337 Ga0207674_10633753 3300026116 Bacteria 1032
338 Ga0207675_100000102 3300026118 Bacteria 67767
339 Ga0207698_10085526 3300026142 Bacteria 2561
340 Ga0207698_10207105 3300026142 Bacteria 1761
341 Ga0207698_10413038 3300026142 Bacteria 1293
342 Ga0207698_10574211 3300026142 Bacteria 1108
343 Ga0207698_11912440 3300026142 Unclassified 608
344 Ga0207428_10014068 3300027907 Bacteria 6969
345 Ga0207428_10262416 3300027907 Bacteria 1286
346 Ga0207428_10458224 3300027907 Bacteria 929
347 Ga0268266_10185846 3300028379 Bacteria 1895
348 Ga0268265_10006287 3300028380 Bacteria 8041
349 Ga0268264_10024519 3300028381 Bacteria 4925
350 Ga0307408_100003716 3300031548 Bacteria 10395
351 Ga0307408_100052037 3300031548 Bacteria 2953
352 Ga0307408_100220093 3300031548 Bacteria 1548
353 Ga0307408_100255495 3300031548 Bacteria 1447
354 Ga0307408_100289170 3300031548 Bacteria 1368
355 Ga0307405_10001397 3300031731 Bacteria 10146
356 Ga0307405_10120666 3300031731 Bacteria 1793
357 Ga0307405_10127335 3300031731 Bacteria 1753
358 Ga0307413_10000351 3300031824 Bacteria 14645
359 Ga0307413_10001284 3300031824 Bacteria 9358
360 Ga0307413_10057193 3300031824 Bacteria 2383
361 Ga0307413_10087414 3300031824 Bacteria 2019
362 Ga0307413_10728133 3300031824 Bacteria 827
363 Ga0307410_10003392 3300031852 Bacteria 7986
364 Ga0307410_10016319 3300031852 Bacteria 4426
365 Ga0307410_10435518 3300031852 Bacteria 1066
366 Ga0307410_10633444 3300031852 Bacteria 895
367 Ga0307410_11038354 3300031852 Bacteria 708
368 Ga0307410_11193918 3300031852 Bacteria 662
369 Ga0307406_10002791 3300031901 Bacteria 9533
370 Ga0307406_10004928 3300031901 Bacteria 7274
371 Ga0307406_10005676 3300031901 Bacteria 6826
372 Ga0307406_11407137 3300031901 Bacteria 611
373 Ga0307407_10001030 3300031903 Bacteria 9621
374 Ga0307407_10003415 3300031903 Bacteria 6505
375 Ga0307407_10048414 3300031903 Bacteria 2419
376 Ga0307407_10052808 3300031903 Bacteria 2336
377 Ga0307412_10001978 3300031911 Bacteria 11353
378 Ga0307412_10074489 3300031911 Bacteria 2326
379 Ga0307412_10201340 3300031911 Bacteria 1512
380 Ga0307409_100000948 3300031995 Bacteria 13507
381 Ga0307409_100009795 3300031995 Bacteria 5909
382 Ga0307409_100212238 3300031995 Bacteria 1740
383 Ga0307409_100562270 3300031995 Bacteria 1121
384 Ga0307416_100003006 3300032002 Bacteria 9843
385 Ga0307416_100007108 3300032002 Bacteria 7077
386 Ga0307416_100249091 3300032002 Bacteria 1727
387 Ga0307416_100471242 3300032002 Bacteria 1313
388 Ga0307416_100485864 3300032002 Archaea 1296
389 Ga0307416_100922085 3300032002 Bacteria 974
390 Ga0307416_100967233 3300032002 Unclassified 954
391 Ga0307416_101079442 3300032002 Bacteria 907
392 Ga0307416_101347303 3300032002 Bacteria 819
393 Ga0307416_101755283 3300032002 Bacteria 725
394 Ga0307414_10003029 3300032004 Bacteria 8908
395 Ga0307414_10034044 3300032004 Bacteria 3373
396 Ga0307414_10156361 3300032004 Bacteria 1805
397 Ga0307414_10918115 3300032004 Bacteria 803
398 Ga0307411_10000351 3300032005 Bacteria 15517
399 Ga0307411_10005597 3300032005 Bacteria 6191
400 Ga0307411_10346432 3300032005 Bacteria 1209
401 Ga0307411_11290992 3300032005 Bacteria 665
402 Ga0307415_100004690 3300032126 Bacteria 7148
403 Ga0307415_100017030 3300032126 Bacteria 4349
404 Ga0307415_100057430 3300032126 Bacteria 2674
405 Ga0307415_100057892 3300032126 Bacteria 2666
406 Ga0307415_100740733 3300032126 Bacteria 891
407 Ga0373944_0048194 3300035089 Archaea 1337
408 Ga0373941_0058202 3300035115 Bacteria 1250
409 Ga0373943_0159773 3300035170 Bacteria 1226
410 Ga0373946_0429878 3300035171 Unclassified 670
411 Ga0373947_0101817 3300035725 Bacteria 1806
412 Ga0373937_0254262 3300036401 Bacteria 1656
413 Ga0395905_0577053 3300037471 Bacteria 1026
414 Ga0439455_0056686 3300042012 Bacteria 1032
415 Ga0439446_0147908 3300042156 Bacteria 771
416 Ga0451577_0008887 3300042876 Bacteria 9724
417 Ga0451577_0190279 3300042876 Bacteria 1851
418 Ga0466966_0010219 3300044684 Bacteria 6226
419 Ga0466966_0096901 3300044684 Bacteria 1827
420 Ga0466961_0030231 3300044693 Bacteria 3481
421 Ga0466961_0359064 3300044693 Bacteria 886
422 Ga0453684_0000886 3300044712 Bacteria 100081
423 Ga0466957_0264792 3300044842 Archaea 1146
424 Ga0466957_0690285 3300044842 Bacteria 720
425 Ga0451576_0190422 3300045051 Bacteria 2142
426 Ga0466958_0402505 3300045836 Bacteria 884
427 Ga0466958_0827043 3300045836 Bacteria 604
428 Ga0466967_1044867 3300045976 Bacteria 814
429 Ga0495582_0487275 3300046473 Bacteria 713
430 Ga0495652_0185890 3300046529 Unclassified 1590
431 Ga0495665_0350754 3300046531 Bacteria 752
432 Ga0495640_0182810 3300046533 Bacteria 1335
433 Ga0495667_0047312 3300046559 Bacteria 2842
434 Ga0495659_0083229 3300046664 Bacteria 1218
435 Ga0495657_0315980 3300046675 Bacteria 929
436 Ga0495680_0154815 3300047322 Bacteria 1668
437 Ga0495684_0051832 3300047471 Bacteria 3131
438 Ga0496109_0722909 3300048912 Bacteria 933
439 Ga0496109_1272050 3300048912 Bacteria 672
440 Ga0501034_1021272 3300049571 Unclassified 710
441 Ga0501038_0018136 3300049574 Bacteria 6358
442 Ga0501039_0127432 3300049575 Bacteria 1997
443 Ga0501040_0002638 3300049576 Bacteria 11568
444 Ga0501040_0673599 3300049576 Unclassified 748
445 Ga0501041_0597391 3300049577 Bacteria 704
446 Ga0501047_0699983 3300049581 Bacteria 831
447 Ga0501048_0047619 3300049582 Bacteria 3059
448 Ga0501072_0537768 3300049588 Bacteria 923
449 Ga0501073_0582919 3300049589 Unclassified 773
450 Ga0501075_0095704 3300049591 Bacteria 2253
451 Ga0501249_048688 3300049679 Bacteria 971
452 Ga0501079_0111360 3300049741 Bacteria 2127
453 Ga0501079_0528029 3300049741 Bacteria 928
454 Ga0501080_1106545 3300049742 Bacteria 684
455 Ga0501080_1330232 3300049742 Unclassified 615
456 Ga0501083_0772093 3300049744 Bacteria 625
457 Ga0501045_0007278 3300049824 Bacteria 7687
458 nmdc:mga05p37_92672_c1 3300050507 Bacteria 3723
459 nmdc:mga09592_251443_c1 3300050508 Bacteria 1532
460 nmdc:mga06r32_494330_c1 3300050510 Bacteria 1201
461 nmdc:mga06r32_990673_c1 3300050510 Unclassified 793
462 nmdc:mga08y16_108773_c1 3300050511 Bacteria 2886
463 nmdc:mga08y16_20519_c1 3300050511 Bacteria 6974
464 nmdc:mga08y16_60470_c1 3300050511 Bacteria 3956
465 nmdc:mga08y16_633579_c1 3300050511 Bacteria 1075
466 nmdc:mga0n895_16749_c1 3300050512 Bacteria 6735
467 nmdc:mga0n895_2188580_c1 3300050512 Unclassified 508
468 nmdc:mga0n895_87270_c1 3300050512 Bacteria 3117
469 nmdc:mga0rr50_758991_c1 3300050513 Bacteria 828
470 nmdc:mga08x19_1061_c1 3300050514 Bacteria 17188
471 nmdc:mga08x19_202219_c1 3300050514 Bacteria 1362
472 nmdc:mga0a205_121778_c1 3300050515 Bacteria 2508
473 nmdc:mga0a205_2374_c1 3300050515 Bacteria 16601
474 nmdc:mga0a205_254148_c1 3300050515 Bacteria 1636
475 Ga0501084_0301623 3300054114 Unclassified 1353
476 Ga0501084_0444402 3300054114 Bacteria 1096
477 Ga0501084_0839790 3300054114 Bacteria 773
478 Ga0530510_0189933 3300061734 Bacteria 1525
479 Ga0307409_101179126
480 Ga0065715_10154132
481 Ga0065707_10085069
482 Ga0070658_10006065
483 Ga0070658_10077288
484 Ga0070658_10150642
485 Ga0070658_10212973
486 Ga0070658_10403134
487 Ga0070683_100026639
488 Ga0070683_100060837
489 Ga0070683_100117749
490 Ga0070683_100186795
491 Ga0070690_100212610
492 Ga0070670_100017277
493 Ga0070670_100190622
494 Ga0070670_100814934
495 Ga0068869_100001089
496 Ga0070666_10254885
497 Ga0070680_100018586
498 Ga0070680_100055756
499 Ga0070682_100142403
500 Ga0070682_100564404
501 Ga0068868_100042815
502 Ga0070660_100005894
503 Ga0070660_100041127
504 Ga0070660_100055577
505 Ga0070660_100086616
506 Ga0070660_100246441
507 Ga0070660_100390310
508 Ga0070660_100721012
509 Ga0070660_101335115
510 Ga0070689_100001085
511 Ga0070689_100304296
512 Ga0070691_10017175
513 Ga0070691_10115992
514 Ga0070691_10326147
515 Ga0070687_100086679
516 Ga0070687_100185955
517 Ga0070661_100013207
518 Ga0070661_100013882
519 Ga0070661_100022773
520 Ga0070661_100060226
521 Ga0070661_100126557
522 Ga0070661_100160273
523 Ga0070661_100418501
524 Ga0070692_10015881
525 Ga0070668_100001891
526 Ga0070669_100000657
527 Ga0070675_100004160
528 Ga0070675_100685074
529 Ga0070674_100088771
530 Ga0070673_100186017
531 Ga0070688_100029698
532 Ga0070659_100016388
533 Ga0070659_100019413
534 Ga0070659_101104412
535 Ga0070667_100006856
536 Ga0070714_100255827
537 Ga0070701_10014459
538 Ga0070700_100025724
539 Ga0070694_100009972
540 Ga0070663_100004367
541 Ga0070663_100203312
542 Ga0070663_101570601
543 Ga0070662_100000394
544 Ga0070681_10008311
545 Ga0070681_10088558
546 Ga0070681_10450101
547 Ga0068867_100015743
548 Ga0070685_10142005
549 Ga0070685_10697764
550 Ga0070707_100105038
551 Ga0070707_100771588
552 Ga0070698_100108021
553 Ga0070698_100296895
554 Ga0070698_100501357
555 Ga0070699_100031397
556 Ga0070699_100310623
557 Ga0070679_100061151
558 Ga0070679_100149323
559 Ga0070679_100168097
560 Ga0070679_100266123
561 Ga0070679_100317630
562 Ga0070679_100488834
563 Ga0070684_100057028
564 Ga0070684_100078374
565 Ga0070684_100103116
566 Ga0070684_100161365
567 Ga0070684_100273730
568 Ga0070684_101096872
569 Ga0068853_100011969
570 Ga0068853_100050948
571 Ga0068853_100209559
572 Ga0068853_100487470
573 Ga0070672_100096814
574 Ga0070672_101314160
575 Ga0070695_100554988
576 Ga0070696_100010871
577 Ga0070696_100755755
578 Ga0070693_100651555
579 Ga0070665_100103326
580 Ga0068855_100051245
581 Ga0068855_100112878
582 Ga0068855_100160049
583 Ga0068855_100222778
584 Ga0068855_101358668
585 Ga0070664_100003200
586 Ga0070664_100057445
587 Ga0070664_100097473
588 Ga0070664_101257137
589 Ga0068857_100029224
590 Ga0068857_100045417
591 Ga0068857_100376884
592 Ga0068854_100174117
593 Ga0068854_100245071
594 Ga0068854_101047031
595 Ga0068856_100126204
596 Ga0068852_100174649
597 Ga0068852_100232787
598 Ga0068852_100470091
599 Ga0068852_100574325
600 Ga0068852_100661668
601 Ga0068852_101150744
602 Ga0068859_100018921
603 Ga0068864_101418207
604 Ga0068866_10016039
605 Ga0068866_10106489
606 Ga0068861_100002080
607 Ga0068851_10058514
608 Ga0068851_10060524
609 Ga0068851_10170178
610 Ga0068851_10183790
611 Ga0068851_10632910
612 Ga0068870_10740202
613 Ga0068863_100003523
614 Ga0068863_100420109
615 Ga0068860_100007611
616 Ga0068860_102068607
617 Ga0068862_100002084
618 Ga0070712_100338337
619 Ga0075428_100073164
620 Ga0075428_100130248
621 Ga0075428_101336353
622 Ga0075428_101437889
623 Ga0075430_100048697
624 Ga0075431_100444034
625 Ga0075431_100986534
626 Ga0075433_10008084
627 Ga0075433_10276188
628 Ga0075433_10296436
629 Ga0075434_100003899
630 Ga0075434_100034123
631 Ga0075434_100940307
632 Ga0068865_100011960
633 Ga0075436_100005153
634 Ga0097620_100018921
635 Ga0075435_100786351
636 Ga0105240_10009714
637 Ga0105240_10023780
638 Ga0105240_10140691
639 Ga0105240_10238742
640 Ga0105240_10492430
641 Ga0105240_11138195
642 Ga0111539_10021367
643 Ga0111539_10221217
644 Ga0111539_10606790
645 Ga0111539_10756514
646 Ga0111539_10786251
647 Ga0105245_10131270
648 Ga0114129_10083027
649 Ga0114129_10115199
650 Ga0114129_10116576
651 Ga0114129_10356276
652 Ga0114129_12449063
653 Ga0105241_10468717
654 Ga0105242_10007227
655 Ga0105248_10012306
656 Ga0105248_10335623
657 Ga0105237_10025409
658 Ga0105237_10323857
659 Ga0105238_10337285
660 Ga0105238_11792583
661 Ga0105249_10000993
662 Ga0105239_10009724
663 Ga0105239_11288311
664 Ga0105239_12822809
665 Ga0157373_10037750
666 Ga0157373_10237994
667 Ga0157371_10006109
668 Ga0157371_10009291
669 Ga0157371_10033191
670 Ga0157371_10113741
671 Ga0157371_10133238
672 Ga0157371_11525733
673 Ga0157370_10035687
674 Ga0157370_10052787
675 Ga0157370_10067689
676 Ga0157370_10317140
677 Ga0157370_10341615
678 Ga0157369_10002055
679 Ga0157369_10042582
680 Ga0157369_10055321
681 Ga0157369_10079765
682 Ga0157369_10140062
683 Ga0157369_10638843
684 Ga0157369_10974864
685 Ga0157369_11868184
686 Ga0157374_10058244
687 Ga0157374_10148253
688 Ga0163162_10003362
689 Ga0157372_10002592
690 Ga0157372_10008785
691 Ga0157372_10008900
692 Ga0157372_10020758
693 Ga0157372_10023531
694 Ga0157372_10171328
695 Ga0157372_10173367
696 Ga0157372_10348291
697 Ga0157372_10580977
698 Ga0157372_11028565
699 Ga0157372_12315031
700 Ga0157375_10007152
701 Ga0163163_10032559
702 Ga0157380_10255928
703 Ga0157377_10003354
704 Ga0157379_10004274
705 Ga0157376_11092877
706 Ga0182007_10068823
707 Ga0163161_10002635
708 Ga0206356_10713939
709 Ga0206353_11977875
710 Ga0206353_12066650
711 Ga0207697_10001863
712 Ga0207656_10041522
713 Ga0207656_10223307
714 Ga0207642_10246145
715 Ga0207688_10044403
716 Ga0207680_10238664
717 Ga0207647_10029530
718 Ga0207685_10381642
719 Ga0207645_10000455
720 Ga0207705_10000925
721 Ga0207705_10073032
722 Ga0207705_10160123
723 Ga0207705_10200953
724 Ga0207705_10572188
725 Ga0207705_10591051
726 Ga0207654_10206109
727 Ga0207707_10012044
728 Ga0207707_10294513
729 Ga0207707_10310607
730 Ga0207707_10475337
731 Ga0207707_10527312
732 Ga0207695_10001616
733 Ga0207695_10003988
734 Ga0207695_10047434
735 Ga0207695_10107779
736 Ga0207695_10492148
737 Ga0207671_10079104
738 Ga0207671_10521136
739 Ga0207693_10472243
740 Ga0207660_10036708
741 Ga0207660_10334608
742 Ga0207660_10449246
743 Ga0207662_10017497
744 Ga0207657_10000432
745 Ga0207657_10031567
746 Ga0207657_10050433
747 Ga0207657_10154501
748 Ga0207649_10009208
749 Ga0207649_10033758
750 Ga0207649_10063864
751 Ga0207649_10072894
752 Ga0207649_10165602
753 Ga0207649_10293400
754 Ga0207652_10121134
755 Ga0207652_10124375
756 Ga0207652_11154322
757 Ga0207681_10027149
758 Ga0207694_10299682
759 Ga0207650_10013534
760 Ga0207650_10086809
761 Ga0207650_10616083
762 Ga0207659_10010696
763 Ga0207664_10066342
764 Ga0207664_10543278
765 Ga0207664_10721553
766 Ga0207644_10104626
767 Ga0207690_10023185
768 Ga0207690_10025433
769 Ga0207690_10252676
770 Ga0207690_11049958
771 Ga0207706_10000217
772 Ga0207686_10074625
773 Ga0207670_10078613
774 Ga0207669_10160102
775 Ga0207669_10747320
776 Ga0207691_10000474
777 Ga0207691_11089225
778 Ga0207691_11096693
779 Ga0207711_10118585
780 Ga0207689_10024756
781 Ga0207661_10040018
782 Ga0207661_10234146
783 Ga0207661_10344273
784 Ga0207679_10004026
785 Ga0207679_10035929
786 Ga0207679_10065024
787 Ga0207667_10049422
788 Ga0207667_10072398
789 Ga0207667_10143833
790 Ga0207667_10373862
791 Ga0207667_10580606
792 Ga0207667_10884666
793 Ga0207712_10000761
794 Ga0207640_10029290
795 Ga0207640_10049414
796 Ga0207640_10291462
797 Ga0207640_10502875
798 Ga0207658_10065799
799 Ga0207677_10021012
800 Ga0207703_10070512
801 Ga0207639_10084902
802 Ga0207639_10385865
803 Ga0207639_10446309
804 Ga0207639_10717162
805 Ga0207678_10000338
806 Ga0207678_10183098
807 Ga0207678_11818726
808 Ga0207708_10004799
809 Ga0207702_10295555
810 Ga0207641_10002186
811 Ga0207641_11165520
812 Ga0207648_10003278
813 Ga0207674_10001464
814 Ga0207674_10005418
815 Ga0207674_10633753
816 Ga0207675_100000102
817 Ga0207698_10085526
818 Ga0207698_10207105
819 Ga0207698_10413038
820 Ga0207698_10574211
821 Ga0207698_11912440
822 Ga0207428_10014068
823 Ga0207428_10262416
824 Ga0207428_10458224
825 Ga0268266_10185846
826 Ga0268265_10006287
827 Ga0268264_10024519
828 Ga0307408_100003716
829 Ga0307408_100052037
830 Ga0307408_100220093
831 Ga0307408_100255495
832 Ga0307408_100289170
833 Ga0307405_10001397
834 Ga0307405_10120666
835 Ga0307405_10127335
836 Ga0307413_10000351
837 Ga0307413_10001284
838 Ga0307413_10057193
839 Ga0307413_10087414
840 Ga0307413_10728133
841 Ga0307410_10003392
842 Ga0307410_10016319
843 Ga0307410_10435518
844 Ga0307410_10633444
845 Ga0307410_11038354
846 Ga0307410_11193918
847 Ga0307406_10002791
848 Ga0307406_10004928
849 Ga0307406_10005676
850 Ga0307406_11407137
851 Ga0307407_10001030
852 Ga0307407_10003415
853 Ga0307407_10048414
854 Ga0307407_10052808
855 Ga0307412_10001978
856 Ga0307412_10074489
857 Ga0307412_10201340
858 Ga0307409_100000948
859 Ga0307409_100009795
860 Ga0307409_100212238
861 Ga0307409_100562270
862 Ga0307416_100003006
863 Ga0307416_100007108
864 Ga0307416_100249091
865 Ga0307416_100471242
866 Ga0307416_100485864
867 Ga0307416_100922085
868 Ga0307416_100967233
869 Ga0307416_101079442
870 Ga0307416_101347303
871 Ga0307416_101755283
872 Ga0307414_10003029
873 Ga0307414_10034044
874 Ga0307414_10156361
875 Ga0307414_10918115
876 Ga0307411_10000351
877 Ga0307411_10005597
878 Ga0307411_10346432
879 Ga0307411_11290992
880 Ga0307415_100004690
881 Ga0307415_100017030
882 Ga0307415_100057430
883 Ga0307415_100057892
884 Ga0307415_100740733
885 Ga0373944_0048194
886 Ga0373941_0058202
887 Ga0373943_0159773
888 Ga0373946_0429878
889 Ga0373947_0101817
890 Ga0373937_0254262
891 Ga0395905_0577053
892 Ga0439455_0056686
893 Ga0439446_0147908
894 Ga0451577_0008887
895 Ga0451577_0190279
896 Ga0466966_0010219
897 Ga0466966_0096901
898 Ga0466961_0030231
899 Ga0466961_0359064
900 Ga0453684_0000886
901 Ga0466957_0264792
902 Ga0466957_0690285
903 Ga0451576_0190422
904 Ga0466958_0402505
905 Ga0466958_0827043
906 Ga0466967_1044867
907 Ga0495582_0487275
908 Ga0495652_0185890
909 Ga0495665_0350754
910 Ga0495640_0182810
911 Ga0495667_0047312
912 Ga0495659_0083229
913 Ga0495657_0315980
914 Ga0495680_0154815
915 Ga0495684_0051832
916 Ga0496109_0722909
917 Ga0496109_1272050
918 Ga0501034_1021272
919 Ga0501038_0018136
920 Ga0501039_0127432
921 Ga0501040_0002638
922 Ga0501040_0673599
923 Ga0501041_0597391
924 Ga0501047_0699983
925 Ga0501048_0047619
926 Ga0501072_0537768
927 Ga0501073_0582919
928 Ga0501075_0095704
929 Ga0501249_048688
930 Ga0501079_0111360
931 Ga0501079_0528029
932 Ga0501080_1106545
933 Ga0501080_1330232
934 Ga0501083_0772093
935 Ga0501045_0007278
936 nmdc:mga05p37_92672_c1
937 nmdc:mga09592_251443_c1
938 nmdc:mga06r32_494330_c1
939 nmdc:mga06r32_990673_c1
940 nmdc:mga08y16_108773_c1
941 nmdc:mga08y16_20519_c1
942 nmdc:mga08y16_60470_c1
943 nmdc:mga08y16_633579_c1
944 nmdc:mga0n895_16749_c1
945 nmdc:mga0n895_2188580_c1
946 nmdc:mga0n895_87270_c1
947 nmdc:mga0rr50_758991_c1
948 nmdc:mga08x19_1061_c1
949 nmdc:mga08x19_202219_c1
950 nmdc:mga0a205_121778_c1
951 nmdc:mga0a205_2374_c1
952 nmdc:mga0a205_254148_c1
953 Ga0501084_0301623
954 Ga0501084_0444402
955 Ga0501084_0839790
956 Ga0530510_0189933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02590

SPOUT_MTase

Predicted SPOUT methyltransferase

16

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1to0-assembly3.cif.gz_E x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.939 1 147
5twj-assembly2.cif.gz_A crystal structure of rlmh in complex with s-adenosylmethionine 0.9386 2 152
1vh0-assembly1.cif.gz_A crystal structure of a hypothetical protein 0.9368 1 151
1to0-assembly3.cif.gz_E x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9325 1 147
1ns5-assembly1.cif.gz_A x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 0.9315 1 152
ID Description Score Start End Superfamily
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9161 2 148 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9143 1 153 3.40.1280.10
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9098 2 148 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9087 1 153 3.40.1280.10
1o6dA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9085 1 149 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A3D4YSB2-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9831 1 153 GO:0005737
GO:0070038
AF-A0A3D4YSB2-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9767 1 153 GO:0005737
GO:0070038
AF-A0A2V7QW46-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.9752 66 153 GO:0006364
GO:0008168
GO:0032259
AF-A0A2E8QV83-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9706 1 153 GO:0005737
GO:0070038
AF-A0A257SF91-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.9706 31 153 GO:0006364
GO:0008168
GO:0032259

Map