F451887

General Info

Members Datasets Scaffolds Average Seq Length
478 237 957 272

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10300521|Ga0207652_103005213
Length 310
Sequence VLPLESVPNFSEGRDRATIDAIGDALAAHARLLDVHSDADHNRSVYTLVGTEDELRDSLVAGVAVAAERIDLREHDGAHPCIGAADVVPIVXLRPEDLERAIGARIGELGLPVFLYAPPERGPAFYRRGGRAELARRLAAGELAPDFGPPELHATAGGVILGARSPLIAFNVNLRGSLSVAREVAAVVRERGGGFPGVRALGLDLPRAGLVQVSMNVEDWEAAALHDIVDRIAAEAEILRIDGFDASVVRRIRRNRGVLTHWNIPPGPRRAADGLSRRPRPGVAARQGGAGDDRRPAGVRRPALVGSSAV

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.34
Rhizosphere 86.4
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10300521 3300025921 Bacteria 1449
2 rootH1_10043484 3300003316 Bacteria 2499
3 rootH1_10043484 3300003323 Bacteria 2346
4 Ga0070658_10091016 3300005327 Bacteria 2514
5 Ga0070683_100004054 3300005329 Bacteria 12003
6 Ga0070683_100008394 3300005329 Bacteria 8770
7 Ga0070683_100047696 3300005329 Bacteria 3959
8 Ga0070683_100056548 3300005329 Bacteria 3643
9 Ga0070680_100003464 3300005336 Bacteria 11780
10 Ga0070680_100040903 3300005336 Bacteria 3757
11 Ga0070680_100053171 3300005336 Bacteria 3305
12 Ga0070680_100186424 3300005336 Bacteria 1748
13 Ga0070682_100010240 3300005337 Bacteria 5318
14 Ga0068868_100056790 3300005338 Bacteria 3092
15 Ga0070660_100001630 3300005339 Bacteria 15429
16 Ga0070660_100038617 3300005339 Bacteria 3625
17 Ga0070660_100078944 3300005339 Bacteria 2581
18 Ga0070691_10034941 3300005341 Unclassified 2367
19 Ga0070691_10051488 3300005341 Bacteria 1966
20 Ga0070661_100003593 3300005344 Bacteria 10680
21 Ga0070668_100169060 3300005347 Bacteria 1779
22 Ga0070668_100405456 3300005347 Bacteria 1165
23 Ga0070659_100005908 3300005366 Bacteria 8819
24 Ga0070713_100144958 3300005436 Bacteria 2107
25 Ga0070711_100037184 3300005439 Bacteria 3265
26 Ga0070705_100046697 3300005440 Archaea 2498
27 Ga0070700_100105324 3300005441 Unclassified 1865
28 Ga0070700_100300443 3300005441 Bacteria 1172
29 Ga0070694_100046854 3300005444 Bacteria 2904
30 Ga0070708_100037016 3300005445 Bacteria 4255
31 Ga0070678_100040382 3300005456 Bacteria 3301
32 Ga0070681_10003387 3300005458 Bacteria 14915
33 Ga0070681_10005097 3300005458 Bacteria 12677
34 Ga0070681_10007940 3300005458 Bacteria 10385
35 Ga0070681_10021735 3300005458 Bacteria 6433
36 Ga0070681_10043807 3300005458 Bacteria 4480
37 Ga0070681_10055265 3300005458 Bacteria 3953
38 Ga0070681_10131737 3300005458 Bacteria 2432
39 Ga0070706_100359438 3300005467 Unclassified 1357
40 Ga0070707_100032332 3300005468 Bacteria 4984
41 Ga0070707_100317230 3300005468 Bacteria 1515
42 Ga0070698_100221310 3300005471 Unclassified 1826
43 Ga0070679_100005688 3300005530 Bacteria 11562
44 Ga0070679_100009583 3300005530 Bacteria 9158
45 Ga0070679_100011265 3300005530 Bacteria 8523
46 Ga0070679_100014307 3300005530 Bacteria 7620
47 Ga0070679_100093746 3300005530 Unclassified 2990
48 Ga0070679_100421904 3300005530 Unclassified 1279
49 Ga0070679_100520698 3300005530 Bacteria 1133
50 Ga0070684_100035017 3300005535 Bacteria 4295
51 Ga0070684_100044222 3300005535 Bacteria 3851
52 Ga0070684_100081149 3300005535 Unclassified 2869
53 Ga0070684_100085923 3300005535 Bacteria 2791
54 Ga0070684_100182632 3300005535 Unclassified 1908
55 Ga0068853_100099600 3300005539 Unclassified 2568
56 Ga0068853_100406161 3300005539 Unclassified 1275
57 Ga0070672_100127745 3300005543 Bacteria 2087
58 Ga0070686_100046705 3300005544 Bacteria 2734
59 Ga0070695_100281756 3300005545 Bacteria 1221
60 Ga0070696_100021130 3300005546 Bacteria 4413
61 Ga0070693_100003969 3300005547 Bacteria 6946
62 Ga0070693_100020165 3300005547 Bacteria 3511
63 Ga0070693_100099869 3300005547 Bacteria 1766
64 Ga0070665_100052036 3300005548 Bacteria 4108
65 Ga0070665_100124859 3300005548 Bacteria 2576
66 Ga0070704_100048227 3300005549 Archaea 2980
67 Ga0070704_100333408 3300005549 Bacteria 1275
68 Ga0068855_100094824 3300005563 Bacteria 3440
69 Ga0068855_100136980 3300005563 Unclassified 2792
70 Ga0070664_100593378 3300005564 Bacteria 1027
71 Ga0068857_100022009 3300005577 Bacteria 5611
72 Ga0068857_100024503 3300005577 Bacteria 5313
73 Ga0068857_100271253 3300005577 Unclassified 1559
74 Ga0068856_100006533 3300005614 Bacteria 11429
75 Ga0068856_100097222 3300005614 Bacteria 2933
76 Ga0068856_100287274 3300005614 Bacteria 1662
77 Ga0068856_100327094 3300005614 Unclassified 1550
78 Ga0068856_100330157 3300005614 Bacteria 1543
79 Ga0068856_100343036 3300005614 Bacteria 1512
80 Ga0070702_100047528 3300005615 Unclassified 2438
81 Ga0070702_100221371 3300005615 Bacteria 1266
82 Ga0068866_10017915 3300005718 Bacteria 3194
83 Ga0068861_100088363 3300005719 Unclassified 2440
84 Ga0068861_100129116 3300005719 Unclassified 2049
85 Ga0068863_100326980 3300005841 Bacteria 1490
86 Ga0068862_100465831 3300005844 Bacteria 1194
87 Ga0081540_1002947 3300005983 Bacteria 13675
88 Ga0081539_10032150 3300005985 Bacteria 3219
89 Ga0070717_10275872 3300006028 Unclassified 1490
90 Ga0070712_100075258 3300006175 Bacteria 2428
91 Ga0070712_100447696 3300006175 Bacteria 1075
92 Ga0075428_100008829 3300006844 Bacteria 11183
93 Ga0075428_100320730 3300006844 Bacteria 1665
94 Ga0075431_100062911 3300006847 Bacteria 3829
95 Ga0068865_100178071 3300006881 Unclassified 1635
96 Ga0075435_100061982 3300007076 Bacteria 3035
97 Ga0105240_10042128 3300009093 Bacteria 5821
98 Ga0105240_10061476 3300009093 Bacteria 4680
99 Ga0105240_10072887 3300009093 Bacteria 4243
100 Ga0105240_10129947 3300009093 Bacteria 3022
101 Ga0111539_10008027 3300009094 Bacteria 13463
102 Ga0111539_10026073 3300009094 Bacteria 7156
103 Ga0111539_10407486 3300009094 Bacteria 1583
104 Ga0105245_10010748 3300009098 Bacteria 7964
105 Ga0105245_10070586 3300009098 Bacteria 3170
106 Ga0105245_10092189 3300009098 Bacteria 2790
107 Ga0105245_10382538 3300009098 Unclassified 1402
108 Ga0114129_10523743 3300009147 Bacteria 1545
109 Ga0105243_10070078 3300009148 Bacteria 2830
110 Ga0105243_10137419 3300009148 Bacteria 2081
111 Ga0105243_10152767 3300009148 Bacteria 1982
112 Ga0105241_10085579 3300009174 Bacteria 2478
113 Ga0105242_10200505 3300009176 Bacteria 1772
114 Ga0105237_10084575 3300009545 Bacteria 3163
115 Ga0105249_10056858 3300009553 Bacteria 3582
116 Ga0105249_10086145 3300009553 Bacteria 2929
117 Ga0105239_10088188 3300010375 Bacteria 3421
118 Ga0105239_10372453 3300010375 Unclassified 1614
119 Ga0157370_10010192 3300013104 Bacteria 9924
120 Ga0157370_10030325 3300013104 Bacteria 5300
121 Ga0157370_10043629 3300013104 Bacteria 4314
122 Ga0157370_10091393 3300013104 Bacteria 2858
123 Ga0157369_10019839 3300013105 Bacteria 7523
124 Ga0157369_10030919 3300013105 Bacteria 5901
125 Ga0157369_10168171 3300013105 Bacteria 2311
126 Ga0157369_10667934 3300013105 Bacteria 1071
127 Ga0157374_10052826 3300013296 Bacteria 3787
128 Ga0157378_10187554 3300013297 Bacteria 1949
129 Ga0157372_10042033 3300013307 Bacteria 5054
130 Ga0157372_10233127 3300013307 Bacteria 2134
131 Ga0157375_10680515 3300013308 Unclassified 1183
132 Ga0163163_10097424 3300014325 Bacteria 2961
133 Ga0157379_10151829 3300014968 Bacteria 2089
134 Ga0206356_10060908 3300020070 Bacteria 2284
135 Ga0206354_11001909 3300020081 Bacteria 6173
136 Ga0206354_11281213 3300020081 Bacteria 2534
137 Ga0206353_10219348 3300020082 Bacteria 4766
138 Ga0206353_10797243 3300020082 Bacteria 4872
139 Ga0206353_10937337 3300020082 Bacteria 2470
140 Ga0206353_11326857 3300020082 Bacteria 7780
141 Ga0213874_10117999 3300021377 Bacteria 899
142 Ga0213876_10126981 3300021384 Unclassified 1355
143 Ga0207642_10040903 3300025899 Unclassified 2026
144 Ga0207699_10113885 3300025906 Archaea 1738
145 Ga0207705_10005428 3300025909 Bacteria 9534
146 Ga0207684_10211041 3300025910 Bacteria 1675
147 Ga0207707_10002423 3300025912 Bacteria 16786
148 Ga0207707_10032026 3300025912 Bacteria 4603
149 Ga0207707_10073947 3300025912 Bacteria 2972
150 Ga0207671_10417306 3300025914 Bacteria 1068
151 Ga0207693_10111747 3300025915 Bacteria 2143
152 Ga0207660_10016595 3300025917 Bacteria 4877
153 Ga0207660_10130589 3300025917 Bacteria 1912
154 Ga0207657_10000729 3300025919 Bacteria 34956
155 Ga0207657_10001944 3300025919 Bacteria 22302
156 Ga0207657_10004008 3300025919 Bacteria 15659
157 Ga0207657_10023102 3300025919 Bacteria 5800
158 Ga0207657_10107920 3300025919 Bacteria 2302
159 Ga0207657_10158489 3300025919 Unclassified 1839
160 Ga0207649_10203708 3300025920 Unclassified 1399
161 Ga0207649_10311662 3300025920 Bacteria 1154
162 Ga0207652_10011360 3300025921 Bacteria 7176
163 Ga0207652_10028268 3300025921 Bacteria 4678
164 Ga0207652_10032668 3300025921 Bacteria 4377
165 Ga0207652_10116083 3300025921 Bacteria 2378
166 Ga0207652_10516341 3300025921 Bacteria 1075
167 Ga0207646_10252360 3300025922 Bacteria 1594
168 Ga0207687_10010913 3300025927 Bacteria 5937
169 Ga0207687_10248718 3300025927 Unclassified 1412
170 Ga0207700_10166312 3300025928 Bacteria 1836
171 Ga0207664_10049325 3300025929 Bacteria 3314
172 Ga0207690_10279576 3300025932 Unclassified 1299
173 Ga0207706_10002315 3300025933 Bacteria 18592
174 Ga0207709_10080802 3300025935 Bacteria 2094
175 Ga0207709_10093084 3300025935 Bacteria 1975
176 Ga0207709_10260333 3300025935 Bacteria 1272
177 Ga0207669_10013149 3300025937 Bacteria 4100
178 Ga0207661_10009186 3300025944 Bacteria 7087
179 Ga0207661_10024051 3300025944 Bacteria 4610
180 Ga0207661_10038489 3300025944 Bacteria 3749
181 Ga0207661_10115742 3300025944 Bacteria 2275
182 Ga0207661_10199411 3300025944 Bacteria 1759
183 Ga0207661_10216211 3300025944 Bacteria 1692
184 Ga0207679_10373041 3300025945 Bacteria 1249
185 Ga0207667_10098870 3300025949 Bacteria 3010
186 Ga0207667_10125000 3300025949 Bacteria 2649
187 Ga0207667_10201163 3300025949 Unclassified 2043
188 Ga0207712_10056722 3300025961 Unclassified 2760
189 Ga0207712_10502858 3300025961 Unclassified 1036
190 Ga0207677_10085316 3300026023 Bacteria 2279
191 Ga0207639_10055935 3300026041 Unclassified 3021
192 Ga0207639_10098974 3300026041 Bacteria 2352
193 Ga0207639_10170975 3300026041 Unclassified 1840
194 Ga0207708_10011633 3300026075 Bacteria 6557
195 Ga0207702_10095877 3300026078 Bacteria 2608
196 Ga0207702_10138498 3300026078 Bacteria 2199
197 Ga0207674_10006916 3300026116 Bacteria 13286
198 Ga0207674_10021389 3300026116 Bacteria 6966
199 Ga0207674_10444382 3300026116 Bacteria 1253
200 Ga0207675_100041666 3300026118 Bacteria 4288
201 Ga0207675_100106471 3300026118 Bacteria 2644
202 Ga0207683_10152371 3300026121 Bacteria 2086
203 Ga0207683_10195626 3300026121 Unclassified 1837
204 Ga0207698_10090403 3300026142 Unclassified 2503
205 Ga0207698_10318681 3300026142 Bacteria 1455
206 Ga0268266_10047052 3300028379 Bacteria 3693
207 Ga0265334_10102351 3300028573 Bacteria 1036
208 Ga0265330_10062091 3300031235 Bacteria 1625
209 Ga0265331_10083026 3300031250 Bacteria 1486
210 Ga0307408_100021730 3300031548 Bacteria 4347
211 Ga0265314_10121030 3300031711 Bacteria 1647
212 Ga0265342_10049652 3300031712 Bacteria 2510
213 Ga0307405_10034120 3300031731 Bacteria 3025
214 Ga0307410_10002303 3300031852 Bacteria 9174
215 Ga0307406_10177453 3300031901 Unclassified 1548
216 Ga0307407_10007792 3300031903 Bacteria 4873
217 Ga0307409_100187522 3300031995 Bacteria 1837
218 Ga0307409_100461440 3300031995 Unclassified 1228
219 Ga0307416_100627071 3300032002 Unclassified 1158
220 Ga0307414_10207074 3300032004 Unclassified 1600
221 Ga0307415_100015157 3300032126 Bacteria 4555
222 Ga0373945_0028630 3300035116 Unclassified 1953
223 Ga0373943_0002579 3300035170 Bacteria 8251
224 Ga0373943_0050809 3300035170 Bacteria 2039
225 Ga0373924_0106314 3300035410 Unclassified 1210
226 Ga0373935_0026290 3300035692 Bacteria 3591
227 Ga0373947_0002352 3300035725 Bacteria 11431
228 Ga0373947_0012865 3300035725 Bacteria 4796
229 Ga0373937_0013631 3300036401 Bacteria 7162
230 Ga0373937_0035366 3300036401 Bacteria 4547
231 Ga0373937_0376706 3300036401 Bacteria 1346
232 Ga0373925_0108894 3300037068 Bacteria 2138
233 Ga0395899_0001704 3300037312 Bacteria 18327
234 Ga0395899_0005277 3300037312 Bacteria 10033
235 Ga0395900_0022324 3300037418 Bacteria 6474
236 Ga0395900_0027632 3300037418 Bacteria 5812
237 Ga0395900_0083645 3300037418 Unclassified 3278
238 Ga0395900_0133285 3300037418 Bacteria 2546
239 Ga0395900_0164469 3300037418 Bacteria 2262
240 Ga0395900_0227692 3300037418 Bacteria 1876
241 Ga0395900_0271313 3300037418 Bacteria 1691
242 Ga0395898_0002500 3300037466 Bacteria 21621
243 Ga0395898_0019663 3300037466 Bacteria 6869
244 Ga0395898_0068158 3300037466 Bacteria 3443
245 Ga0395898_0094618 3300037466 Bacteria 2871
246 Ga0395898_0449987 3300037466 Unclassified 1226
247 Ga0395905_0001543 3300037471 Bacteria 27575
248 Ga0395901_0000793 3300038443 Bacteria 35158
249 Ga0395901_0005710 3300038443 Bacteria 12596
250 Ga0395901_0011480 3300038443 Bacteria 8977
251 Ga0395901_0024391 3300038443 Bacteria 6207
252 Ga0395901_0044689 3300038443 Bacteria 4594
253 Ga0395901_0056742 3300038443 Bacteria 4074
254 Ga0395901_0066955 3300038443 Bacteria 3740
255 Ga0395901_0516711 3300038443 Bacteria 1214
256 Ga0436365_0849087 3300039437 Bacteria 3679
257 Ga0436365_1579049 3300039437 Bacteria 3461
258 Ga0436363_0752796 3300039450 Unclassified 2307
259 Ga0466965_0039325 3300044683 Bacteria 2325
260 Ga0466966_0026086 3300044684 Bacteria 3815
261 Ga0466966_0088062 3300044684 Bacteria 1930
262 Ga0466966_0123726 3300044684 Bacteria 1587
263 Ga0466961_0003440 3300044693 Bacteria 9873
264 Ga0466961_0122610 3300044693 Bacteria 1631
265 Ga0466963_0001451 3300044694 Bacteria 12777
266 Ga0466963_0006220 3300044694 Bacteria 7050
267 Ga0466963_0006931 3300044694 Bacteria 6742
268 Ga0466963_0009588 3300044694 Bacteria 5836
269 Ga0466964_0002704 3300044706 Bacteria 6357
270 Ga0466964_0006723 3300044706 Bacteria 4286
271 Ga0466964_0043650 3300044706 Bacteria 1819
272 Ga0466971_0000517 3300044719 Bacteria 15241
273 Ga0466968_0003004 3300044735 Bacteria 6234
274 Ga0466957_0002890 3300044842 Bacteria 9308
275 Ga0466957_0065188 3300044842 Bacteria 2243
276 Ga0466957_0143107 3300044842 Bacteria 1542
277 Ga0466959_0030402 3300045049 Bacteria 3999
278 Ga0466959_0051312 3300045049 Bacteria 3026
279 Ga0466958_0000293 3300045836 Bacteria 19554
280 Ga0466967_0001267 3300045976 Bacteria 14313
281 Ga0466967_0003389 3300045976 Bacteria 10387
282 Ga0466967_0005119 3300045976 Bacteria 9010
283 Ga0466967_0005416 3300045976 Bacteria 8841
284 Ga0466967_0010726 3300045976 Bacteria 6889
285 Ga0466967_0011338 3300045976 Bacteria 6744
286 Ga0466967_0035219 3300045976 Bacteria 4258
287 Ga0466967_0035398 3300045976 Bacteria 4250
288 Ga0466967_0040324 3300045976 Bacteria 4019
289 Ga0466967_0046923 3300045976 Bacteria 3764
290 Ga0466967_0053104 3300045976 Bacteria 3561
291 Ga0466967_0060067 3300045976 Bacteria 3367
292 Ga0466967_0068277 3300045976 Bacteria 3174
293 Ga0466967_0342182 3300045976 Bacteria 1447
294 Ga0466967_0470481 3300045976 Bacteria 1230
295 Ga0466967_0573452 3300045976 Bacteria 1112
296 Ga0495592_0131243 3300046454 Bacteria 1752
297 Ga0495603_0098552 3300046455 Unclassified 1707
298 Ga0495629_0001622 3300046459 Bacteria 17679
299 Ga0495641_0011396 3300046461 Bacteria 5070
300 Ga0495641_0032588 3300046461 Bacteria 2478
301 Ga0495641_0035542 3300046461 Unclassified 2347
302 Ga0495641_0039809 3300046461 Unclassified 2189
303 Ga0495651_0045662 3300046462 Bacteria 3393
304 Ga0495651_0347840 3300046462 Unclassified 980
305 Ga0495653_0031547 3300046463 Bacteria 4211
306 Ga0495582_0000462 3300046473 Bacteria 22207
307 Ga0495582_0012924 3300046473 Unclassified 4600
308 Ga0495582_0100801 3300046473 Bacteria 1617
309 Ga0495582_0104847 3300046473 Bacteria 1585
310 Ga0495582_0110385 3300046473 Bacteria 1545
311 Ga0495605_0121969 3300046474 Bacteria 1181
312 Ga0495639_0053137 3300046475 Bacteria 1845
313 Ga0495662_0012839 3300046476 Bacteria 4082
314 Ga0495664_0155630 3300046477 Bacteria 1387
315 Ga0495594_0003954 3300046499 Bacteria 7628
316 Ga0495583_0166392 3300046506 Bacteria 908
317 Ga0495608_0017740 3300046511 Bacteria 4921
318 Ga0495618_0215029 3300046514 Bacteria 1214
319 Ga0495620_0130387 3300046515 Bacteria 987
320 Ga0495630_0035854 3300046517 Bacteria 3706
321 Ga0495630_0041107 3300046517 Bacteria 3453
322 Ga0495630_0056093 3300046517 Bacteria 2952
323 Ga0495630_0083125 3300046517 Bacteria 2417
324 Ga0495630_0478785 3300046517 Bacteria 954
325 Ga0495637_0014193 3300046520 Unclassified 3762
326 Ga0495663_0003034 3300046525 Bacteria 4918
327 Ga0495666_0021772 3300046526 Bacteria 3173
328 Ga0495640_0401551 3300046533 Unclassified 841
329 Ga0495609_0069795 3300046538 Bacteria 1545
330 Ga0495645_0270691 3300046543 Unclassified 1121
331 Ga0495656_0019464 3300046615 Unclassified 2621
332 Ga0495656_0120586 3300046615 Bacteria 1237
333 Ga0495656_0135367 3300046615 Bacteria 1176
334 Ga0495668_0101495 3300046616 Bacteria 1574
335 Ga0495635_0010149 3300046663 Bacteria 6587
336 Ga0495635_0164280 3300046663 Unclassified 1511
337 Ga0495588_0061467 3300046674 Bacteria 1945
338 Ga0495588_0216988 3300046674 Bacteria 1010
339 Ga0495657_0008481 3300046675 Bacteria 7858
340 Ga0495647_0115048 3300046681 Unclassified 1126
341 Ga0495658_0064057 3300046683 Bacteria 2117
342 Ga0495613_0307852 3300046689 Unclassified 1095
343 Ga0495670_0073956 3300046691 Unclassified 1728
344 Ga0495581_0010957 3300047315 Bacteria 5239
345 Ga0495581_0067974 3300047315 Bacteria 2060
346 Ga0495604_0020764 3300047317 Bacteria 5244
347 Ga0495674_0033982 3300047319 Bacteria 4614
348 Ga0495674_0057511 3300047319 Bacteria 3403
349 Ga0495676_0000602 3300047321 Bacteria 29783
350 Ga0495676_0005860 3300047321 Bacteria 11279
351 Ga0495676_0052485 3300047321 Bacteria 3254
352 Ga0495676_0055763 3300047321 Bacteria 3131
353 Ga0495680_0037244 3300047322 Bacteria 3897
354 Ga0495680_0130684 3300047322 Bacteria 1845
355 Ga0495684_0012815 3300047471 Bacteria 6470
356 Ga0495684_0021788 3300047471 Bacteria 4933
357 Ga0495593_0001385 3300047673 Bacteria 14192
358 Ga0495602_0044322 3300048088 Bacteria 4036
359 Ga0495614_0002163 3300048089 Bacteria 8706
360 Ga0495626_0042167 3300048091 Unclassified 2145
361 Ga0496100_0026986 3300048903 Unclassified 3526
362 Ga0496100_0111557 3300048903 Archaea 1901
363 Ga0496101_0028357 3300048904 Bacteria 3907
364 Ga0496101_0096856 3300048904 Bacteria 2202
365 Ga0496101_0181507 3300048904 Bacteria 1621
366 Ga0496102_0005731 3300048905 Bacteria 10556
367 Ga0496102_0041719 3300048905 Bacteria 4157
368 Ga0496102_0062807 3300048905 Bacteria 3401
369 Ga0496102_0076069 3300048905 Bacteria 3087
370 Ga0496102_0198225 3300048905 Bacteria 1892
371 Ga0496102_0555673 3300048905 Bacteria 1071
372 Ga0496103_0008402 3300048906 Bacteria 6135
373 Ga0496103_0013265 3300048906 Bacteria 4884
374 Ga0496103_0018647 3300048906 Bacteria 4163
375 Ga0496103_0125000 3300048906 Bacteria 1640
376 Ga0496104_0000553 3300048907 Bacteria 31874
377 Ga0496104_0001649 3300048907 Bacteria 19260
378 Ga0496104_0023741 3300048907 Bacteria 5639
379 Ga0496104_0031870 3300048907 Bacteria 4904
380 Ga0496104_0062306 3300048907 Bacteria 3536
381 Ga0496105_0000148 3300048908 Bacteria 46239
382 Ga0496105_0018441 3300048908 Bacteria 5609
383 Ga0496105_0029551 3300048908 Bacteria 4486
384 Ga0496106_0009390 3300048909 Bacteria 7229
385 Ga0496106_0059333 3300048909 Bacteria 2898
386 Ga0496107_0006281 3300048910 Bacteria 8169
387 Ga0496107_0050607 3300048910 Bacteria 2995
388 Ga0496108_0000826 3300048911 Bacteria 24092
389 Ga0496108_0004653 3300048911 Bacteria 11064
390 Ga0496108_0024431 3300048911 Bacteria 4975
391 Ga0496108_0092069 3300048911 Bacteria 2578
392 Ga0496109_0002310 3300048912 Bacteria 15874
393 Ga0496109_0003348 3300048912 Bacteria 13409
394 Ga0496109_0006341 3300048912 Bacteria 9962
395 Ga0496109_0045780 3300048912 Bacteria 3971
396 Ga0496109_0074478 3300048912 Bacteria 3121
397 Ga0496109_0076223 3300048912 Bacteria 3084
398 Ga0496110_0000588 3300048913 Bacteria 25003
399 Ga0496110_0001205 3300048913 Bacteria 18413
400 Ga0496110_0115789 3300048913 Bacteria 2413
401 Ga0496110_0151001 3300048913 Bacteria 2104
402 Ga0496111_0000025 3300048914 Bacteria 62100
403 Ga0496111_0000474 3300048914 Bacteria 20521
404 Ga0496111_0029295 3300048914 Bacteria 3909
405 Ga0496111_0109291 3300048914 Bacteria 2036
406 Ga0496111_0212507 3300048914 Bacteria 1437
407 Ga0496112_0000885 3300048915 Bacteria 21514
408 Ga0496112_0001618 3300048915 Bacteria 17434
409 Ga0496112_0016647 3300048915 Bacteria 6893
410 Ga0496112_0028868 3300048915 Bacteria 5360
411 Ga0496113_0000040 3300048916 Bacteria 55517
412 Ga0496114_0000385 3300048917 Bacteria 32591
413 Ga0496114_0001590 3300048917 Bacteria 17228
414 Ga0496114_0020252 3300048917 Bacteria 5398
415 Ga0496114_0053272 3300048917 Bacteria 3372
416 Ga0496114_0138804 3300048917 Bacteria 2103
417 Ga0496115_0009771 3300048918 Bacteria 7147
418 Ga0496115_0017912 3300048918 Bacteria 5427
419 Ga0496115_0032954 3300048918 Bacteria 4089
420 Ga0501031_0002877 3300049568 Bacteria 11003
421 Ga0501033_0093986 3300049570 Bacteria 2193
422 Ga0501034_0029782 3300049571 Bacteria 5549
423 Ga0501036_0014420 3300049572 Bacteria 6582
424 Ga0501037_0026419 3300049573 Bacteria 4292
425 Ga0501039_0030779 3300049575 Bacteria 4138
426 Ga0501040_0023383 3300049576 Bacteria 4144
427 Ga0501042_0368706 3300049578 Bacteria 1039
428 Ga0501043_0130138 3300049579 Unclassified 1972
429 Ga0501046_0114916 3300049580 Bacteria 2053
430 Ga0501047_0063412 3300049581 Bacteria 3565
431 Ga0501047_0081163 3300049581 Bacteria 3118
432 Ga0501047_0118001 3300049581 Bacteria 2535
433 Ga0501048_0007923 3300049582 Bacteria 8046
434 Ga0501067_0000285 3300049583 Bacteria 27590
435 Ga0501067_0016770 3300049583 Bacteria 4048
436 Ga0501067_0032558 3300049583 Bacteria 2894
437 Ga0501069_0002217 3300049585 Bacteria 9794
438 Ga0501069_0153285 3300049585 Unclassified 1325
439 Ga0501070_0007274 3300049586 Bacteria 9398
440 Ga0501070_0010590 3300049586 Bacteria 7795
441 Ga0501071_0036160 3300049587 Bacteria 3521
442 Ga0501072_0001083 3300049588 Bacteria 20212
443 Ga0501072_0028816 3300049588 Bacteria 4334
444 Ga0501074_0008072 3300049590 Bacteria 7625
445 Ga0501074_0037963 3300049590 Bacteria 3491
446 Ga0501074_0042636 3300049590 Bacteria 3283
447 Ga0501074_0172704 3300049590 Bacteria 1542
448 Ga0501074_0370962 3300049590 Bacteria 1015
449 Ga0501075_0005192 3300049591 Bacteria 8908
450 Ga0501076_0031566 3300049592 Bacteria 4132
451 Ga0501077_0002003 3300049593 Bacteria 12295
452 Ga0501077_0066396 3300049593 Bacteria 2288
453 Ga0501079_0125676 3300049741 Bacteria 1995
454 Ga0501079_0134572 3300049741 Bacteria 1924
455 Ga0501079_0289323 3300049741 Bacteria 1281
456 Ga0501080_0029157 3300049742 Bacteria 5137
457 Ga0501080_0050853 3300049742 Bacteria 3856
458 Ga0501080_0133580 3300049742 Bacteria 2297
459 Ga0501081_0030638 3300049743 Bacteria 3643
460 Ga0501081_0161196 3300049743 Unclassified 1616
461 Ga0501083_0000145 3300049744 Bacteria 48483
462 Ga0501083_0282072 3300049744 Bacteria 1081
463 Ga0501044_0479047 3300049823 Bacteria 1148
464 Ga0501045_0016669 3300049824 Bacteria 5219
465 nmdc:mga08y16_145498_c1 3300050511 Bacteria 2464
466 nmdc:mga08y16_348398_c1 3300050511 Bacteria 1522
467 nmdc:mga0a205_68546_c1 3300050515 Bacteria 3426
468 nmdc:mga0a205_78971_c1 3300050515 Bacteria 3179
469 Ga0495601_0098507 3300053077 Bacteria 1887
470 Ga0495655_0006893 3300053083 Bacteria 2089
471 Ga0495595_0005718 3300053084 Bacteria 5034
472 Ga0495595_0013729 3300053084 Bacteria 3426
473 Ga0495619_0019345 3300053085 Bacteria 4327
474 Ga0495619_0327432 3300053085 Unclassified 1060
475 Ga0501084_0010155 3300054114 Bacteria 7784
476 Ga0501084_0097305 3300054114 Bacteria 2471
477 Ga0501082_0040567 3300060353 Bacteria 4015
478 Ga0501082_0074282 3300060353 Bacteria 2928
479 Ga0466962_0000941 3300061719 Bacteria 13185
480 Ga0207652_10300521
481 rootH1_10043484
482 Ga0070658_10091016
483 Ga0070683_100004054
484 Ga0070683_100008394
485 Ga0070683_100047696
486 Ga0070683_100056548
487 Ga0070680_100003464
488 Ga0070680_100040903
489 Ga0070680_100053171
490 Ga0070680_100186424
491 Ga0070682_100010240
492 Ga0068868_100056790
493 Ga0070660_100001630
494 Ga0070660_100038617
495 Ga0070660_100078944
496 Ga0070691_10034941
497 Ga0070691_10051488
498 Ga0070661_100003593
499 Ga0070668_100169060
500 Ga0070668_100405456
501 Ga0070659_100005908
502 Ga0070713_100144958
503 Ga0070711_100037184
504 Ga0070705_100046697
505 Ga0070700_100105324
506 Ga0070700_100300443
507 Ga0070694_100046854
508 Ga0070708_100037016
509 Ga0070678_100040382
510 Ga0070681_10003387
511 Ga0070681_10005097
512 Ga0070681_10007940
513 Ga0070681_10021735
514 Ga0070681_10043807
515 Ga0070681_10055265
516 Ga0070681_10131737
517 Ga0070706_100359438
518 Ga0070707_100032332
519 Ga0070707_100317230
520 Ga0070698_100221310
521 Ga0070679_100005688
522 Ga0070679_100009583
523 Ga0070679_100011265
524 Ga0070679_100014307
525 Ga0070679_100093746
526 Ga0070679_100421904
527 Ga0070679_100520698
528 Ga0070684_100035017
529 Ga0070684_100044222
530 Ga0070684_100081149
531 Ga0070684_100085923
532 Ga0070684_100182632
533 Ga0068853_100099600
534 Ga0068853_100406161
535 Ga0070672_100127745
536 Ga0070686_100046705
537 Ga0070695_100281756
538 Ga0070696_100021130
539 Ga0070693_100003969
540 Ga0070693_100020165
541 Ga0070693_100099869
542 Ga0070665_100052036
543 Ga0070665_100124859
544 Ga0070704_100048227
545 Ga0070704_100333408
546 Ga0068855_100094824
547 Ga0068855_100136980
548 Ga0070664_100593378
549 Ga0068857_100022009
550 Ga0068857_100024503
551 Ga0068857_100271253
552 Ga0068856_100006533
553 Ga0068856_100097222
554 Ga0068856_100287274
555 Ga0068856_100327094
556 Ga0068856_100330157
557 Ga0068856_100343036
558 Ga0070702_100047528
559 Ga0070702_100221371
560 Ga0068866_10017915
561 Ga0068861_100088363
562 Ga0068861_100129116
563 Ga0068863_100326980
564 Ga0068862_100465831
565 Ga0081540_1002947
566 Ga0081539_10032150
567 Ga0070717_10275872
568 Ga0070712_100075258
569 Ga0070712_100447696
570 Ga0075428_100008829
571 Ga0075428_100320730
572 Ga0075431_100062911
573 Ga0068865_100178071
574 Ga0075435_100061982
575 Ga0105240_10042128
576 Ga0105240_10061476
577 Ga0105240_10072887
578 Ga0105240_10129947
579 Ga0111539_10008027
580 Ga0111539_10026073
581 Ga0111539_10407486
582 Ga0105245_10010748
583 Ga0105245_10070586
584 Ga0105245_10092189
585 Ga0105245_10382538
586 Ga0114129_10523743
587 Ga0105243_10070078
588 Ga0105243_10137419
589 Ga0105243_10152767
590 Ga0105241_10085579
591 Ga0105242_10200505
592 Ga0105237_10084575
593 Ga0105249_10056858
594 Ga0105249_10086145
595 Ga0105239_10088188
596 Ga0105239_10372453
597 Ga0157370_10010192
598 Ga0157370_10030325
599 Ga0157370_10043629
600 Ga0157370_10091393
601 Ga0157369_10019839
602 Ga0157369_10030919
603 Ga0157369_10168171
604 Ga0157369_10667934
605 Ga0157374_10052826
606 Ga0157378_10187554
607 Ga0157372_10042033
608 Ga0157372_10233127
609 Ga0157375_10680515
610 Ga0163163_10097424
611 Ga0157379_10151829
612 Ga0206356_10060908
613 Ga0206354_11001909
614 Ga0206354_11281213
615 Ga0206353_10219348
616 Ga0206353_10797243
617 Ga0206353_10937337
618 Ga0206353_11326857
619 Ga0213874_10117999
620 Ga0213876_10126981
621 Ga0207642_10040903
622 Ga0207699_10113885
623 Ga0207705_10005428
624 Ga0207684_10211041
625 Ga0207707_10002423
626 Ga0207707_10032026
627 Ga0207707_10073947
628 Ga0207671_10417306
629 Ga0207693_10111747
630 Ga0207660_10016595
631 Ga0207660_10130589
632 Ga0207657_10000729
633 Ga0207657_10001944
634 Ga0207657_10004008
635 Ga0207657_10023102
636 Ga0207657_10107920
637 Ga0207657_10158489
638 Ga0207649_10203708
639 Ga0207649_10311662
640 Ga0207652_10011360
641 Ga0207652_10028268
642 Ga0207652_10032668
643 Ga0207652_10116083
644 Ga0207652_10516341
645 Ga0207646_10252360
646 Ga0207687_10010913
647 Ga0207687_10248718
648 Ga0207700_10166312
649 Ga0207664_10049325
650 Ga0207690_10279576
651 Ga0207706_10002315
652 Ga0207709_10080802
653 Ga0207709_10093084
654 Ga0207709_10260333
655 Ga0207669_10013149
656 Ga0207661_10009186
657 Ga0207661_10024051
658 Ga0207661_10038489
659 Ga0207661_10115742
660 Ga0207661_10199411
661 Ga0207661_10216211
662 Ga0207679_10373041
663 Ga0207667_10098870
664 Ga0207667_10125000
665 Ga0207667_10201163
666 Ga0207712_10056722
667 Ga0207712_10502858
668 Ga0207677_10085316
669 Ga0207639_10055935
670 Ga0207639_10098974
671 Ga0207639_10170975
672 Ga0207708_10011633
673 Ga0207702_10095877
674 Ga0207702_10138498
675 Ga0207674_10006916
676 Ga0207674_10021389
677 Ga0207674_10444382
678 Ga0207675_100041666
679 Ga0207675_100106471
680 Ga0207683_10152371
681 Ga0207683_10195626
682 Ga0207698_10090403
683 Ga0207698_10318681
684 Ga0268266_10047052
685 Ga0265334_10102351
686 Ga0265330_10062091
687 Ga0265331_10083026
688 Ga0307408_100021730
689 Ga0265314_10121030
690 Ga0265342_10049652
691 Ga0307405_10034120
692 Ga0307410_10002303
693 Ga0307406_10177453
694 Ga0307407_10007792
695 Ga0307409_100187522
696 Ga0307409_100461440
697 Ga0307416_100627071
698 Ga0307414_10207074
699 Ga0307415_100015157
700 Ga0373945_0028630
701 Ga0373943_0002579
702 Ga0373943_0050809
703 Ga0373924_0106314
704 Ga0373935_0026290
705 Ga0373947_0002352
706 Ga0373947_0012865
707 Ga0373937_0013631
708 Ga0373937_0035366
709 Ga0373937_0376706
710 Ga0373925_0108894
711 Ga0395899_0001704
712 Ga0395899_0005277
713 Ga0395900_0022324
714 Ga0395900_0027632
715 Ga0395900_0083645
716 Ga0395900_0133285
717 Ga0395900_0164469
718 Ga0395900_0227692
719 Ga0395900_0271313
720 Ga0395898_0002500
721 Ga0395898_0019663
722 Ga0395898_0068158
723 Ga0395898_0094618
724 Ga0395898_0449987
725 Ga0395905_0001543
726 Ga0395901_0000793
727 Ga0395901_0005710
728 Ga0395901_0011480
729 Ga0395901_0024391
730 Ga0395901_0044689
731 Ga0395901_0056742
732 Ga0395901_0066955
733 Ga0395901_0516711
734 Ga0436365_0849087
735 Ga0436365_1579049
736 Ga0436363_0752796
737 Ga0466965_0039325
738 Ga0466966_0026086
739 Ga0466966_0088062
740 Ga0466966_0123726
741 Ga0466961_0003440
742 Ga0466961_0122610
743 Ga0466963_0001451
744 Ga0466963_0006220
745 Ga0466963_0006931
746 Ga0466963_0009588
747 Ga0466964_0002704
748 Ga0466964_0006723
749 Ga0466964_0043650
750 Ga0466971_0000517
751 Ga0466968_0003004
752 Ga0466957_0002890
753 Ga0466957_0065188
754 Ga0466957_0143107
755 Ga0466959_0030402
756 Ga0466959_0051312
757 Ga0466958_0000293
758 Ga0466967_0001267
759 Ga0466967_0003389
760 Ga0466967_0005119
761 Ga0466967_0005416
762 Ga0466967_0010726
763 Ga0466967_0011338
764 Ga0466967_0035219
765 Ga0466967_0035398
766 Ga0466967_0040324
767 Ga0466967_0046923
768 Ga0466967_0053104
769 Ga0466967_0060067
770 Ga0466967_0068277
771 Ga0466967_0342182
772 Ga0466967_0470481
773 Ga0466967_0573452
774 Ga0495592_0131243
775 Ga0495603_0098552
776 Ga0495629_0001622
777 Ga0495641_0011396
778 Ga0495641_0032588
779 Ga0495641_0035542
780 Ga0495641_0039809
781 Ga0495651_0045662
782 Ga0495651_0347840
783 Ga0495653_0031547
784 Ga0495582_0000462
785 Ga0495582_0012924
786 Ga0495582_0100801
787 Ga0495582_0104847
788 Ga0495582_0110385
789 Ga0495605_0121969
790 Ga0495639_0053137
791 Ga0495662_0012839
792 Ga0495664_0155630
793 Ga0495594_0003954
794 Ga0495583_0166392
795 Ga0495608_0017740
796 Ga0495618_0215029
797 Ga0495620_0130387
798 Ga0495630_0035854
799 Ga0495630_0041107
800 Ga0495630_0056093
801 Ga0495630_0083125
802 Ga0495630_0478785
803 Ga0495637_0014193
804 Ga0495663_0003034
805 Ga0495666_0021772
806 Ga0495640_0401551
807 Ga0495609_0069795
808 Ga0495645_0270691
809 Ga0495656_0019464
810 Ga0495656_0120586
811 Ga0495656_0135367
812 Ga0495668_0101495
813 Ga0495635_0010149
814 Ga0495635_0164280
815 Ga0495588_0061467
816 Ga0495588_0216988
817 Ga0495657_0008481
818 Ga0495647_0115048
819 Ga0495658_0064057
820 Ga0495613_0307852
821 Ga0495670_0073956
822 Ga0495581_0010957
823 Ga0495581_0067974
824 Ga0495604_0020764
825 Ga0495674_0033982
826 Ga0495674_0057511
827 Ga0495676_0000602
828 Ga0495676_0005860
829 Ga0495676_0052485
830 Ga0495676_0055763
831 Ga0495680_0037244
832 Ga0495680_0130684
833 Ga0495684_0012815
834 Ga0495684_0021788
835 Ga0495593_0001385
836 Ga0495602_0044322
837 Ga0495614_0002163
838 Ga0495626_0042167
839 Ga0496100_0026986
840 Ga0496100_0111557
841 Ga0496101_0028357
842 Ga0496101_0096856
843 Ga0496101_0181507
844 Ga0496102_0005731
845 Ga0496102_0041719
846 Ga0496102_0062807
847 Ga0496102_0076069
848 Ga0496102_0198225
849 Ga0496102_0555673
850 Ga0496103_0008402
851 Ga0496103_0013265
852 Ga0496103_0018647
853 Ga0496103_0125000
854 Ga0496104_0000553
855 Ga0496104_0001649
856 Ga0496104_0023741
857 Ga0496104_0031870
858 Ga0496104_0062306
859 Ga0496105_0000148
860 Ga0496105_0018441
861 Ga0496105_0029551
862 Ga0496106_0009390
863 Ga0496106_0059333
864 Ga0496107_0006281
865 Ga0496107_0050607
866 Ga0496108_0000826
867 Ga0496108_0004653
868 Ga0496108_0024431
869 Ga0496108_0092069
870 Ga0496109_0002310
871 Ga0496109_0003348
872 Ga0496109_0006341
873 Ga0496109_0045780
874 Ga0496109_0074478
875 Ga0496109_0076223
876 Ga0496110_0000588
877 Ga0496110_0001205
878 Ga0496110_0115789
879 Ga0496110_0151001
880 Ga0496111_0000025
881 Ga0496111_0000474
882 Ga0496111_0029295
883 Ga0496111_0109291
884 Ga0496111_0212507
885 Ga0496112_0000885
886 Ga0496112_0001618
887 Ga0496112_0016647
888 Ga0496112_0028868
889 Ga0496113_0000040
890 Ga0496114_0000385
891 Ga0496114_0001590
892 Ga0496114_0020252
893 Ga0496114_0053272
894 Ga0496114_0138804
895 Ga0496115_0009771
896 Ga0496115_0017912
897 Ga0496115_0032954
898 Ga0501031_0002877
899 Ga0501033_0093986
900 Ga0501034_0029782
901 Ga0501036_0014420
902 Ga0501037_0026419
903 Ga0501039_0030779
904 Ga0501040_0023383
905 Ga0501042_0368706
906 Ga0501043_0130138
907 Ga0501046_0114916
908 Ga0501047_0063412
909 Ga0501047_0081163
910 Ga0501047_0118001
911 Ga0501048_0007923
912 Ga0501067_0000285
913 Ga0501067_0016770
914 Ga0501067_0032558
915 Ga0501069_0002217
916 Ga0501069_0153285
917 Ga0501070_0007274
918 Ga0501070_0010590
919 Ga0501071_0036160
920 Ga0501072_0001083
921 Ga0501072_0028816
922 Ga0501074_0008072
923 Ga0501074_0037963
924 Ga0501074_0042636
925 Ga0501074_0172704
926 Ga0501074_0370962
927 Ga0501075_0005192
928 Ga0501076_0031566
929 Ga0501077_0002003
930 Ga0501077_0066396
931 Ga0501079_0125676
932 Ga0501079_0134572
933 Ga0501079_0289323
934 Ga0501080_0029157
935 Ga0501080_0050853
936 Ga0501080_0133580
937 Ga0501081_0030638
938 Ga0501081_0161196
939 Ga0501083_0000145
940 Ga0501083_0282072
941 Ga0501044_0479047
942 Ga0501045_0016669
943 nmdc:mga08y16_145498_c1
944 nmdc:mga08y16_348398_c1
945 nmdc:mga0a205_68546_c1
946 nmdc:mga0a205_78971_c1
947 Ga0495601_0098507
948 Ga0495655_0006893
949 Ga0495595_0005718
950 Ga0495595_0013729
951 Ga0495619_0019345
952 Ga0495619_0327432
953 Ga0501084_0010155
954 Ga0501084_0097305
955 Ga0501082_0040567
956 Ga0501082_0074282
957 Ga0466962_0000941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07837

FTCD_N

Formiminotransferase domain, N-terminal subdomain

3

164

0.94

PF02971

FTCD

Formiminotransferase domain

166

252

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qd1-assembly1.cif.gz_A the crystal structure of the formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.9417 1 241
1qd1-assembly1.cif.gz_B the crystal structure of the formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.9379 1 241
1qd1-assembly1.cif.gz_A the crystal structure of the formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.8722 1 241
1qd1-assembly1.cif.gz_B the crystal structure of the formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.8687 1 241
7dhq-assembly1.cif.gz_C structure of halothiobacillus neapolitanus microcompartments protein csos1d 0.8214 3 68
ID Description Score Start End Superfamily
1qd1A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Formiminotransferase, C-terminal subdomain 0.9563 169 241 3.30.70.670
2pfdC01 Alpha Beta;2-Layer Sandwich;Formiminotransferase-cyclodeaminase; Chain B, domain 1;Formiminotransferase, N-terminal subdomain 0.9009 1 166 3.30.990.10
af_A0A0P0WRU8_12_147_3.30.990.10 Alpha Beta;2-Layer Sandwich;Formiminotransferase-cyclodeaminase; Chain B, domain 1;Formiminotransferase, N-terminal subdomain 0.869 1 109 3.30.990.10
2pfdC01 Alpha Beta;2-Layer Sandwich;Formiminotransferase-cyclodeaminase; Chain B, domain 1;Formiminotransferase, N-terminal subdomain 0.848 1 166 3.30.990.10
6fdbB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.7985 3 66 3.30.70.1710
ID Description Score Start End GO Terms
AF-A0A538G7L2-F1-model_v4 Glutamate formimidoyltransferase 0.9983 1 73 GO:0005542
GO:0016740
AF-A0A538HFQ0-F1-model_v4 Glutamate formiminotransferase 0.9855 1 80 GO:0005542
GO:0016740
AF-A0A645FH72-F1-model_v4 Glutamate formimidoyltransferase (EC 2.1.2.5) 0.9765 166 241 GO:0005542
GO:0030409
AF-A0A7T8QVX9-F1-model_v4 Formiminotransferase N-terminal subdomain domain-containing protein 0.9729 3 80 GO:0005542
GO:0016740
AF-A0A538G7L2-F1-model_v4 Glutamate formimidoyltransferase 0.9718 1 73 GO:0005542
GO:0016740

Map