F451845

General Info

Members Datasets Scaffolds Average Seq Length
478 288 956 99

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100023323|Ga0070714_1000233235
Length 116
Sequence VSTWALRASSGRTSGMAMFHVVVTRSGPEWQPGRPLEEQTGWGEHAAFMDGLVDAGFVVLGGPLSDECRVVHAVEAESADAIRETLRRDPWSETHLQVESVEPWTIRLDGRDRARG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.67
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 12.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100023323 3300005435 Bacteria 5082
2 Ga0070676_10126741 3300005328 Bacteria 1609
3 Ga0070683_100231968 3300005329 Bacteria 1755
4 Ga0070683_101207076 3300005329 Bacteria 727
5 Ga0070690_100153293 3300005330 Bacteria 1574
6 Ga0070670_100052110 3300005331 Bacteria 3515
7 Ga0068869_100058222 3300005334 Bacteria 2824
8 Ga0070680_100391044 3300005336 Bacteria 1185
9 Ga0070680_100763366 3300005336 Bacteria 833
10 Ga0070680_101713365 3300005336 Bacteria 545
11 Ga0070682_100294320 3300005337 Bacteria 1188
12 Ga0070682_101181524 3300005337 Bacteria 645
13 Ga0068868_100034851 3300005338 Bacteria 3887
14 Ga0070660_100082565 3300005339 Bacteria 2523
15 Ga0070689_100009937 3300005340 Bacteria 6769
16 Ga0070691_10012844 3300005341 Bacteria 3837
17 Ga0070691_10089475 3300005341 Bacteria 1516
18 Ga0070687_100040336 3300005343 Bacteria 2352
19 Ga0070687_100560866 3300005343 Bacteria 779
20 Ga0070661_100192518 3300005344 Bacteria 1556
21 Ga0070668_100335135 3300005347 Bacteria 1277
22 Ga0070669_100812830 3300005353 Bacteria 795
23 Ga0070675_100359665 3300005354 Bacteria 1292
24 Ga0070671_100418329 3300005355 Bacteria 1148
25 Ga0070673_100137705 3300005364 Bacteria 2057
26 Ga0070673_100502464 3300005364 Bacteria 1097
27 Ga0070688_100111252 3300005365 Bacteria 1822
28 Ga0070659_100020617 3300005366 Bacteria 5010
29 Ga0070659_100027126 3300005366 Bacteria 4410
30 Ga0070667_100394565 3300005367 Bacteria 1259
31 Ga0070667_101111729 3300005367 Bacteria 739
32 Ga0070703_10157169 3300005406 Bacteria 859
33 Ga0070714_100186570 3300005435 Bacteria 1890
34 Ga0070714_101199730 3300005435 Unclassified 740
35 Ga0070713_100539206 3300005436 Bacteria 1104
36 Ga0070713_101774269 3300005436 Unclassified 599
37 Ga0070713_102292987 3300005436 Bacteria 522
38 Ga0070710_10181904 3300005437 Bacteria 1317
39 Ga0070711_100099651 3300005439 Bacteria 2111
40 Ga0070711_100122603 3300005439 Bacteria 1925
41 Ga0070705_100313719 3300005440 Bacteria 1129
42 Ga0070700_100053269 3300005441 Bacteria 2524
43 Ga0070694_100343276 3300005444 Bacteria 1155
44 Ga0070694_100938671 3300005444 Bacteria 716
45 Ga0070708_100993763 3300005445 Bacteria 787
46 Ga0070708_101073871 3300005445 Bacteria 754
47 Ga0070708_101095910 3300005445 Unclassified 746
48 Ga0070663_100154040 3300005455 Bacteria 1765
49 Ga0070678_102002417 3300005456 Unclassified 548
50 Ga0070681_10180396 3300005458 Bacteria 2033
51 Ga0068867_100118748 3300005459 Bacteria 2041
52 Ga0070685_10016769 3300005466 Bacteria 3908
53 Ga0070685_10156421 3300005466 Bacteria 1449
54 Ga0070706_100034165 3300005467 Bacteria 4696
55 Ga0070706_100120082 3300005467 Bacteria 2450
56 Ga0070706_100661444 3300005467 Bacteria 969
57 Ga0070706_100771562 3300005467 Archaea 890
58 Ga0070706_100834074 3300005467 Unclassified 853
59 Ga0070707_100002013 3300005468 Bacteria 19454
60 Ga0070707_100161495 3300005468 Bacteria 2183
61 Ga0070707_100304739 3300005468 Bacteria 1548
62 Ga0070698_100057532 3300005471 Bacteria 3934
63 Ga0070698_100123307 3300005471 Bacteria 2549
64 Ga0070698_100237530 3300005471 Bacteria 1755
65 Ga0070698_102047276 3300005471 Bacteria 526
66 Ga0070699_100000077 3300005518 Bacteria 94042
67 Ga0070699_100001229 3300005518 Bacteria 23630
68 Ga0070684_100306913 3300005535 Bacteria 1457
69 Ga0070684_100326246 3300005535 Bacteria 1410
70 Ga0070697_100000025 3300005536 Bacteria 128895
71 Ga0070697_101298649 3300005536 Unclassified 649
72 Ga0070672_100178413 3300005543 Bacteria 1769
73 Ga0070686_100061500 3300005544 Bacteria 2427
74 Ga0070686_100319856 3300005544 Unclassified 1156
75 Ga0070695_100073675 3300005545 Bacteria 2242
76 Ga0070693_100051115 3300005547 Bacteria 2366
77 Ga0068855_100006714 3300005563 Bacteria 13965
78 Ga0068855_100127688 3300005563 Bacteria 2906
79 Ga0070664_100710573 3300005564 Unclassified 937
80 Ga0068857_100481030 3300005577 Bacteria 1163
81 Ga0068857_100779408 3300005577 Bacteria 912
82 Ga0068857_101883196 3300005577 Bacteria 586
83 Ga0068854_100206055 3300005578 Bacteria 1549
84 Ga0068854_100211583 3300005578 Bacteria 1530
85 Ga0068856_100011679 3300005614 Bacteria 8518
86 Ga0070702_100004290 3300005615 Bacteria 6497
87 Ga0068852_100209877 3300005616 Bacteria 1847
88 Ga0068864_100902725 3300005618 Bacteria 873
89 Ga0068864_102122787 3300005618 Unclassified 568
90 Ga0068866_10059444 3300005718 Bacteria 1978
91 Ga0068861_100039528 3300005719 Bacteria 3521
92 Ga0068851_10088919 3300005834 Bacteria 1624
93 Ga0068870_10102224 3300005840 Unclassified 1622
94 Ga0068863_100937679 3300005841 Bacteria 867
95 Ga0068858_100231751 3300005842 Bacteria 1751
96 Ga0068860_101140037 3300005843 Unclassified 799
97 Ga0081455_10005148 3300005937 Bacteria 14402
98 Ga0070717_10001220 3300006028 Bacteria 17453
99 Ga0070717_10012022 3300006028 Bacteria 6592
100 Ga0070717_10806376 3300006028 Unclassified 854
101 Ga0070717_11077792 3300006028 Bacteria 732
102 Ga0070716_100097616 3300006173 Bacteria 1794
103 Ga0070716_101305844 3300006173 Bacteria 587
104 Ga0070712_100370010 3300006175 Bacteria 1177
105 Ga0070712_100773278 3300006175 Unclassified 823
106 Ga0097621_100277861 3300006237 Bacteria 1474
107 Ga0097621_101030287 3300006237 Bacteria 771
108 Ga0075428_100004958 3300006844 Bacteria 14785
109 Ga0075428_102282816 3300006844 Bacteria 557
110 Ga0075431_100101400 3300006847 Bacteria 2970
111 Ga0075433_10134482 3300006852 Bacteria 2198
112 Ga0075433_10203874 3300006852 Bacteria 1758
113 Ga0075433_10558381 3300006852 Bacteria 1006
114 Ga0075434_100002439 3300006871 Bacteria 16357
115 Ga0075434_100058062 3300006871 Bacteria 3846
116 Ga0075434_101034475 3300006871 Bacteria 835
117 Ga0075434_102036433 3300006871 Unclassified 579
118 Ga0075429_100013633 3300006880 Bacteria 7050
119 Ga0068865_100013735 3300006881 Bacteria 5129
120 Ga0068865_100051380 3300006881 Bacteria 2853
121 Ga0068865_100064992 3300006881 Bacteria 2569
122 Ga0075435_100000942 3300007076 Bacteria 18348
123 Ga0075435_100009655 3300007076 Bacteria 7005
124 Ga0105251_10052936 3300009011 Bacteria 1931
125 Ga0105240_10107886 3300009093 Bacteria 3375
126 Ga0105240_10129111 3300009093 Bacteria 3034
127 Ga0111539_10005342 3300009094 Bacteria 16619
128 Ga0111539_10237110 3300009094 Bacteria 2123
129 Ga0111539_11423976 3300009094 Bacteria 804
130 Ga0105245_10032351 3300009098 Bacteria 4630
131 Ga0105245_10221599 3300009098 Bacteria 1825
132 Ga0105245_10805951 3300009098 Bacteria 977
133 Ga0105247_10214448 3300009101 Bacteria 1300
134 Ga0114129_10009199 3300009147 Bacteria 14085
135 Ga0114129_11056885 3300009147 Bacteria 1019
136 Ga0105243_10011925 3300009148 Bacteria 6574
137 Ga0105243_10047118 3300009148 Bacteria 3392
138 Ga0105243_10159729 3300009148 Bacteria 1942
139 Ga0105241_10357083 3300009174 Bacteria 1271
140 Ga0105241_11533639 3300009174 Unclassified 642
141 Ga0105241_11912156 3300009174 Unclassified 582
142 Ga0105242_10067431 3300009176 Bacteria 2958
143 Ga0105242_10154464 3300009176 Bacteria 2004
144 Ga0105248_12159386 3300009177 Unclassified 633
145 Ga0105237_10331271 3300009545 Bacteria 1526
146 Ga0105237_10987297 3300009545 Unclassified 849
147 Ga0105238_10005660 3300009551 Bacteria 12351
148 Ga0105238_10278375 3300009551 Bacteria 1654
149 Ga0105238_10662377 3300009551 Bacteria 1054
150 Ga0105249_10058200 3300009553 Bacteria 3542
151 Ga0105249_12798470 3300009553 Unclassified 559
152 Ga0105239_10061299 3300010375 Bacteria 4128
153 Ga0105239_10073542 3300010375 Bacteria 3757
154 Ga0105239_10410387 3300010375 Bacteria 1533
155 Ga0105239_10573562 3300010375 Bacteria 1286
156 Ga0105246_10014708 3300011119 Bacteria 4926
157 Ga0105246_10034091 3300011119 Bacteria 3388
158 Ga0105246_10350825 3300011119 Unclassified 1209
159 Ga0157371_10416171 3300013102 Bacteria 985
160 Ga0157369_10212499 3300013105 Bacteria 2027
161 Ga0157369_10452943 3300013105 Bacteria 1329
162 Ga0157369_11259507 3300013105 Bacteria 754
163 Ga0157374_10576531 3300013296 Bacteria 1134
164 Ga0157374_11679263 3300013296 Bacteria 660
165 Ga0157374_12232630 3300013296 Bacteria 574
166 Ga0157378_10579827 3300013297 Bacteria 1130
167 Ga0163162_10096108 3300013306 Bacteria 3050
168 Ga0163162_12708590 3300013306 Viruses 571
169 Ga0157372_10085013 3300013307 Bacteria 3588
170 Ga0157372_10178939 3300013307 Bacteria 2455
171 Ga0157372_10672478 3300013307 Unclassified 1205
172 Ga0157375_10058086 3300013308 Bacteria 3826
173 Ga0157375_10108837 3300013308 Bacteria 2867
174 Ga0157375_11477868 3300013308 Bacteria 802
175 Ga0163163_10015196 3300014325 Bacteria 7110
176 Ga0163163_10814122 3300014325 Bacteria 997
177 Ga0163163_10968803 3300014325 Unclassified 914
178 Ga0157380_10065807 3300014326 Bacteria 2914
179 Ga0157380_10106698 3300014326 Unclassified 2344
180 Ga0182008_10110657 3300014497 Bacteria 1361
181 Ga0157377_10076244 3300014745 Unclassified 1950
182 Ga0157379_10745010 3300014968 Bacteria 922
183 Ga0157379_11085611 3300014968 Viruses 766
184 Ga0157376_10060461 3300014969 Bacteria 3182
185 Ga0157376_10635564 3300014969 Bacteria 1066
186 Ga0206350_11549238 3300020080 Unclassified 709
187 Ga0207656_10099056 3300025321 Unclassified 1334
188 Ga0207653_10195513 3300025885 Unclassified 761
189 Ga0207692_10146865 3300025898 Bacteria 1347
190 Ga0207710_10099406 3300025900 Bacteria 1370
191 Ga0207688_10045835 3300025901 Bacteria 2440
192 Ga0207685_10632254 3300025905 Viruses 577
193 Ga0207684_10017244 3300025910 Bacteria 6194
194 Ga0207684_10051082 3300025910 Bacteria 3507
195 Ga0207684_10852034 3300025910 Bacteria 768
196 Ga0207654_10015945 3300025911 Bacteria 3908
197 Ga0207707_10181146 3300025912 Bacteria 1839
198 Ga0207695_10003453 3300025913 Bacteria 22270
199 Ga0207693_10047621 3300025915 Bacteria 3368
200 Ga0207693_10061949 3300025915 Bacteria 2930
201 Ga0207693_10173855 3300025915 Bacteria 1695
202 Ga0207663_10057465 3300025916 Bacteria 2451
203 Ga0207663_10177635 3300025916 Bacteria 1517
204 Ga0207663_10957622 3300025916 Bacteria 686
205 Ga0207660_10171453 3300025917 Bacteria 1680
206 Ga0207660_10769683 3300025917 Bacteria 786
207 Ga0207662_10022756 3300025918 Bacteria 3596
208 Ga0207657_10002052 3300025919 Bacteria 21796
209 Ga0207657_10103737 3300025919 Bacteria 2357
210 Ga0207649_10371567 3300025920 Bacteria 1064
211 Ga0207652_10050466 3300025921 Bacteria 3565
212 Ga0207646_10002761 3300025922 Bacteria 20506
213 Ga0207646_10101236 3300025922 Bacteria 2583
214 Ga0207646_10156264 3300025922 Bacteria 2057
215 Ga0207681_10351768 3300025923 Bacteria 1180
216 Ga0207694_10019180 3300025924 Bacteria 5170
217 Ga0207694_10222667 3300025924 Bacteria 1539
218 Ga0207694_11344496 3300025924 Bacteria 604
219 Ga0207650_10820145 3300025925 Unclassified 789
220 Ga0207650_11082864 3300025925 Bacteria 682
221 Ga0207659_11793884 3300025926 Bacteria 521
222 Ga0207687_10003780 3300025927 Bacteria 10171
223 Ga0207687_10008965 3300025927 Bacteria 6540
224 Ga0207687_11068291 3300025927 Unclassified 693
225 Ga0207700_10277808 3300025928 Bacteria 1440
226 Ga0207700_10479437 3300025928 Unclassified 1099
227 Ga0207700_10707914 3300025928 Bacteria 899
228 Ga0207664_10015837 3300025929 Bacteria 5488
229 Ga0207664_10292045 3300025929 Bacteria 1433
230 Ga0207664_10301231 3300025929 Bacteria 1410
231 Ga0207664_10558806 3300025929 Bacteria 1027
232 Ga0207644_10076280 3300025931 Bacteria 2466
233 Ga0207690_10022706 3300025932 Bacteria 3906
234 Ga0207690_10194646 3300025932 Bacteria 1536
235 Ga0207686_10039020 3300025934 Bacteria 2878
236 Ga0207709_10020507 3300025935 Bacteria 3730
237 Ga0207709_10176171 3300025935 Bacteria 1506
238 Ga0207709_10222292 3300025935 Bacteria 1363
239 Ga0207670_10015161 3300025936 Bacteria 4596
240 Ga0207670_10848227 3300025936 Unclassified 763
241 Ga0207669_10223970 3300025937 Bacteria 1382
242 Ga0207704_10209652 3300025938 Bacteria 1433
243 Ga0207704_10276282 3300025938 Bacteria 1275
244 Ga0207665_10089680 3300025939 Bacteria 2130
245 Ga0207691_10196532 3300025940 Bacteria 1757
246 Ga0207711_10201133 3300025941 Bacteria 1818
247 Ga0207689_10071713 3300025942 Bacteria 2845
248 Ga0207661_10076915 3300025944 Bacteria 2743
249 Ga0207661_10543430 3300025944 Bacteria 1064
250 Ga0207679_10214575 3300025945 Bacteria 1616
251 Ga0207667_10060549 3300025949 Bacteria 3962
252 Ga0207667_10183928 3300025949 Bacteria 2145
253 Ga0207651_10102712 3300025960 Bacteria 2126
254 Ga0207651_10600729 3300025960 Bacteria 962
255 Ga0207651_11195822 3300025960 Unclassified 682
256 Ga0207712_10071358 3300025961 Bacteria 2498
257 Ga0207668_10204704 3300025972 Unclassified 1574
258 Ga0207668_12032062 3300025972 Unclassified 518
259 Ga0207658_10573052 3300025986 Bacteria 1012
260 Ga0207677_10023108 3300026023 Bacteria 3834
261 Ga0207677_10240356 3300026023 Bacteria 1465
262 Ga0207677_10482451 3300026023 Unclassified 1068
263 Ga0207677_11460963 3300026023 Unclassified 631
264 Ga0207677_11631720 3300026023 Bacteria 597
265 Ga0207703_10016616 3300026035 Bacteria 5739
266 Ga0207703_10139752 3300026035 Bacteria 2101
267 Ga0207639_11004629 3300026041 Bacteria 781
268 Ga0207708_10012739 3300026075 Bacteria 6271
269 Ga0207702_10003309 3300026078 Bacteria 14833
270 Ga0207641_10548904 3300026088 Bacteria 1127
271 Ga0207648_10108058 3300026089 Bacteria 2442
272 Ga0207648_10522414 3300026089 Bacteria 1088
273 Ga0207648_10866833 3300026089 Unclassified 842
274 Ga0207676_10967623 3300026095 Bacteria 837
275 Ga0207676_11893918 3300026095 Unclassified 595
276 Ga0207674_10701449 3300026116 Bacteria 977
277 Ga0207675_100303773 3300026118 Bacteria 1555
278 Ga0207683_10125884 3300026121 Bacteria 2303
279 Ga0207683_10279927 3300026121 Bacteria 1524
280 Ga0207698_10064710 3300026142 Bacteria 2868
281 Ga0207698_10085052 3300026142 Bacteria 2566
282 Ga0207428_10040310 3300027907 Bacteria 3789
283 Ga0268264_10071497 3300028381 Bacteria 2940
284 Ga0265326_10023463 3300028558 Bacteria 1763
285 Ga0265319_1053487 3300028563 Bacteria 1326
286 Ga0265334_10037397 3300028573 Bacteria 1913
287 Ga0265318_10001723 3300028577 Bacteria 12521
288 Ga0265323_10048831 3300028653 Unclassified 1508
289 Ga0265322_10027373 3300028654 Bacteria 1629
290 Ga0265338_10111017 3300028800 Bacteria 2208
291 Ga0265330_10028576 3300031235 Bacteria 2511
292 Ga0265332_10051801 3300031238 Unclassified 1762
293 Ga0265328_10143683 3300031239 Bacteria 895
294 Ga0265320_10065346 3300031240 Bacteria 1726
295 Ga0265320_10190056 3300031240 Bacteria 918
296 Ga0265325_10000684 3300031241 Bacteria 24693
297 Ga0265325_10105515 3300031241 Bacteria 1375
298 Ga0265329_10067978 3300031242 Bacteria 1127
299 Ga0265340_10036788 3300031247 Bacteria 2425
300 Ga0265339_10078413 3300031249 Bacteria 1748
301 Ga0265331_10026891 3300031250 Bacteria 2888
302 Ga0265316_10330661 3300031344 Bacteria 1105
303 Ga0265314_10329654 3300031711 Bacteria 846
304 Ga0265342_10183301 3300031712 Bacteria 1145
305 Ga0307416_102313777 3300032002 Bacteria 638
306 Ga0373935_0956049 3300035692 Bacteria 636
307 Ga0373937_1738066 3300036401 Unclassified 570
308 Ga0395899_0488039 3300037312 Bacteria 801
309 Ga0395900_0205185 3300037418 Bacteria 1992
310 Ga0395898_0238302 3300037466 Bacteria 1735
311 Ga0395898_0731890 3300037466 Bacteria 931
312 Ga0395905_0593622 3300037471 Bacteria 1009
313 Ga0436364_0824612 3300037853 Unclassified 956
314 Ga0395901_0128799 3300038443 Bacteria 2660
315 Ga0395901_0269079 3300038443 Bacteria 1773
316 Ga0395901_1900454 3300038443 Bacteria 543
317 Ga0439434_0094843 3300042435 Bacteria 957
318 Ga0466963_0008116 3300044694 Bacteria 6286
319 Ga0466963_0055710 3300044694 Bacteria 2630
320 Ga0466963_0371187 3300044694 Bacteria 1008
321 Ga0466964_0219263 3300044706 Bacteria 923
322 Ga0466968_0124301 3300044735 Bacteria 1170
323 Ga0466959_0080905 3300045049 Bacteria 2341
324 Ga0466958_0980664 3300045836 Unclassified 551
325 Ga0466967_0010621 3300045976 Bacteria 6919
326 Ga0466967_0011808 3300045976 Bacteria 6642
327 Ga0466967_1965704 3300045976 Unclassified 581
328 Ga0495592_0266883 3300046454 Bacteria 1124
329 Ga0495641_0202917 3300046461 Unclassified 889
330 Ga0495605_0126199 3300046474 Bacteria 1157
331 Ga0495605_0399493 3300046474 Bacteria 572
332 Ga0495664_0147094 3300046477 Bacteria 1429
333 Ga0495584_0261386 3300046491 Bacteria 880
334 Ga0495585_0215236 3300046492 Bacteria 972
335 Ga0495596_0199617 3300046500 Bacteria 777
336 Ga0495608_0119753 3300046511 Bacteria 1688
337 Ga0495630_0030748 3300046517 Bacteria 3996
338 Ga0495631_0140781 3300046518 Bacteria 1036
339 Ga0495637_0124934 3300046520 Bacteria 987
340 Ga0495663_0112023 3300046525 Bacteria 907
341 Ga0495642_0023777 3300046528 Bacteria 2421
342 Ga0495652_0149380 3300046529 Bacteria 1828
343 Ga0495652_0569861 3300046529 Bacteria 776
344 Ga0495640_0230198 3300046533 Bacteria 1166
345 Ga0495587_0493610 3300046536 Unclassified 677
346 Ga0495609_0043227 3300046538 Unclassified 2023
347 Ga0495645_0746059 3300046543 Bacteria 591
348 Ga0495656_0096463 3300046615 Bacteria 1361
349 Ga0495656_0404567 3300046615 Bacteria 714
350 Ga0495656_0436131 3300046615 Bacteria 689
351 Ga0495634_0102051 3300046642 Bacteria 1852
352 Ga0495599_0112328 3300046678 Unclassified 1697
353 Ga0495646_0047364 3300046680 Bacteria 2617
354 Ga0495669_0389694 3300046684 Bacteria 675
355 Ga0495670_0101792 3300046691 Bacteria 1480
356 Ga0495671_0510311 3300046692 Bacteria 573
357 Ga0495589_0068946 3300046794 Unclassified 1730
358 Ga0495604_0162295 3300047317 Bacteria 1578
359 Ga0495604_0388389 3300047317 Unclassified 921
360 Ga0495680_0107221 3300047322 Bacteria 2075
361 Ga0495683_0097075 3300047323 Bacteria 1421
362 Ga0495675_0399637 3300047444 Bacteria 801
363 Ga0495677_0055521 3300047445 Bacteria 1462
364 Ga0495684_0364399 3300047471 Bacteria 1023
365 Ga0495602_0837286 3300048088 Unclassified 616
366 Ga0496100_0028160 3300048903 Bacteria 3463
367 Ga0496101_0134935 3300048904 Unclassified 1877
368 Ga0496101_0394522 3300048904 Bacteria 1089
369 Ga0496102_0028626 3300048905 Bacteria 4978
370 Ga0496102_0050145 3300048905 Bacteria 3799
371 Ga0496102_0085088 3300048905 Bacteria 2919
372 Ga0496102_0228459 3300048905 Bacteria 1754
373 Ga0496103_0017664 3300048906 Bacteria 4270
374 Ga0496103_0057922 3300048906 Bacteria 2406
375 Ga0496103_0403023 3300048906 Bacteria 879
376 Ga0496104_0063464 3300048907 Bacteria 3503
377 Ga0496104_1348088 3300048907 Unclassified 616
378 Ga0496105_0018970 3300048908 Bacteria 5542
379 Ga0496105_0203762 3300048908 Bacteria 1614
380 Ga0496105_0392726 3300048908 Bacteria 1102
381 Ga0496105_0727516 3300048908 Unclassified 760
382 Ga0496106_0006407 3300048909 Bacteria 8712
383 Ga0496106_0098027 3300048909 Bacteria 2270
384 Ga0496106_0128041 3300048909 Unclassified 1989
385 Ga0496107_0024610 3300048910 Bacteria 4259
386 Ga0496107_0039450 3300048910 Bacteria 3388
387 Ga0496107_0055376 3300048910 Bacteria 2864
388 Ga0496107_0077851 3300048910 Bacteria 2415
389 Ga0496108_0032590 3300048911 Bacteria 4328
390 Ga0496108_0035845 3300048911 Bacteria 4125
391 Ga0496108_0040339 3300048911 Bacteria 3891
392 Ga0496108_0067843 3300048911 Bacteria 3008
393 Ga0496109_0039537 3300048912 Bacteria 4269
394 Ga0496109_0119664 3300048912 Bacteria 2452
395 Ga0496109_0163866 3300048912 Bacteria 2083
396 Ga0496109_0268428 3300048912 Unclassified 1607
397 Ga0496109_0343391 3300048912 Unclassified 1410
398 Ga0496109_1805748 3300048912 Bacteria 544
399 Ga0496110_0026011 3300048913 Bacteria 5004
400 Ga0496110_0044775 3300048913 Bacteria 3865
401 Ga0496110_0109542 3300048913 Bacteria 2480
402 Ga0496110_0346997 3300048913 Bacteria 1352
403 Ga0496111_0006002 3300048914 Bacteria 7845
404 Ga0496111_0025365 3300048914 Bacteria 4183
405 Ga0496112_0012803 3300048915 Bacteria 7722
406 Ga0496112_0030718 3300048915 Bacteria 5203
407 Ga0496112_0188615 3300048915 Bacteria 2024
408 Ga0496113_0000913 3300048916 Bacteria 15606
409 Ga0496113_0022991 3300048916 Bacteria 4417
410 Ga0496113_0171377 3300048916 Bacteria 1719
411 Ga0496113_0563571 3300048916 Bacteria 913
412 Ga0496114_0058613 3300048917 Bacteria 3215
413 Ga0496115_0015546 3300048918 Bacteria 5775
414 Ga0496115_0017333 3300048918 Bacteria 5504
415 Ga0496115_0144443 3300048918 Bacteria 1963
416 Ga0496115_0869949 3300048918 Bacteria 697
417 Ga0501031_0008253 3300049568 Bacteria 6773
418 Ga0501032_0592604 3300049569 Bacteria 705
419 Ga0501034_1575521 3300049571 Bacteria 530
420 Ga0501036_0001000 3300049572 Bacteria 21363
421 Ga0501037_0020823 3300049573 Bacteria 4842
422 Ga0501038_0023389 3300049574 Bacteria 5525
423 Ga0501039_0004331 3300049575 Bacteria 10704
424 Ga0501040_0001923 3300049576 Bacteria 13352
425 Ga0501041_0000234 3300049577 Bacteria 25828
426 Ga0501042_0001358 3300049578 Bacteria 14341
427 Ga0501043_0234076 3300049579 Bacteria 1418
428 Ga0501043_0296398 3300049579 Bacteria 1237
429 Ga0501046_0207078 3300049580 Bacteria 1457
430 Ga0501048_0003913 3300049582 Bacteria 11315
431 Ga0501067_0002891 3300049583 Bacteria 9451
432 Ga0501067_0674831 3300049583 Bacteria 580
433 Ga0501068_0114926 3300049584 Bacteria 1675
434 Ga0501069_0003301 3300049585 Bacteria 8277
435 Ga0501069_0125748 3300049585 Bacteria 1466
436 Ga0501070_0027442 3300049586 Bacteria 4777
437 Ga0501070_0121609 3300049586 Bacteria 2158
438 Ga0501071_0010469 3300049587 Bacteria 6215
439 Ga0501072_0000398 3300049588 Bacteria 31066
440 Ga0501073_0057999 3300049589 Bacteria 2707
441 Ga0501074_0002675 3300049590 Bacteria 12481
442 Ga0501075_0893491 3300049591 Bacteria 675
443 Ga0501076_0002773 3300049592 Bacteria 12126
444 Ga0501077_0001316 3300049593 Bacteria 14999
445 Ga0501077_0011321 3300049593 Bacteria 5570
446 Ga0501079_0000407 3300049741 Bacteria 27838
447 Ga0501079_0083829 3300049741 Bacteria 2466
448 Ga0501080_0008889 3300049742 Bacteria 9135
449 Ga0501081_0000210 3300049743 Bacteria 28824
450 Ga0501083_0348739 3300049744 Bacteria 962
451 Ga0501035_0241182 3300049822 Bacteria 1537
452 Ga0501044_0124607 3300049823 Bacteria 2575
453 Ga0501045_0158274 3300049824 Bacteria 1685
454 nmdc:mga05p37_2323_c1 3300050507 Bacteria 22135
455 nmdc:mga05p37_793047_c1 3300050507 Bacteria 1037
456 nmdc:mga09592_115597_c1 3300050508 Bacteria 2303
457 nmdc:mga0qj67_1244048_c1 3300050509 Unclassified 578
458 nmdc:mga0qj67_5102_c1 3300050509 Bacteria 9556
459 nmdc:mga06r32_508_c1 3300050510 Bacteria 33514
460 nmdc:mga08y16_531214_c1 3300050511 Bacteria 1192
461 nmdc:mga08y16_6128_c1 3300050511 Bacteria 12609
462 nmdc:mga0n895_1386056_c1 3300050512 Bacteria 672
463 nmdc:mga0n895_3035_c1 3300050512 Bacteria 13359
464 nmdc:mga0n895_627111_c1 3300050512 Bacteria 1076
465 nmdc:mga0rr50_46826_c1 3300050513 Bacteria 3186
466 nmdc:mga0rr50_7877_c1 3300050513 Bacteria 6607
467 nmdc:mga08x19_28981_c1 3300050514 Bacteria 3471
468 nmdc:mga08x19_7186_c1 3300050514 Bacteria 6615
469 nmdc:mga0a205_641849_c1 3300050515 Bacteria 913
470 nmdc:mga0a205_774282_c1 3300050515 Bacteria 808
471 Ga0495601_0305383 3300053077 Bacteria 1036
472 Ga0495655_0032865 3300053083 Bacteria 1273
473 Ga0501084_0000526 3300054114 Bacteria 29269
474 Ga0501084_0578414 3300054114 Unclassified 949
475 Ga0501082_0001275 3300060353 Bacteria 22113
476 Ga0466962_0135728 3300061719 Bacteria 1190
477 Ga0530510_0001078 3300061734 Bacteria 18095
478 Ga0530510_0837107 3300061734 Bacteria 702
479 Ga0070714_100023323
480 Ga0070676_10126741
481 Ga0070683_100231968
482 Ga0070683_101207076
483 Ga0070690_100153293
484 Ga0070670_100052110
485 Ga0068869_100058222
486 Ga0070680_100391044
487 Ga0070680_100763366
488 Ga0070680_101713365
489 Ga0070682_100294320
490 Ga0070682_101181524
491 Ga0068868_100034851
492 Ga0070660_100082565
493 Ga0070689_100009937
494 Ga0070691_10012844
495 Ga0070691_10089475
496 Ga0070687_100040336
497 Ga0070687_100560866
498 Ga0070661_100192518
499 Ga0070668_100335135
500 Ga0070669_100812830
501 Ga0070675_100359665
502 Ga0070671_100418329
503 Ga0070673_100137705
504 Ga0070673_100502464
505 Ga0070688_100111252
506 Ga0070659_100020617
507 Ga0070659_100027126
508 Ga0070667_100394565
509 Ga0070667_101111729
510 Ga0070703_10157169
511 Ga0070714_100186570
512 Ga0070714_101199730
513 Ga0070713_100539206
514 Ga0070713_101774269
515 Ga0070713_102292987
516 Ga0070710_10181904
517 Ga0070711_100099651
518 Ga0070711_100122603
519 Ga0070705_100313719
520 Ga0070700_100053269
521 Ga0070694_100343276
522 Ga0070694_100938671
523 Ga0070708_100993763
524 Ga0070708_101073871
525 Ga0070708_101095910
526 Ga0070663_100154040
527 Ga0070678_102002417
528 Ga0070681_10180396
529 Ga0068867_100118748
530 Ga0070685_10016769
531 Ga0070685_10156421
532 Ga0070706_100034165
533 Ga0070706_100120082
534 Ga0070706_100661444
535 Ga0070706_100771562
536 Ga0070706_100834074
537 Ga0070707_100002013
538 Ga0070707_100161495
539 Ga0070707_100304739
540 Ga0070698_100057532
541 Ga0070698_100123307
542 Ga0070698_100237530
543 Ga0070698_102047276
544 Ga0070699_100000077
545 Ga0070699_100001229
546 Ga0070684_100306913
547 Ga0070684_100326246
548 Ga0070697_100000025
549 Ga0070697_101298649
550 Ga0070672_100178413
551 Ga0070686_100061500
552 Ga0070686_100319856
553 Ga0070695_100073675
554 Ga0070693_100051115
555 Ga0068855_100006714
556 Ga0068855_100127688
557 Ga0070664_100710573
558 Ga0068857_100481030
559 Ga0068857_100779408
560 Ga0068857_101883196
561 Ga0068854_100206055
562 Ga0068854_100211583
563 Ga0068856_100011679
564 Ga0070702_100004290
565 Ga0068852_100209877
566 Ga0068864_100902725
567 Ga0068864_102122787
568 Ga0068866_10059444
569 Ga0068861_100039528
570 Ga0068851_10088919
571 Ga0068870_10102224
572 Ga0068863_100937679
573 Ga0068858_100231751
574 Ga0068860_101140037
575 Ga0081455_10005148
576 Ga0070717_10001220
577 Ga0070717_10012022
578 Ga0070717_10806376
579 Ga0070717_11077792
580 Ga0070716_100097616
581 Ga0070716_101305844
582 Ga0070712_100370010
583 Ga0070712_100773278
584 Ga0097621_100277861
585 Ga0097621_101030287
586 Ga0075428_100004958
587 Ga0075428_102282816
588 Ga0075431_100101400
589 Ga0075433_10134482
590 Ga0075433_10203874
591 Ga0075433_10558381
592 Ga0075434_100002439
593 Ga0075434_100058062
594 Ga0075434_101034475
595 Ga0075434_102036433
596 Ga0075429_100013633
597 Ga0068865_100013735
598 Ga0068865_100051380
599 Ga0068865_100064992
600 Ga0075435_100000942
601 Ga0075435_100009655
602 Ga0105251_10052936
603 Ga0105240_10107886
604 Ga0105240_10129111
605 Ga0111539_10005342
606 Ga0111539_10237110
607 Ga0111539_11423976
608 Ga0105245_10032351
609 Ga0105245_10221599
610 Ga0105245_10805951
611 Ga0105247_10214448
612 Ga0114129_10009199
613 Ga0114129_11056885
614 Ga0105243_10011925
615 Ga0105243_10047118
616 Ga0105243_10159729
617 Ga0105241_10357083
618 Ga0105241_11533639
619 Ga0105241_11912156
620 Ga0105242_10067431
621 Ga0105242_10154464
622 Ga0105248_12159386
623 Ga0105237_10331271
624 Ga0105237_10987297
625 Ga0105238_10005660
626 Ga0105238_10278375
627 Ga0105238_10662377
628 Ga0105249_10058200
629 Ga0105249_12798470
630 Ga0105239_10061299
631 Ga0105239_10073542
632 Ga0105239_10410387
633 Ga0105239_10573562
634 Ga0105246_10014708
635 Ga0105246_10034091
636 Ga0105246_10350825
637 Ga0157371_10416171
638 Ga0157369_10212499
639 Ga0157369_10452943
640 Ga0157369_11259507
641 Ga0157374_10576531
642 Ga0157374_11679263
643 Ga0157374_12232630
644 Ga0157378_10579827
645 Ga0163162_10096108
646 Ga0163162_12708590
647 Ga0157372_10085013
648 Ga0157372_10178939
649 Ga0157372_10672478
650 Ga0157375_10058086
651 Ga0157375_10108837
652 Ga0157375_11477868
653 Ga0163163_10015196
654 Ga0163163_10814122
655 Ga0163163_10968803
656 Ga0157380_10065807
657 Ga0157380_10106698
658 Ga0182008_10110657
659 Ga0157377_10076244
660 Ga0157379_10745010
661 Ga0157379_11085611
662 Ga0157376_10060461
663 Ga0157376_10635564
664 Ga0206350_11549238
665 Ga0207656_10099056
666 Ga0207653_10195513
667 Ga0207692_10146865
668 Ga0207710_10099406
669 Ga0207688_10045835
670 Ga0207685_10632254
671 Ga0207684_10017244
672 Ga0207684_10051082
673 Ga0207684_10852034
674 Ga0207654_10015945
675 Ga0207707_10181146
676 Ga0207695_10003453
677 Ga0207693_10047621
678 Ga0207693_10061949
679 Ga0207693_10173855
680 Ga0207663_10057465
681 Ga0207663_10177635
682 Ga0207663_10957622
683 Ga0207660_10171453
684 Ga0207660_10769683
685 Ga0207662_10022756
686 Ga0207657_10002052
687 Ga0207657_10103737
688 Ga0207649_10371567
689 Ga0207652_10050466
690 Ga0207646_10002761
691 Ga0207646_10101236
692 Ga0207646_10156264
693 Ga0207681_10351768
694 Ga0207694_10019180
695 Ga0207694_10222667
696 Ga0207694_11344496
697 Ga0207650_10820145
698 Ga0207650_11082864
699 Ga0207659_11793884
700 Ga0207687_10003780
701 Ga0207687_10008965
702 Ga0207687_11068291
703 Ga0207700_10277808
704 Ga0207700_10479437
705 Ga0207700_10707914
706 Ga0207664_10015837
707 Ga0207664_10292045
708 Ga0207664_10301231
709 Ga0207664_10558806
710 Ga0207644_10076280
711 Ga0207690_10022706
712 Ga0207690_10194646
713 Ga0207686_10039020
714 Ga0207709_10020507
715 Ga0207709_10176171
716 Ga0207709_10222292
717 Ga0207670_10015161
718 Ga0207670_10848227
719 Ga0207669_10223970
720 Ga0207704_10209652
721 Ga0207704_10276282
722 Ga0207665_10089680
723 Ga0207691_10196532
724 Ga0207711_10201133
725 Ga0207689_10071713
726 Ga0207661_10076915
727 Ga0207661_10543430
728 Ga0207679_10214575
729 Ga0207667_10060549
730 Ga0207667_10183928
731 Ga0207651_10102712
732 Ga0207651_10600729
733 Ga0207651_11195822
734 Ga0207712_10071358
735 Ga0207668_10204704
736 Ga0207668_12032062
737 Ga0207658_10573052
738 Ga0207677_10023108
739 Ga0207677_10240356
740 Ga0207677_10482451
741 Ga0207677_11460963
742 Ga0207677_11631720
743 Ga0207703_10016616
744 Ga0207703_10139752
745 Ga0207639_11004629
746 Ga0207708_10012739
747 Ga0207702_10003309
748 Ga0207641_10548904
749 Ga0207648_10108058
750 Ga0207648_10522414
751 Ga0207648_10866833
752 Ga0207676_10967623
753 Ga0207676_11893918
754 Ga0207674_10701449
755 Ga0207675_100303773
756 Ga0207683_10125884
757 Ga0207683_10279927
758 Ga0207698_10064710
759 Ga0207698_10085052
760 Ga0207428_10040310
761 Ga0268264_10071497
762 Ga0265326_10023463
763 Ga0265319_1053487
764 Ga0265334_10037397
765 Ga0265318_10001723
766 Ga0265323_10048831
767 Ga0265322_10027373
768 Ga0265338_10111017
769 Ga0265330_10028576
770 Ga0265332_10051801
771 Ga0265328_10143683
772 Ga0265320_10065346
773 Ga0265320_10190056
774 Ga0265325_10000684
775 Ga0265325_10105515
776 Ga0265329_10067978
777 Ga0265340_10036788
778 Ga0265339_10078413
779 Ga0265331_10026891
780 Ga0265316_10330661
781 Ga0265314_10329654
782 Ga0265342_10183301
783 Ga0307416_102313777
784 Ga0373935_0956049
785 Ga0373937_1738066
786 Ga0395899_0488039
787 Ga0395900_0205185
788 Ga0395898_0238302
789 Ga0395898_0731890
790 Ga0395905_0593622
791 Ga0436364_0824612
792 Ga0395901_0128799
793 Ga0395901_0269079
794 Ga0395901_1900454
795 Ga0439434_0094843
796 Ga0466963_0008116
797 Ga0466963_0055710
798 Ga0466963_0371187
799 Ga0466964_0219263
800 Ga0466968_0124301
801 Ga0466959_0080905
802 Ga0466958_0980664
803 Ga0466967_0010621
804 Ga0466967_0011808
805 Ga0466967_1965704
806 Ga0495592_0266883
807 Ga0495641_0202917
808 Ga0495605_0126199
809 Ga0495605_0399493
810 Ga0495664_0147094
811 Ga0495584_0261386
812 Ga0495585_0215236
813 Ga0495596_0199617
814 Ga0495608_0119753
815 Ga0495630_0030748
816 Ga0495631_0140781
817 Ga0495637_0124934
818 Ga0495663_0112023
819 Ga0495642_0023777
820 Ga0495652_0149380
821 Ga0495652_0569861
822 Ga0495640_0230198
823 Ga0495587_0493610
824 Ga0495609_0043227
825 Ga0495645_0746059
826 Ga0495656_0096463
827 Ga0495656_0404567
828 Ga0495656_0436131
829 Ga0495634_0102051
830 Ga0495599_0112328
831 Ga0495646_0047364
832 Ga0495669_0389694
833 Ga0495670_0101792
834 Ga0495671_0510311
835 Ga0495589_0068946
836 Ga0495604_0162295
837 Ga0495604_0388389
838 Ga0495680_0107221
839 Ga0495683_0097075
840 Ga0495675_0399637
841 Ga0495677_0055521
842 Ga0495684_0364399
843 Ga0495602_0837286
844 Ga0496100_0028160
845 Ga0496101_0134935
846 Ga0496101_0394522
847 Ga0496102_0028626
848 Ga0496102_0050145
849 Ga0496102_0085088
850 Ga0496102_0228459
851 Ga0496103_0017664
852 Ga0496103_0057922
853 Ga0496103_0403023
854 Ga0496104_0063464
855 Ga0496104_1348088
856 Ga0496105_0018970
857 Ga0496105_0203762
858 Ga0496105_0392726
859 Ga0496105_0727516
860 Ga0496106_0006407
861 Ga0496106_0098027
862 Ga0496106_0128041
863 Ga0496107_0024610
864 Ga0496107_0039450
865 Ga0496107_0055376
866 Ga0496107_0077851
867 Ga0496108_0032590
868 Ga0496108_0035845
869 Ga0496108_0040339
870 Ga0496108_0067843
871 Ga0496109_0039537
872 Ga0496109_0119664
873 Ga0496109_0163866
874 Ga0496109_0268428
875 Ga0496109_0343391
876 Ga0496109_1805748
877 Ga0496110_0026011
878 Ga0496110_0044775
879 Ga0496110_0109542
880 Ga0496110_0346997
881 Ga0496111_0006002
882 Ga0496111_0025365
883 Ga0496112_0012803
884 Ga0496112_0030718
885 Ga0496112_0188615
886 Ga0496113_0000913
887 Ga0496113_0022991
888 Ga0496113_0171377
889 Ga0496113_0563571
890 Ga0496114_0058613
891 Ga0496115_0015546
892 Ga0496115_0017333
893 Ga0496115_0144443
894 Ga0496115_0869949
895 Ga0501031_0008253
896 Ga0501032_0592604
897 Ga0501034_1575521
898 Ga0501036_0001000
899 Ga0501037_0020823
900 Ga0501038_0023389
901 Ga0501039_0004331
902 Ga0501040_0001923
903 Ga0501041_0000234
904 Ga0501042_0001358
905 Ga0501043_0234076
906 Ga0501043_0296398
907 Ga0501046_0207078
908 Ga0501048_0003913
909 Ga0501067_0002891
910 Ga0501067_0674831
911 Ga0501068_0114926
912 Ga0501069_0003301
913 Ga0501069_0125748
914 Ga0501070_0027442
915 Ga0501070_0121609
916 Ga0501071_0010469
917 Ga0501072_0000398
918 Ga0501073_0057999
919 Ga0501074_0002675
920 Ga0501075_0893491
921 Ga0501076_0002773
922 Ga0501077_0001316
923 Ga0501077_0011321
924 Ga0501079_0000407
925 Ga0501079_0083829
926 Ga0501080_0008889
927 Ga0501081_0000210
928 Ga0501083_0348739
929 Ga0501035_0241182
930 Ga0501044_0124607
931 Ga0501045_0158274
932 nmdc:mga05p37_2323_c1
933 nmdc:mga05p37_793047_c1
934 nmdc:mga09592_115597_c1
935 nmdc:mga0qj67_1244048_c1
936 nmdc:mga0qj67_5102_c1
937 nmdc:mga06r32_508_c1
938 nmdc:mga08y16_531214_c1
939 nmdc:mga08y16_6128_c1
940 nmdc:mga0n895_1386056_c1
941 nmdc:mga0n895_3035_c1
942 nmdc:mga0n895_627111_c1
943 nmdc:mga0rr50_46826_c1
944 nmdc:mga0rr50_7877_c1
945 nmdc:mga08x19_28981_c1
946 nmdc:mga08x19_7186_c1
947 nmdc:mga0a205_641849_c1
948 nmdc:mga0a205_774282_c1
949 Ga0495601_0305383
950 Ga0495655_0032865
951 Ga0501084_0000526
952 Ga0501084_0578414
953 Ga0501082_0001275
954 Ga0466962_0135728
955 Ga0530510_0001078
956 Ga0530510_0837107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.75 1 96
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7492 1 96
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.7456 1 96
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7416 1 96
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.7409 2 96
ID Description Score Start End Superfamily
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7336 1 96 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7155 1 96 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7141 1 96 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7087 1 96 3.30.70.1060
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.6978 2 85 3.30.70.3090
ID Description Score Start End GO Terms
AF-A0A7V9KZF9-F1-model_v4 YCII-related domain-containing protein 0.9863 2 87
AF-A0A538IJE2-F1-model_v4 YCII-related domain-containing protein 0.9615 2 93
AF-A0A538CP83-F1-model_v4 YCII-related domain-containing protein 0.9548 1 94
AF-A0A0K1QG02-F1-model_v4 Muconolactone isomerase domain-containing protein 0.9485 26 74
AF-A0A1N5ZKK8-F1-model_v4 YCII-related domain-containing protein 0.9462 2 95

Map