F451828

General Info

Members Datasets Scaffolds Average Seq Length
478 251 417 286

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10000113|rootH2_1000011320
Length 331
Sequence LPAIKAACEKTGSSTSDVAQLGIGLNFELVSQMDWIMPQRPFKQVDVFTRTPFKGNPLAVVLDGEGLSAEAMQGIARWTNLSETAFVFPSAVPEADYSVRIFATDKEFMFAGHPTLGTAHALLEAGLQPRTPGRLVQHCGVGLVTIEIGEDGSLAFQAPPVNIDAFDESLRPLLAKALRSEAWHVQLLPAQVEMGNRWLVVGLTDAQACLDVVPDAGAMQELLERSSLHGVAVFGFYRETGPADIEVRTFLVEQGALVEDPVTGSANGCIAWLLEAQGMMGEAVGRARYIARQGTRLQRHGLLMVTYRGQTPWVGGHSTTLIQGVIAADRH

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
9 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
14 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
15 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
16 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
17 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
18 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
19 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
20 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
21 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
22 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
23 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
24 2738541297 Duganella sp. GV083 Isolate Unclassified
25 2738541357 Duganella sp. GV053 Isolate Unclassified
26 2738543003 Duganella sp. GV066 Isolate Unclassified
27 2738543026 Duganella sp. GV089 Isolate Unclassified
28 2738543029 Duganella sp. GV039 Isolate Unclassified
29 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
30 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
31 2847085930 Erwinia persicina B64 Isolate Bulb
32 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
33 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
34 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
35 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
36 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
37 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
38 2857558681 Duganella sp. R-74565 Isolate Unclassified
39 2857564685 Duganella sp. R-74599 Isolate Unclassified
40 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
41 2865014394 Pantoea sp. R-71966 Isolate Unclassified
42 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
43 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
44 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
45 2876601092 Pantoea endophytica 596 Isolate Unclassified
46 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
47 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
48 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
49 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
50 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
51 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
52 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
53 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
54 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
55 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
56 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
57 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
127 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
128 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
135 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
136 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
137 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
138 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
217 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
248 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
249 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
250 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
251 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.24
Metatranscriptomes 0
Isolates 12.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0.21
Endosphere 3.77
Nodule 0.84
Rhizoplane 7.53
Rhizosphere 65.27
Stem 0
Stem Tuber 1.26
Unclassified 20.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000017 3300001989 Bacteria 48831
2 rootH2_10000113 3300003320 Bacteria 75503
3 rootH2_10114353 3300003320 Bacteria 1302
4 rootL2_10027677 3300003322 Bacteria 9529
5 rootL2_10159956 3300003322 Bacteria 2661
6 rootL2_10286704 3300003322 Bacteria 1420
7 JGI25160J50197_1000057 3300003354 Bacteria 118983
8 Ga0055524_1000668 3300003775 Bacteria 24115
9 Ga0058692_1000171 3300003856 Bacteria 40209
10 Ga0058692_1000368 3300003856 Bacteria 21725
11 Ga0058692_1000415 3300003856 Bacteria 19761
12 Ga0058692_1001444 3300003856 Bacteria 8752
13 Ga0058692_1006302 3300003856 Bacteria 3278
14 Ga0058692_1011151 3300003856 Bacteria 2188
15 Ga0065165_1000448 3300005262 Bacteria 64666
16 Ga0070658_10000871 3300005327 Bacteria 25797
17 Ga0070666_10173376 3300005335 Bacteria 1511
18 Ga0070667_100092516 3300005367 Bacteria 2602
19 Ga0070705_100090196 3300005440 Bacteria 1907
20 Ga0070694_100077884 3300005444 Bacteria 2298
21 Ga0070663_100199640 3300005455 Bacteria 1560
22 Ga0070663_100347359 3300005455 Bacteria 1200
23 Ga0070663_100403144 3300005455 Bacteria 1118
24 Ga0070662_100075834 3300005457 Bacteria 2491
25 Ga0070681_10165106 3300005458 Bacteria 2137
26 Ga0068867_100037265 3300005459 Bacteria 3535
27 Ga0068867_100362731 3300005459 Bacteria 1212
28 Ga0070699_100010039 3300005518 Bacteria 8196
29 Ga0070684_100557980 3300005535 Bacteria 1063
30 Ga0070695_100019944 3300005545 Bacteria 4088
31 Ga0070665_100091260 3300005548 Bacteria 3051
32 Ga0068855_100005220 3300005563 Bacteria 15844
33 Ga0068857_100021637 3300005577 Bacteria 5659
34 Ga0081455_10003200 3300005937 Bacteria 18964
35 Ga0081539_10002201 3300005985 Bacteria 28507
36 Ga0070717_10036847 3300006028 Bacteria 3969
37 Ga0075364_10026839 3300006051 Bacteria 3676
38 Ga0075364_10121214 3300006051 Bacteria 1750
39 Ga0075370_10020024 3300006353 Bacteria 3650
40 Ga0105251_10000501 3300009011 Bacteria 37116
41 Ga0105251_10000744 3300009011 Bacteria 29738
42 Ga0105251_10001022 3300009011 Bacteria 24543
43 Ga0105251_10053736 3300009011 Bacteria 1914
44 Ga0105244_10000379 3300009036 Bacteria 41302
45 Ga0105244_10000512 3300009036 Bacteria 34678
46 Ga0105244_10001102 3300009036 Bacteria 22424
47 Ga0105244_10007929 3300009036 Bacteria 6691
48 Ga0105244_10074666 3300009036 Bacteria 1686
49 Ga0105244_10134394 3300009036 Bacteria 1192
50 Ga0105244_10178515 3300009036 Bacteria 1008
51 Ga0105250_10008401 3300009092 Bacteria 4386
52 Ga0105250_10024985 3300009092 Bacteria 2407
53 Ga0105240_10002446 3300009093 Bacteria 29863
54 Ga0105240_10002659 3300009093 Bacteria 28427
55 Ga0105240_10012980 3300009093 Bacteria 11475
56 Ga0105240_10123177 3300009093 Bacteria 3120
57 Ga0105247_10000128 3300009101 Bacteria 73288
58 Ga0114129_10494396 3300009147 Bacteria 1598
59 Ga0105243_10159787 3300009148 Bacteria 1942
60 Ga0105248_10014325 3300009177 Bacteria 8727
61 Ga0105248_10341912 3300009177 Bacteria 1684
62 Ga0105248_10396172 3300009177 Bacteria 1555
63 Ga0105239_10000056 3300010375 Bacteria 157615
64 Ga0105246_10024628 3300011119 Bacteria 3912
65 Ga0105246_10053137 3300011119 Bacteria 2787
66 Ga0105246_10064061 3300011119 Bacteria 2567
67 Ga0105246_10127901 3300011119 Bacteria 1893
68 Ga0157373_10000189 3300013100 Bacteria 50406
69 Ga0157373_10001330 3300013100 Bacteria 18924
70 Ga0157373_10014529 3300013100 Bacteria 5770
71 Ga0157373_10070842 3300013100 Bacteria 2463
72 Ga0157371_10000791 3300013102 Bacteria 36344
73 Ga0157371_10001117 3300013102 Bacteria 29083
74 Ga0157371_10004213 3300013102 Bacteria 12659
75 Ga0157370_10000789 3300013104 Bacteria 39816
76 Ga0157370_10006599 3300013104 Bacteria 12761
77 Ga0157370_10287622 3300013104 Bacteria 1518
78 Ga0157369_10015594 3300013105 Bacteria 8564
79 Ga0163162_10014549 3300013306 Bacteria 7689
80 Ga0163162_10195030 3300013306 Bacteria 2154
81 Ga0157372_10050484 3300013307 Bacteria 4627
82 Ga0157372_10056822 3300013307 Bacteria 4373
83 Ga0157372_10070674 3300013307 Bacteria 3928
84 Ga0157372_10077074 3300013307 Bacteria 3764
85 Ga0157372_10089397 3300013307 Bacteria 3499
86 Ga0157372_10543415 3300013307 Bacteria 1354
87 Ga0157375_10074784 3300013308 Bacteria 3410
88 Ga0157375_10197159 3300013308 Bacteria 2169
89 Ga0157380_10159525 3300014326 Bacteria 1959
90 Ga0183365_10001 3300015684 Bacteria 2090444
91 Ga0163161_10128225 3300017792 Bacteria 1912
92 Ga0209437_100322 3300025233 Bacteria 61805
93 Ga0209564_1016672 3300025295 Bacteria 2906
94 Ga0207426_1000168 3300025302 Bacteria 165214
95 Ga0207696_1000390 3300025711 Bacteria 41986
96 Ga0207696_1000627 3300025711 Bacteria 25917
97 Ga0207696_1008271 3300025711 Bacteria 4000
98 Ga0207655_1000029 3300025728 Bacteria 432187
99 Ga0207655_1000064 3300025728 Bacteria 255782
100 Ga0207655_1000130 3300025728 Bacteria 148370
101 Ga0207655_1003437 3300025728 Bacteria 11787
102 Ga0207655_1020667 3300025728 Bacteria 3372
103 Ga0207655_1061196 3300025728 Bacteria 1455
104 Ga0207713_1000016 3300025735 Bacteria 421689
105 Ga0207713_1000043 3300025735 Bacteria 241808
106 Ga0207713_1002911 3300025735 Bacteria 11986
107 Ga0207713_1006250 3300025735 Bacteria 7291
108 Ga0207713_1010785 3300025735 Bacteria 5032
109 Ga0207710_10000224 3300025900 Bacteria 49005
110 Ga0207680_10155892 3300025903 Bacteria 1527
111 Ga0207705_10000850 3300025909 Bacteria 25052
112 Ga0207707_10510188 3300025912 Bacteria 1025
113 Ga0207695_10000663 3300025913 Bacteria 67900
114 Ga0207695_10020759 3300025913 Bacteria 7514
115 Ga0207695_10042791 3300025913 Bacteria 4832
116 Ga0207695_10047859 3300025913 Bacteria 4521
117 Ga0207695_10061109 3300025913 Bacteria 3895
118 Ga0207671_10092309 3300025914 Bacteria 2282
119 Ga0207706_10095026 3300025933 Bacteria 2622
120 Ga0207711_10018390 3300025941 Bacteria 5809
121 Ga0207711_10182630 3300025941 Bacteria 1908
122 Ga0207711_10330829 3300025941 Bacteria 1409
123 Ga0207667_10001157 3300025949 Bacteria 33139
124 Ga0207668_10031758 3300025972 Bacteria 3482
125 Ga0207658_10070294 3300025986 Bacteria 2648
126 Ga0207678_10044083 3300026067 Bacteria 3860
127 Ga0207678_10141726 3300026067 Bacteria 2051
128 Ga0207678_10290949 3300026067 Bacteria 1403
129 Ga0207648_10300109 3300026089 Bacteria 1440
130 Ga0209371_1000061 3300027312 Bacteria 223014
131 Ga0209371_1000082 3300027312 Bacteria 184560
132 Ga0209371_1000138 3300027312 Bacteria 120551
133 Ga0209371_1000339 3300027312 Bacteria 51185
134 Ga0209371_1000417 3300027312 Bacteria 43898
135 Ga0209371_1001123 3300027312 Bacteria 19743
136 Ga0209371_1010995 3300027312 Bacteria 2726
137 Ga0209371_1012568 3300027312 Bacteria 2437
138 Ga0209371_1023467 3300027312 Bacteria 1452
139 Ga0265338_10000302 3300028800 Bacteria 89074
140 Ga0268256_1000059 3300030500 Bacteria 223875
141 Ga0268256_1000072 3300030500 Bacteria 184436
142 Ga0268256_1000202 3300030500 Bacteria 67837
143 Ga0268256_1000290 3300030500 Bacteria 51185
144 Ga0268256_1000587 3300030500 Bacteria 29060
145 Ga0268256_1013721 3300030500 Bacteria 2437
146 Ga0316177_1084263 3300030731 Bacteria 1328
147 Ga0316178_1036040 3300030735 Bacteria 1805
148 Ga0316180_1023907 3300030736 Bacteria 3794
149 Ga0307414_10075520 3300032004 Bacteria 2446
150 Ga0395899_0000038 3300037312 Bacteria 272627
151 Ga0395900_0000268 3300037418 Bacteria 80910
152 Ga0395905_0000455 3300037471 Bacteria 57161
153 Ga0395901_0000002 3300038443 Bacteria 761045
154 Ga0439438_000040 3300041405 Bacteria 65293
155 Ga0439438_001995 3300041405 Bacteria 8921
156 Ga0439438_011159 3300041405 Bacteria 2810
157 Ga0439447_004552 3300041407 Bacteria 4744
158 Ga0439447_006210 3300041407 Bacteria 3895
159 Ga0439466_0000079 3300041411 Bacteria 37067
160 Ga0439431_0041720 3300041997 Bacteria 1171
161 Ga0439432_000264 3300042006 Bacteria 18796
162 Ga0439432_001143 3300042006 Bacteria 10057
163 Ga0439432_038852 3300042006 Bacteria 1514
164 Ga0439452_000026 3300042010 Bacteria 223971
165 Ga0439463_006612 3300042016 Bacteria 2870
166 Ga0450907_000255 3300042146 Bacteria 18164
167 Ga0439464_0003162 3300042439 Bacteria 4130
168 Ga0466969_0019691 3300044656 Bacteria 3504
169 Ga0466966_0001002 3300044684 Bacteria 18015
170 Ga0466961_0000245 3300044693 Bacteria 36547
171 Ga0466961_0035494 3300044693 Bacteria 3202
172 Ga0466963_0005922 3300044694 Bacteria 7198
173 Ga0466971_0024769 3300044719 Bacteria 2678
174 Ga0466957_0146301 3300044842 Bacteria 1526
175 Ga0466957_0377186 3300044842 Bacteria 966
176 Ga0466967_0824281 3300045976 Bacteria 922
177 Ga0495617_000020 3300046452 Bacteria 230257
178 Ga0495617_014995 3300046452 Bacteria 2630
179 Ga0495627_000145 3300046453 Bacteria 84853
180 Ga0495627_036240 3300046453 Bacteria 1534
181 Ga0495603_0021640 3300046455 Bacteria 3895
182 Ga0495603_0048120 3300046455 Bacteria 2539
183 Ga0495590_0000012 3300046457 Bacteria 303377
184 Ga0495591_000111 3300046458 Bacteria 93733
185 Ga0495591_001076 3300046458 Bacteria 18246
186 Ga0495591_040836 3300046458 Bacteria 1320
187 Ga0495629_0000115 3300046459 Bacteria 72648
188 Ga0495638_0000304 3300046460 Bacteria 63367
189 Ga0495638_0006519 3300046460 Bacteria 8489
190 Ga0495653_0000082 3300046463 Bacteria 80285
191 Ga0495653_0041252 3300046463 Bacteria 3603
192 Ga0495650_0000001 3300046471 Bacteria 1085492
193 Ga0495650_0000380 3300046471 Bacteria 76955
194 Ga0495650_0000462 3300046471 Bacteria 63149
195 Ga0495650_0001729 3300046471 Bacteria 19982
196 Ga0495650_0005383 3300046471 Bacteria 8327
197 Ga0495580_0020322 3300046472 Bacteria 4916
198 Ga0495605_0011371 3300046474 Bacteria 4967
199 Ga0495605_0033803 3300046474 Bacteria 2593
200 Ga0495605_0034124 3300046474 Bacteria 2578
201 Ga0495664_0062889 3300046477 Bacteria 2211
202 Ga0495584_0002094 3300046491 Bacteria 11446
203 Ga0495585_0000424 3300046492 Bacteria 40738
204 Ga0495585_0007280 3300046492 Bacteria 6794
205 Ga0495596_0000698 3300046500 Bacteria 20825
206 Ga0495607_0005675 3300046501 Bacteria 8890
207 Ga0495607_0054413 3300046501 Bacteria 2306
208 Ga0495583_0000044 3300046506 Bacteria 226264
209 Ga0495583_0021963 3300046506 Bacteria 3270
210 Ga0495606_0000075 3300046507 Bacteria 170038
211 Ga0495606_0002690 3300046507 Bacteria 20099
212 Ga0495606_0007172 3300046507 Bacteria 10061
213 Ga0495606_0008151 3300046507 Bacteria 9176
214 Ga0495610_0000014 3300046512 Bacteria 444708
215 Ga0495610_0000872 3300046512 Bacteria 28180
216 Ga0495610_0002983 3300046512 Bacteria 13645
217 Ga0495610_0051889 3300046512 Bacteria 1993
218 Ga0495616_0029691 3300046513 Bacteria 2884
219 Ga0495616_0051587 3300046513 Bacteria 2051
220 Ga0495637_0001932 3300046520 Bacteria 11754
221 Ga0495643_0000387 3300046522 Bacteria 58350
222 Ga0495643_0001204 3300046522 Bacteria 25093
223 Ga0495643_0116539 3300046522 Bacteria 1353
224 Ga0495644_0004261 3300046523 Bacteria 5616
225 Ga0495648_0000006 3300046524 Bacteria 361208
226 Ga0495648_0001083 3300046524 Bacteria 27678
227 Ga0495648_0003278 3300046524 Bacteria 14318
228 Ga0495648_0006600 3300046524 Bacteria 9426
229 Ga0495648_0014270 3300046524 Bacteria 5825
230 Ga0495648_0018753 3300046524 Bacteria 4884
231 Ga0495654_0000022 3300046530 Bacteria 260104
232 Ga0495654_0000170 3300046530 Bacteria 64005
233 Ga0495654_0000183 3300046530 Bacteria 61398
234 Ga0495654_0000250 3300046530 Bacteria 49614
235 Ga0495654_0064567 3300046530 Bacteria 1750
236 Ga0495609_0006605 3300046538 Bacteria 5899
237 Ga0495597_0000909 3300046542 Bacteria 22976
238 Ga0495622_0000511 3300046557 Bacteria 23882
239 Ga0495633_0000221 3300046558 Bacteria 70459
240 Ga0495633_0001101 3300046558 Bacteria 21797
241 Ga0495633_0004184 3300046558 Bacteria 9259
242 Ga0495633_0008773 3300046558 Bacteria 5655
243 Ga0495668_0000579 3300046616 Bacteria 44604
244 Ga0495668_0001259 3300046616 Bacteria 25237
245 Ga0495625_0000160 3300046660 Bacteria 104165
246 Ga0495671_0000005 3300046692 Bacteria 509397
247 Ga0495671_0058389 3300046692 Bacteria 1909
248 Ga0495671_0067600 3300046692 Bacteria 1757
249 Ga0495649_0000846 3300046694 Bacteria 24578
250 Ga0495649_0025301 3300046694 Bacteria 3306
251 Ga0495649_0037677 3300046694 Bacteria 2654
252 Ga0495589_0020375 3300046794 Bacteria 3391
253 Ga0495660_0000058 3300046810 Bacteria 133170
254 Ga0495660_0033519 3300046810 Bacteria 2879
255 Ga0495674_0010288 3300047319 Bacteria 8856
256 Ga0495674_0038905 3300047319 Bacteria 4265
257 Ga0495672_0000040 3300047320 Bacteria 268573
258 Ga0495672_0000075 3300047320 Bacteria 175957
259 Ga0495672_0000106 3300047320 Bacteria 132815
260 Ga0495672_0001554 3300047320 Bacteria 22467
261 Ga0495672_0023076 3300047320 Bacteria 4034
262 Ga0495683_0019720 3300047323 Bacteria 3480
263 Ga0495683_0021945 3300047323 Bacteria 3286
264 Ga0495683_0090331 3300047323 Bacteria 1484
265 Ga0495687_000015 3300047443 Bacteria 365627
266 Ga0495687_000547 3300047443 Bacteria 44844
267 Ga0495687_000758 3300047443 Bacteria 34926
268 Ga0495679_009027 3300047446 Bacteria 4016
269 Ga0495679_030066 3300047446 Bacteria 1766
270 Ga0495673_0000009 3300047469 Bacteria 731993
271 Ga0495673_0000012 3300047469 Bacteria 656908
272 Ga0495673_0000113 3300047469 Bacteria 163495
273 Ga0495673_0000371 3300047469 Bacteria 53983
274 Ga0495673_0022091 3300047469 Bacteria 3124
275 Ga0495673_0066995 3300047469 Bacteria 1521
276 Ga0495686_0000826 3300047472 Bacteria 39862
277 Ga0495686_0016451 3300047472 Bacteria 5015
278 Ga0495686_0160531 3300047472 Bacteria 1314
279 Ga0495686_0169694 3300047472 Bacteria 1269
280 Ga0496100_0001306 3300048903 Bacteria 12171
281 Ga0496100_0041145 3300048903 Bacteria 2944
282 Ga0496100_0044411 3300048903 Bacteria 2846
283 Ga0496101_0000164 3300048904 Bacteria 56560
284 Ga0496101_0056767 3300048904 Bacteria 2830
285 Ga0496101_0145196 3300048904 Bacteria 1811
286 Ga0496101_0197661 3300048904 Bacteria 1553
287 Ga0496101_0218946 3300048904 Bacteria 1477
288 Ga0496102_0001984 3300048905 Bacteria 17671
289 Ga0496102_0006344 3300048905 Bacteria 10082
290 Ga0496102_0063494 3300048905 Bacteria 3382
291 Ga0496102_0318879 3300048905 Bacteria 1464
292 Ga0496102_0584905 3300048905 Bacteria 1039
293 Ga0496103_0001615 3300048906 Bacteria 14789
294 Ga0496103_0049224 3300048906 Bacteria 2606
295 Ga0496103_0202102 3300048906 Bacteria 1278
296 Ga0496104_0051536 3300048907 Bacteria 3884
297 Ga0496104_0376839 3300048907 Bacteria 1331
298 Ga0496105_0037307 3300048908 Bacteria 4002
299 Ga0496105_0056989 3300048908 Bacteria 3226
300 Ga0496105_0089911 3300048908 Bacteria 2536
301 Ga0496106_0149419 3300048909 Bacteria 1842
302 Ga0496106_0372862 3300048909 Bacteria 1147
303 Ga0496107_0058172 3300048910 Bacteria 2795
304 Ga0496107_0154413 3300048910 Bacteria 1699
305 Ga0496107_0281098 3300048910 Bacteria 1239
306 Ga0496107_0341906 3300048910 Bacteria 1113
307 Ga0496110_0070151 3300048913 Bacteria 3104
308 Ga0496112_0300618 3300048915 Bacteria 1550
309 Ga0496113_0101412 3300048916 Bacteria 2231
310 Ga0496114_0186926 3300048917 Bacteria 1811
311 Ga0496115_0061073 3300048918 Bacteria 3038
312 Ga0496116_0000001 3300048919 Bacteria 1501681
313 Ga0496116_0000177 3300048919 Bacteria 128402
314 Ga0496116_0000386 3300048919 Bacteria 64715
315 Ga0496116_0008301 3300048919 Bacteria 9026
316 Ga0496116_0016086 3300048919 Bacteria 5874
317 Ga0496116_0021527 3300048919 Bacteria 4859
318 Ga0496116_0032658 3300048919 Bacteria 3706
319 Ga0496116_0061379 3300048919 Bacteria 2434
320 Ga0496117_0000092 3300048920 Bacteria 202608
321 Ga0496117_0000551 3300048920 Bacteria 61568
322 Ga0496117_0000588 3300048920 Bacteria 59882
323 Ga0496117_0000599 3300048920 Bacteria 59097
324 Ga0496117_0003443 3300048920 Bacteria 18406
325 Ga0496117_0013690 3300048920 Bacteria 7051
326 Ga0496117_0026726 3300048920 Bacteria 4510
327 Ga0496117_0036589 3300048920 Bacteria 3671
328 Ga0496117_0119657 3300048920 Bacteria 1621
329 Ga0496118_0000053 3300048921 Bacteria 235810
330 Ga0496118_0001141 3300048921 Bacteria 40960
331 Ga0496118_0002529 3300048921 Bacteria 24523
332 Ga0496118_0002642 3300048921 Bacteria 23749
333 Ga0496118_0003020 3300048921 Bacteria 21734
334 Ga0496118_0003717 3300048921 Bacteria 18892
335 Ga0496118_0005698 3300048921 Bacteria 14028
336 Ga0496118_0060738 3300048921 Bacteria 2805
337 Ga0496118_0076119 3300048921 Bacteria 2388
338 Ga0496118_0093427 3300048921 Bacteria 2060
339 Ga0496119_0000085 3300048922 Bacteria 137406
340 Ga0496119_0000293 3300048922 Bacteria 70001
341 Ga0496119_0000362 3300048922 Bacteria 63745
342 Ga0496119_0002037 3300048922 Bacteria 22873
343 Ga0496119_0003643 3300048922 Bacteria 15820
344 Ga0496119_0003957 3300048922 Bacteria 15009
345 Ga0496119_0032237 3300048922 Bacteria 3495
346 Ga0496119_0084498 3300048922 Bacteria 1820
347 Ga0496119_0228565 3300048922 Bacteria 948
348 Ga0496120_0000111 3300048923 Bacteria 137405
349 Ga0496120_0000136 3300048923 Bacteria 124418
350 Ga0496120_0000341 3300048923 Bacteria 77155
351 Ga0496120_0000398 3300048923 Bacteria 70169
352 Ga0496120_0000854 3300048923 Bacteria 43100
353 Ga0496120_0001630 3300048923 Bacteria 26005
354 Ga0496120_0006511 3300048923 Bacteria 8951
355 Ga0496120_0007234 3300048923 Bacteria 8306
356 Ga0496120_0092651 3300048923 Bacteria 1611
357 Ga0496121_0000169 3300048924 Bacteria 144577
358 Ga0496121_0002108 3300048924 Bacteria 31297
359 Ga0496121_0004258 3300048924 Bacteria 19444
360 Ga0496121_0008000 3300048924 Bacteria 12621
361 Ga0496121_0118487 3300048924 Bacteria 2004
362 Ga0496121_0166497 3300048924 Bacteria 1606
363 Ga0496122_0000970 3300048925 Bacteria 51487
364 Ga0496122_0005241 3300048925 Bacteria 15547
365 Ga0496122_0007749 3300048925 Bacteria 11812
366 Ga0496122_0084057 3300048925 Bacteria 2204
367 Ga0496122_0149113 3300048925 Bacteria 1447
368 Ga0496123_0000286 3300048926 Bacteria 98752
369 Ga0496123_0000816 3300048926 Bacteria 50216
370 Ga0496123_0010392 3300048926 Bacteria 8234
371 Ga0496124_0000013 3300048927 Bacteria 484884
372 Ga0496124_0000755 3300048927 Bacteria 53053
373 Ga0496124_0005857 3300048927 Bacteria 13633
374 Ga0496124_0016457 3300048927 Bacteria 7027
375 Ga0496124_0074712 3300048927 Bacteria 2801
376 Ga0496124_0258375 3300048927 Bacteria 1283
377 Ga0496125_0004111 3300048928 Bacteria 16999
378 Ga0496126_0003025 3300048929 Bacteria 21794
379 Ga0496126_0034558 3300048929 Bacteria 4747
380 Ga0495678_000088 3300049459 Bacteria 115071
381 Ga0495678_000993 3300049459 Bacteria 24302
382 Ga0495678_026480 3300049459 Bacteria 2475
383 Ga0495682_0000033 3300049460 Bacteria 132733
384 Ga0501034_0029756 3300049571 Bacteria 5552
385 Ga0501034_0106936 3300049571 Bacteria 2790
386 Ga0501036_0001709 3300049572 Bacteria 17056
387 Ga0501037_0163132 3300049573 Unclassified 1588
388 Ga0501041_0014411 3300049577 Bacteria 4694
389 Ga0501042_0013167 3300049578 Bacteria 5630
390 Ga0501047_0023468 3300049581 Bacteria 5921
391 Ga0501070_0127717 3300049586 Bacteria 2101
392 Ga0501074_0060459 3300049590 Bacteria 2730
393 Ga0501075_0012113 3300049591 Bacteria 6121
394 Ga0501076_0045041 3300049592 Bacteria 3481
395 Ga0501077_0043658 3300049593 Bacteria 2849
396 Ga0501079_0057567 3300049741 Bacteria 2999
397 Ga0501079_0228686 3300049741 Bacteria 1453
398 Ga0501080_0402547 3300049742 Bacteria 1231
399 Ga0501081_0042116 3300049743 Bacteria 3128
400 Ga0501083_0320555 3300049744 Bacteria 1008
401 Ga0501035_0122624 3300049822 Bacteria 2271
402 Ga0501035_0245494 3300049822 Bacteria 1522
403 nmdc:mga00v17_27420_c1 3300050491 Bacteria 3325
404 nmdc:mga00v17_7363_c1 3300050491 Bacteria 5868
405 nmdc:mga07m45_34789_c3 3300050496 Bacteria 1389
406 nmdc:mga0rr50_20096_c1 3300050513 Bacteria 4525
407 nmdc:mga08x19_56132_c1 3300050514 Bacteria 2541
408 nmdc:mga0a205_495445_c1 3300050515 Bacteria 1079
409 Ga0500643_012033 3300053087 Bacteria 3118
410 Ga0500618_000525 3300053125 Bacteria 24130
411 Ga0500621_000013 3300053126 Bacteria 132878
412 Ga0500559_0007073 3300053136 Bacteria 5006
413 Ga0500586_000104 3300053145 Bacteria 14746
414 Ga0500586_047591 3300053145 Bacteria 1472
415 Ga0501084_0057919 3300054114 Bacteria 3242
416 Ga0466962_0006520 3300061719 Bacteria 5604
417 Ga0530510_0051168 3300061734 Bacteria 2984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0058389 Ga0495671_0058389_15_785 247
2 3300046458 Ga0495591_040836 Ga0495591_040836_345_1091 248
3 3300048909 Ga0496106_0149419 Ga0496106_0149419_1048_1827 248
4 3300009036 Ga0105244_10178515 Ga0105244_101785151 255
5 3300048905 Ga0496102_0063494 Ga0496102_0063494_1457_2323 256
6 3300048924 Ga0496121_0008000 Ga0496121_0008000_10942_11808 256
7 3300046522 Ga0495643_0116539 Ga0495643_0116539_565_1338 257
8 3300048904 Ga0496101_0218946 Ga0496101_0218946_481_1398 258
9 3300009093 Ga0105240_10012980 Ga0105240_100129802 260
10 3300025913 Ga0207695_10042791 Ga0207695_100427912 260
11 3300048920 Ga0496117_0026726 Ga0496117_0026726_2795_3673 260
12 3300048921 Ga0496118_0076119 Ga0496118_0076119_35_913 260
13 3300005458 Ga0070681_10165106 Ga0070681_101651062 261
14 3300025912 Ga0207707_10510188 Ga0207707_105101882 261
15 3300049581 Ga0501047_0023468 Ga0501047_0023468_1031_1912 261
16 3300047472 Ga0495686_0169694 Ga0495686_0169694_158_1075 262
17 3300049572 Ga0501036_0001709 Ga0501036_0001709_15669_16484 262
18 3300049573 Ga0501037_0163132 Ga0501037_0163132_380_1195 262
19 3300049577 Ga0501041_0014411 Ga0501041_0014411_767_1582 262
20 3300049578 Ga0501042_0013167 Ga0501042_0013167_4763_5578 262
21 3300049586 Ga0501070_0127717 Ga0501070_0127717_1156_1971 262
22 3300049591 Ga0501075_0012113 Ga0501075_0012113_3709_4524 262
23 3300049592 Ga0501076_0045041 Ga0501076_0045041_2473_3288 262
24 3300049741 Ga0501079_0057567 Ga0501079_0057567_1169_1984 262
25 3300049742 Ga0501080_0402547 Ga0501080_0402547_328_1143 262
26 3300049743 Ga0501081_0042116 Ga0501081_0042116_2277_3092 262
27 3300049744 Ga0501083_0320555 Ga0501083_0320555_41_868 262
28 3300049822 Ga0501035_0245494 Ga0501035_0245494_454_1269 262
29 3300061734 Ga0530510_0051168 Ga0530510_0051168_1445_2260 262
30 3300005535 Ga0070684_100557980 Ga0070684_1005579801 263
31 3300003856 Ga0058692_1000415 Ga0058692_10004156 266
32 3300027312 Ga0209371_1000082 Ga0209371_100008219 266
33 3300030500 Ga0268256_1000072 Ga0268256_100007218 266
34 iso_pu_bacteria 2643221603 2644027755 266
35 3300005440 Ga0070705_100090196 Ga0070705_1000901962 267
36 3300005444 Ga0070694_100077884 Ga0070694_1000778842 267
37 3300005518 Ga0070699_100010039 Ga0070699_1000100395 267
38 3300005545 Ga0070695_100019944 Ga0070695_1000199443 267
39 3300005937 Ga0081455_10003200 Ga0081455_1000320020 267
40 3300005985 Ga0081539_10002201 Ga0081539_100022012 267
41 3300009147 Ga0114129_10494396 Ga0114129_104943962 267
42 3300050513 nmdc:mga0rr50_20096_c1 nmdc:mga0rr50_20096_c1_926_1750 267
43 3300050514 nmdc:mga08x19_56132_c1 nmdc:mga08x19_56132_c1_1014_1838 267
44 3300050515 nmdc:mga0a205_495445_c1 nmdc:mga0a205_495445_c1_67_891 267
45 3300003320 rootH2_10114353 rootH2_101143531 268
46 3300013307 Ga0157372_10089397 Ga0157372_100893972 268
47 3300037471 Ga0395905_0000455 Ga0395905_0000455_4272_5102 269
48 3300045976 Ga0466967_0824281 Ga0466967_0824281_43_894 269
49 3300048922 Ga0496119_0228565 Ga0496119_0228565_11_853 269
50 3300053087 Ga0500643_012033 Ga0500643_012033_426_1286 269
51 3300009148 Ga0105243_10159787 Ga0105243_101597872 270
52 3300013104 Ga0157370_10287622 Ga0157370_102876222 270
53 3300013308 Ga0157375_10197159 Ga0157375_101971593 270
54 3300026067 Ga0207678_10290949 Ga0207678_102909491 270
55 3300041997 Ga0439431_0041720 Ga0439431_0041720_268_1116 270
56 3300048913 Ga0496110_0070151 Ga0496110_0070151_2236_3075 270
57 3300014326 Ga0157380_10159525 Ga0157380_101595253 271
58 3300048919 Ga0496116_0061379 Ga0496116_0061379_223_1074 271
59 iso_pu_bacteria 2738541297 2738826351 271
60 iso_pu_bacteria 2738541357 2739150148 271
61 iso_pu_bacteria 2738543003 2739192067 271
62 iso_pu_bacteria 2738543026 2739318544 271
63 iso_pu_bacteria 2738543029 2739336785 271
64 3300049590 Ga0501074_0060459 Ga0501074_0060459_502_1356 272
65 3300049822 Ga0501035_0122624 Ga0501035_0122624_260_1114 272
66 3300003322 rootL2_10286704 rootL2_102867041 273
67 3300015684 Ga0183365_10001 Ga0183365_10001981 273
68 3300028800 Ga0265338_10000302 Ga0265338_1000030226 273
69 3300049571 Ga0501034_0106936 Ga0501034_0106936_180_1034 273
70 iso_pu_bacteria 2857542790 2857543274 273
71 iso_pu_bacteria 2857564685 2857567606 273
72 iso_pu_bacteria 3003930520 3003933987 273
73 3300048927 Ga0496124_0000013 Ga0496124_0000013_351336_352196 274
74 3300049593 Ga0501077_0043658 Ga0501077_0043658_145_999 274
75 3300049741 Ga0501079_0228686 Ga0501079_0228686_461_1315 274
76 3300054114 Ga0501084_0057919 Ga0501084_0057919_1279_2133 274
77 3300046452 Ga0495617_000020 Ga0495617_000020_215335_216171 275
78 3300046453 Ga0495627_036240 Ga0495627_036240_627_1463 275
79 3300046463 Ga0495653_0041252 Ga0495653_0041252_2435_3271 275
80 3300046471 Ga0495650_0000462 Ga0495650_0000462_42471_43307 275
81 3300046492 Ga0495585_0000424 Ga0495585_0000424_24226_25062 275
82 3300046512 Ga0495610_0000014 Ga0495610_0000014_41429_42265 275
83 3300046524 Ga0495648_0001083 Ga0495648_0001083_26582_27418 275
84 3300046524 Ga0495648_0018753 Ga0495648_0018753_3999_4835 275
85 3300046558 Ga0495633_0008773 Ga0495633_0008773_3513_4349 275
86 3300046616 Ga0495668_0000579 Ga0495668_0000579_29994_30830 275
87 3300046692 Ga0495671_0000005 Ga0495671_0000005_406404_407240 275
88 3300047323 Ga0495683_0019720 Ga0495683_0019720_1716_2552 275
89 3300047446 Ga0495679_030066 Ga0495679_030066_655_1491 275
90 3300047469 Ga0495673_0000009 Ga0495673_0000009_386402_387238 275
91 3300047472 Ga0495686_0160531 Ga0495686_0160531_89_925 275
92 3300048925 Ga0496122_0084057 Ga0496122_0084057_1182_2018 275
93 3300049571 Ga0501034_0029756 Ga0501034_0029756_2064_2927 275
94 3300053145 Ga0500586_047591 Ga0500586_047591_194_1030 275
95 iso_pu_bacteria 2857558681 2857558957 275
96 3300003775 Ga0055524_1000668 Ga0055524_100066815 276
97 iso_pu_bacteria 8055225921 8055226552 276
98 3300005459 Ga0068867_100037265 Ga0068867_1000372654 277
99 3300006028 Ga0070717_10036847 Ga0070717_100368475 277
100 3300025728 Ga0207655_1000029 Ga0207655_100002938 277
101 3300032004 Ga0307414_10075520 Ga0307414_100755202 277
102 3300046507 Ga0495606_0000075 Ga0495606_0000075_115228_116091 277
103 3300048924 Ga0496121_0118487 Ga0496121_0118487_284_1153 277
104 3300046463 Ga0495653_0000082 Ga0495653_0000082_59361_60206 278
105 3300046471 Ga0495650_0000001 Ga0495650_0000001_240231_241115 278
106 3300046471 Ga0495650_0005383 Ga0495650_0005383_1944_2792 278
107 3300046520 Ga0495637_0001932 Ga0495637_0001932_9157_10005 278
108 3300046530 Ga0495654_0000022 Ga0495654_0000022_45912_46760 278
109 3300046810 Ga0495660_0033519 Ga0495660_0033519_490_1338 278
110 3300047469 Ga0495673_0000012 Ga0495673_0000012_211200_212048 278
111 3300047469 Ga0495673_0000113 Ga0495673_0000113_38929_39870 278
112 3300047472 Ga0495686_0016451 Ga0495686_0016451_3238_4101 278
113 3300048929 Ga0496126_0034558 Ga0496126_0034558_1809_2654 278
114 3300053125 Ga0500618_000525 Ga0500618_000525_3858_4709 278
115 3300053136 Ga0500559_0007073 Ga0500559_0007073_167_1039 278
116 iso_pu_bacteria 2511231025 2511380851 278
117 iso_pu_bacteria 2511231035 2511436799 278
118 iso_pu_bacteria 2599185299 2599929362 278
119 iso_pu_bacteria 2608642108 2608671565 278
120 iso_pu_bacteria 2648501693 2650899749 278
121 iso_pu_bacteria 2684622997 2686356447 278
122 iso_pu_bacteria 2808606414 2809126821 278
123 iso_pu_bacteria 2844528606 2844532404 278
124 iso_pu_bacteria 2847797336 2847797578 278
125 iso_pu_bacteria 2865014394 2865018648 278
126 iso_pu_bacteria 2876601092 2876601780 278
127 iso_pu_bacteria 2881609920 2881613392 278
128 iso_pu_bacteria 2939602548 2939607088 278
129 iso_pu_bacteria 2945951305 2945955141 278
130 iso_pu_bacteria 2978975091 2978977623 278
131 iso_pu_bacteria 2984494565 2984499004 278
132 iso_pu_bacteria 2990261002 2990263710 278
133 iso_pu_bacteria 8016733728 8016733941 278
134 iso_pu_bacteria 8019499862 8019504522 278
135 3300005459 Ga0068867_100362731 Ga0068867_1003627311 279
136 3300026089 Ga0207648_10300109 Ga0207648_103001092 279
137 3300046457 Ga0495590_0000012 Ga0495590_0000012_94960_95808 279
138 3300046460 Ga0495638_0000304 Ga0495638_0000304_57154_58002 279
139 3300046471 Ga0495650_0001729 Ga0495650_0001729_17515_18363 279
140 3300046501 Ga0495607_0005675 Ga0495607_0005675_5582_6430 279
141 3300046506 Ga0495583_0000044 Ga0495583_0000044_221640_222488 279
142 3300046507 Ga0495606_0007172 Ga0495606_0007172_4644_5492 279
143 3300046507 Ga0495606_0008151 Ga0495606_0008151_2612_3460 279
144 3300046512 Ga0495610_0000872 Ga0495610_0000872_6901_7749 279
145 3300046512 Ga0495610_0002983 Ga0495610_0002983_10499_11347 279
146 3300046512 Ga0495610_0051889 Ga0495610_0051889_1094_1942 279
147 3300046522 Ga0495643_0000387 Ga0495643_0000387_50980_51828 279
148 3300046522 Ga0495643_0001204 Ga0495643_0001204_4376_5224 279
149 3300046524 Ga0495648_0000006 Ga0495648_0000006_9317_10165 279
150 3300046538 Ga0495609_0006605 Ga0495609_0006605_4427_5275 279
151 3300046542 Ga0495597_0000909 Ga0495597_0000909_17559_18407 279
152 3300046557 Ga0495622_0000511 Ga0495622_0000511_19483_20331 279
153 3300046558 Ga0495633_0000221 Ga0495633_0000221_32545_33393 279
154 3300046558 Ga0495633_0001101 Ga0495633_0001101_19100_19948 279
155 3300046558 Ga0495633_0004184 Ga0495633_0004184_1673_2521 279
156 3300046616 Ga0495668_0001259 Ga0495668_0001259_19873_20721 279
157 3300046660 Ga0495625_0000160 Ga0495625_0000160_5259_6107 279
158 3300046694 Ga0495649_0000846 Ga0495649_0000846_2928_3776 279
159 3300046694 Ga0495649_0037677 Ga0495649_0037677_46_894 279
160 3300047320 Ga0495672_0000075 Ga0495672_0000075_172098_172946 279
161 3300047443 Ga0495687_000547 Ga0495687_000547_42488_43336 279
162 3300047443 Ga0495687_000758 Ga0495687_000758_31671_32519 279
163 3300048925 Ga0496122_0000970 Ga0496122_0000970_37525_38415 279
164 3300048926 Ga0496123_0000286 Ga0496123_0000286_13165_14055 279
165 3300049459 Ga0495678_000993 Ga0495678_000993_20306_21154 279
166 3300053145 Ga0500586_000104 Ga0500586_000104_11718_12566 279
167 iso_pu_bacteria 2706794495 2707098821 279
168 iso_pu_bacteria 2847085930 2847089707 279
169 iso_pu_bacteria 2854601825 2854606045 279
170 iso_pu_bacteria 2908669403 2908674335 279
171 3300006353 Ga0075370_10020024 Ga0075370_100200245 280
172 3300046459 Ga0495629_0000115 Ga0495629_0000115_17875_18753 280
173 3300050496 nmdc:mga07m45_34789_c3 nmdc:mga07m45_34789_c3_328_1212 280
174 iso_pu_bacteria 2501025501 2501075875 280
175 iso_pu_bacteria 2501025504 2501411220 280
176 iso_pu_bacteria 2510917013 2511089148 280
177 iso_pu_bacteria 2510917014 2511100134 280
178 iso_pu_bacteria 2510917015 2511104110 280
179 iso_pu_bacteria 2513237082 2513552740 280
180 iso_pu_bacteria 2513237083 2513561772 280
181 iso_pu_bacteria 2515154189 2516021324 280
182 iso_pu_bacteria 2537561728 2538425370 280
183 iso_pu_bacteria 2855195626 2855199605 280
184 iso_pu_bacteria 2856287931 2856293929 280
185 iso_pu_bacteria 2857357740 2857361869 280
186 iso_pu_bacteria 2858466076 2858466742 280
187 iso_pu_bacteria 2871272651 2871275931 280
188 iso_pu_bacteria 2871282230 2871285782 280
189 iso_pu_bacteria 2883087390 2883094005 280
190 iso_pu_bacteria 2900051742 2900052955 280
191 iso_pu_bacteria 8003955200 8003958628 280
192 3300003856 Ga0058692_1006302 Ga0058692_10063022 281
193 3300005335 Ga0070666_10173376 Ga0070666_101733762 281
194 3300005367 Ga0070667_100092516 Ga0070667_1000925162 281
195 3300005455 Ga0070663_100199640 Ga0070663_1001996402 281
196 3300005455 Ga0070663_100347359 Ga0070663_1003473591 281
197 3300009036 Ga0105244_10134394 Ga0105244_101343942 281
198 3300009177 Ga0105248_10014325 Ga0105248_100143256 281
199 3300013100 Ga0157373_10001330 Ga0157373_100013307 281
200 3300013102 Ga0157371_10000791 Ga0157371_1000079117 281
201 3300013306 Ga0163162_10014549 Ga0163162_100145492 281
202 3300013307 Ga0157372_10056822 Ga0157372_100568224 281
203 3300013307 Ga0157372_10070674 Ga0157372_100706744 281
204 3300013308 Ga0157375_10074784 Ga0157375_100747842 281
205 3300025903 Ga0207680_10155892 Ga0207680_101558922 281
206 3300025941 Ga0207711_10018390 Ga0207711_100183905 281
207 3300025986 Ga0207658_10070294 Ga0207658_100702942 281
208 3300026067 Ga0207678_10044083 Ga0207678_100440832 281
209 3300026067 Ga0207678_10141726 Ga0207678_101417262 281
210 3300027312 Ga0209371_1000339 Ga0209371_100033934 281
211 3300030500 Ga0268256_1000290 Ga0268256_100029010 281
212 3300030731 Ga0316177_1084263 Ga0316177_10842632 281
213 3300030735 Ga0316178_1036040 Ga0316178_10360402 281
214 3300030736 Ga0316180_1023907 Ga0316180_10239073 281
215 3300041405 Ga0439438_000040 Ga0439438_000040_46864_47742 281
216 3300041405 Ga0439438_001995 Ga0439438_001995_7324_8175 281
217 3300041407 Ga0439447_004552 Ga0439447_004552_3729_4607 281
218 3300041407 Ga0439447_006210 Ga0439447_006210_2401_3252 281
219 3300042006 Ga0439432_001143 Ga0439432_001143_3973_4851 281
220 3300044693 Ga0466961_0035494 Ga0466961_0035494_425_1315 281
221 3300044842 Ga0466957_0377186 Ga0466957_0377186_14_892 281
222 3300046455 Ga0495603_0048120 Ga0495603_0048120_248_1129 281
223 3300046458 Ga0495591_001076 Ga0495591_001076_8203_9054 281
224 3300046460 Ga0495638_0006519 Ga0495638_0006519_1493_2374 281
225 3300046471 Ga0495650_0000380 Ga0495650_0000380_49601_50452 281
226 3300046474 Ga0495605_0011371 Ga0495605_0011371_3249_4130 281
227 3300046474 Ga0495605_0033803 Ga0495605_0033803_478_1353 281
228 3300046491 Ga0495584_0002094 Ga0495584_0002094_278_1129 281
229 3300046501 Ga0495607_0054413 Ga0495607_0054413_897_1772 281
230 3300046507 Ga0495606_0002690 Ga0495606_0002690_3812_4687 281
231 3300046513 Ga0495616_0029691 Ga0495616_0029691_338_1213 281
232 3300046523 Ga0495644_0004261 Ga0495644_0004261_4051_4926 281
233 3300046524 Ga0495648_0006600 Ga0495648_0006600_2995_3846 281
234 3300046530 Ga0495654_0000183 Ga0495654_0000183_12342_13193 281
235 3300046530 Ga0495654_0064567 Ga0495654_0064567_381_1232 281
236 3300046692 Ga0495671_0067600 Ga0495671_0067600_160_1035 281
237 3300046694 Ga0495649_0025301 Ga0495649_0025301_2076_2927 281
238 3300046794 Ga0495589_0020375 Ga0495589_0020375_1927_2802 281
239 3300046810 Ga0495660_0000058 Ga0495660_0000058_49573_50448 281
240 3300047320 Ga0495672_0000106 Ga0495672_0000106_82386_83261 281
241 3300047323 Ga0495683_0021945 Ga0495683_0021945_264_1139 281
242 3300047323 Ga0495683_0090331 Ga0495683_0090331_143_994 281
243 3300047443 Ga0495687_000015 Ga0495687_000015_59815_60711 281
244 3300047469 Ga0495673_0000371 Ga0495673_0000371_30189_31064 281
245 3300048910 Ga0496107_0058172 Ga0496107_0058172_470_1351 281
246 3300048917 Ga0496114_0186926 Ga0496114_0186926_86_967 281
247 3300048919 Ga0496116_0000177 Ga0496116_0000177_47747_48598 281
248 3300048922 Ga0496119_0000085 Ga0496119_0000085_88260_89111 281
249 3300048922 Ga0496119_0000293 Ga0496119_0000293_51188_52033 281
250 3300048922 Ga0496119_0002037 Ga0496119_0002037_9394_10245 281
251 3300048923 Ga0496120_0000111 Ga0496120_0000111_88259_89110 281
252 3300048923 Ga0496120_0000136 Ga0496120_0000136_77261_78112 281
253 3300048923 Ga0496120_0000398 Ga0496120_0000398_51188_52033 281
254 3300049459 Ga0495678_000088 Ga0495678_000088_82380_83231 281
255 3300049460 Ga0495682_0000033 Ga0495682_0000033_82285_83136 281
256 3300053126 Ga0500621_000013 Ga0500621_000013_82386_83237 281
257 iso_pu_bacteria 2562617112 2563062437 281
258 iso_pu_bacteria 2711768613 2713477706 281
259 iso_pu_bacteria 642555112 642593911 281
260 3300001989 JGI24739J22299_10000017 JGI24739J22299_1000001743 282
261 3300003320 rootH2_10000113 rootH2_1000011320 282
262 3300003322 rootL2_10027677 rootL2_100276776 282
263 3300003322 rootL2_10159956 rootL2_101599562 282
264 3300003354 JGI25160J50197_1000057 JGI25160J50197_100005761 282
265 3300003856 Ga0058692_1000171 Ga0058692_100017125 282
266 3300003856 Ga0058692_1000368 Ga0058692_10003686 282
267 3300003856 Ga0058692_1001444 Ga0058692_10014444 282
268 3300003856 Ga0058692_1011151 Ga0058692_10111514 282
269 3300005262 Ga0065165_1000448 Ga0065165_100044810 282
270 3300005327 Ga0070658_10000871 Ga0070658_1000087117 282
271 3300005455 Ga0070663_100403144 Ga0070663_1004031441 282
272 3300005457 Ga0070662_100075834 Ga0070662_1000758342 282
273 3300005548 Ga0070665_100091260 Ga0070665_1000912601 282
274 3300005563 Ga0068855_100005220 Ga0068855_1000052202 282
275 3300005577 Ga0068857_100021637 Ga0068857_1000216375 282
276 3300006051 Ga0075364_10026839 Ga0075364_100268394 282
277 3300006051 Ga0075364_10121214 Ga0075364_101212141 282
278 3300009011 Ga0105251_10000501 Ga0105251_100005018 282
279 3300009011 Ga0105251_10000744 Ga0105251_1000074417 282
280 3300009011 Ga0105251_10001022 Ga0105251_1000102218 282
281 3300009011 Ga0105251_10053736 Ga0105251_100537362 282
282 3300009036 Ga0105244_10000379 Ga0105244_100003796 282
283 3300009036 Ga0105244_10000512 Ga0105244_100005126 282
284 3300009036 Ga0105244_10001102 Ga0105244_100011026 282
285 3300009036 Ga0105244_10007929 Ga0105244_100079295 282
286 3300009036 Ga0105244_10074666 Ga0105244_100746662 282
287 3300009092 Ga0105250_10008401 Ga0105250_100084014 282
288 3300009092 Ga0105250_10024985 Ga0105250_100249854 282
289 3300009093 Ga0105240_10002446 Ga0105240_100024464 282
290 3300009093 Ga0105240_10002659 Ga0105240_100026595 282
291 3300009093 Ga0105240_10123177 Ga0105240_101231772 282
292 3300009101 Ga0105247_10000128 Ga0105247_1000012834 282
293 3300009177 Ga0105248_10341912 Ga0105248_103419121 282
294 3300009177 Ga0105248_10396172 Ga0105248_103961722 282
295 3300010375 Ga0105239_10000056 Ga0105239_1000005635 282
296 3300011119 Ga0105246_10024628 Ga0105246_100246281 282
297 3300011119 Ga0105246_10053137 Ga0105246_100531373 282
298 3300011119 Ga0105246_10064061 Ga0105246_100640613 282
299 3300011119 Ga0105246_10127901 Ga0105246_101279011 282
300 3300013100 Ga0157373_10000189 Ga0157373_1000018917 282
301 3300013100 Ga0157373_10014529 Ga0157373_100145293 282
302 3300013100 Ga0157373_10070842 Ga0157373_100708423 282
303 3300013102 Ga0157371_10001117 Ga0157371_1000111712 282
304 3300013102 Ga0157371_10004213 Ga0157371_100042139 282
305 3300013104 Ga0157370_10000789 Ga0157370_1000078924 282
306 3300013104 Ga0157370_10006599 Ga0157370_100065993 282
307 3300013105 Ga0157369_10015594 Ga0157369_100155947 282
308 3300013306 Ga0163162_10195030 Ga0163162_101950302 282
309 3300013307 Ga0157372_10050484 Ga0157372_100504845 282
310 3300013307 Ga0157372_10077074 Ga0157372_100770743 282
311 3300013307 Ga0157372_10543415 Ga0157372_105434152 282
312 3300017792 Ga0163161_10128225 Ga0163161_101282253 282
313 3300025233 Ga0209437_100322 Ga0209437_10032217 282
314 3300025295 Ga0209564_1016672 Ga0209564_10166722 282
315 3300025302 Ga0207426_1000168 Ga0207426_100016859 282
316 3300025711 Ga0207696_1000390 Ga0207696_100039024 282
317 3300025711 Ga0207696_1000627 Ga0207696_100062713 282
318 3300025711 Ga0207696_1008271 Ga0207696_10082712 282
319 3300025728 Ga0207655_1000064 Ga0207655_1000064105 282
320 3300025728 Ga0207655_1000130 Ga0207655_100013018 282
321 3300025728 Ga0207655_1003437 Ga0207655_10034372 282
322 3300025728 Ga0207655_1020667 Ga0207655_10206674 282
323 3300025728 Ga0207655_1061196 Ga0207655_10611961 282
324 3300025735 Ga0207713_1000016 Ga0207713_1000016158 282
325 3300025735 Ga0207713_1000043 Ga0207713_1000043215 282
326 3300025735 Ga0207713_1002911 Ga0207713_10029118 282
327 3300025735 Ga0207713_1006250 Ga0207713_10062505 282
328 3300025735 Ga0207713_1010785 Ga0207713_10107853 282
329 3300025900 Ga0207710_10000224 Ga0207710_1000022436 282
330 3300025909 Ga0207705_10000850 Ga0207705_1000085013 282
331 3300025913 Ga0207695_10000663 Ga0207695_1000066347 282
332 3300025913 Ga0207695_10020759 Ga0207695_100207595 282
333 3300025913 Ga0207695_10047859 Ga0207695_100478592 282
334 3300025913 Ga0207695_10061109 Ga0207695_100611092 282
335 3300025914 Ga0207671_10092309 Ga0207671_100923093 282
336 3300025933 Ga0207706_10095026 Ga0207706_100950262 282
337 3300025941 Ga0207711_10182630 Ga0207711_101826302 282
338 3300025941 Ga0207711_10330829 Ga0207711_103308291 282
339 3300025949 Ga0207667_10001157 Ga0207667_1000115722 282
340 3300025972 Ga0207668_10031758 Ga0207668_100317583 282
341 3300027312 Ga0209371_1000061 Ga0209371_100006119 282
342 3300027312 Ga0209371_1000138 Ga0209371_100013819 282
343 3300027312 Ga0209371_1000417 Ga0209371_100041718 282
344 3300027312 Ga0209371_1001123 Ga0209371_10011235 282
345 3300027312 Ga0209371_1010995 Ga0209371_10109953 282
346 3300027312 Ga0209371_1012568 Ga0209371_10125681 282
347 3300027312 Ga0209371_1023467 Ga0209371_10234671 282
348 3300030500 Ga0268256_1000059 Ga0268256_1000059196 282
349 3300030500 Ga0268256_1000202 Ga0268256_100020244 282
350 3300030500 Ga0268256_1000587 Ga0268256_10005878 282
351 3300030500 Ga0268256_1013721 Ga0268256_10137213 282
352 3300037312 Ga0395899_0000038 Ga0395899_0000038_159043_159924 282
353 3300037418 Ga0395900_0000268 Ga0395900_0000268_42363_43247 282
354 3300038443 Ga0395901_0000002 Ga0395901_0000002_623188_624072 282
355 3300041405 Ga0439438_011159 Ga0439438_011159_207_1055 282
356 3300041411 Ga0439466_0000079 Ga0439466_0000079_17924_18772 282
357 3300042006 Ga0439432_000264 Ga0439432_000264_8044_8892 282
358 3300042006 Ga0439432_038852 Ga0439432_038852_209_1057 282
359 3300042010 Ga0439452_000026 Ga0439452_000026_24248_25096 282
360 3300042016 Ga0439463_006612 Ga0439463_006612_386_1234 282
361 3300042146 Ga0450907_000255 Ga0450907_000255_11780_12628 282
362 3300042439 Ga0439464_0003162 Ga0439464_0003162_351_1199 282
363 3300044656 Ga0466969_0019691 Ga0466969_0019691_582_1463 282
364 3300044684 Ga0466966_0001002 Ga0466966_0001002_5035_5916 282
365 3300044693 Ga0466961_0000245 Ga0466961_0000245_17073_17954 282
366 3300044694 Ga0466963_0005922 Ga0466963_0005922_559_1440 282
367 3300044719 Ga0466971_0024769 Ga0466971_0024769_927_1808 282
368 3300044842 Ga0466957_0146301 Ga0466957_0146301_152_1042 282
369 3300046452 Ga0495617_014995 Ga0495617_014995_816_1664 282
370 3300046453 Ga0495627_000145 Ga0495627_000145_5923_6831 282
371 3300046455 Ga0495603_0021640 Ga0495603_0021640_1719_2609 282
372 3300046458 Ga0495591_000111 Ga0495591_000111_75538_76386 282
373 3300046472 Ga0495580_0020322 Ga0495580_0020322_2694_3584 282
374 3300046474 Ga0495605_0034124 Ga0495605_0034124_1563_2453 282
375 3300046477 Ga0495664_0062889 Ga0495664_0062889_56_940 282
376 3300046492 Ga0495585_0007280 Ga0495585_0007280_3682_4530 282
377 3300046500 Ga0495596_0000698 Ga0495596_0000698_3870_4718 282
378 3300046506 Ga0495583_0021963 Ga0495583_0021963_1987_2877 282
379 3300046513 Ga0495616_0051587 Ga0495616_0051587_37_927 282
380 3300046524 Ga0495648_0003278 Ga0495648_0003278_5634_6482 282
381 3300046524 Ga0495648_0014270 Ga0495648_0014270_4765_5655 282
382 3300046530 Ga0495654_0000170 Ga0495654_0000170_23199_24095 282
383 3300046530 Ga0495654_0000250 Ga0495654_0000250_31139_31987 282
384 3300047319 Ga0495674_0010288 Ga0495674_0010288_2059_2943 282
385 3300047319 Ga0495674_0038905 Ga0495674_0038905_1216_2106 282
386 3300047320 Ga0495672_0000040 Ga0495672_0000040_249800_250648 282
387 3300047320 Ga0495672_0001554 Ga0495672_0001554_10882_11766 282
388 3300047320 Ga0495672_0023076 Ga0495672_0023076_257_1147 282
389 3300047446 Ga0495679_009027 Ga0495679_009027_1893_2741 282
390 3300047469 Ga0495673_0022091 Ga0495673_0022091_2138_3028 282
391 3300047469 Ga0495673_0066995 Ga0495673_0066995_532_1416 282
392 3300047472 Ga0495686_0000826 Ga0495686_0000826_15399_16292 282
393 3300048903 Ga0496100_0001306 Ga0496100_0001306_5396_6286 282
394 3300048903 Ga0496100_0041145 Ga0496100_0041145_399_1247 282
395 3300048903 Ga0496100_0044411 Ga0496100_0044411_1100_1990 282
396 3300048904 Ga0496101_0000164 Ga0496101_0000164_38200_39048 282
397 3300048904 Ga0496101_0056767 Ga0496101_0056767_1510_2400 282
398 3300048904 Ga0496101_0145196 Ga0496101_0145196_81_968 282
399 3300048904 Ga0496101_0197661 Ga0496101_0197661_450_1340 282
400 3300048905 Ga0496102_0001984 Ga0496102_0001984_5571_6419 282
401 3300048905 Ga0496102_0006344 Ga0496102_0006344_375_1265 282
402 3300048905 Ga0496102_0318879 Ga0496102_0318879_589_1437 282
403 3300048905 Ga0496102_0584905 Ga0496102_0584905_75_962 282
404 3300048906 Ga0496103_0001615 Ga0496103_0001615_5582_6472 282
405 3300048906 Ga0496103_0049224 Ga0496103_0049224_220_1068 282
406 3300048906 Ga0496103_0202102 Ga0496103_0202102_48_938 282
407 3300048907 Ga0496104_0051536 Ga0496104_0051536_2817_3704 282
408 3300048907 Ga0496104_0376839 Ga0496104_0376839_225_1115 282
409 3300048908 Ga0496105_0037307 Ga0496105_0037307_2174_3022 282
410 3300048908 Ga0496105_0056989 Ga0496105_0056989_177_1064 282
411 3300048908 Ga0496105_0089911 Ga0496105_0089911_1065_1955 282
412 3300048909 Ga0496106_0372862 Ga0496106_0372862_168_1055 282
413 3300048910 Ga0496107_0154413 Ga0496107_0154413_785_1672 282
414 3300048910 Ga0496107_0281098 Ga0496107_0281098_43_930 282
415 3300048910 Ga0496107_0341906 Ga0496107_0341906_59_949 282
416 3300048915 Ga0496112_0300618 Ga0496112_0300618_419_1309 282
417 3300048916 Ga0496113_0101412 Ga0496113_0101412_353_1243 282
418 3300048918 Ga0496115_0061073 Ga0496115_0061073_1118_2008 282
419 3300048919 Ga0496116_0000001 Ga0496116_0000001_604063_604959 282
420 3300048919 Ga0496116_0000386 Ga0496116_0000386_39620_40468 282
421 3300048919 Ga0496116_0008301 Ga0496116_0008301_5931_6779 282
422 3300048919 Ga0496116_0016086 Ga0496116_0016086_4534_5382 282
423 3300048919 Ga0496116_0021527 Ga0496116_0021527_1229_2077 282
424 3300048919 Ga0496116_0032658 Ga0496116_0032658_2419_3336 282
425 3300048920 Ga0496117_0000092 Ga0496117_0000092_18048_18896 282
426 3300048920 Ga0496117_0000551 Ga0496117_0000551_36259_37107 282
427 3300048920 Ga0496117_0000588 Ga0496117_0000588_45875_46723 282
428 3300048920 Ga0496117_0000599 Ga0496117_0000599_20937_21833 282
429 3300048920 Ga0496117_0003443 Ga0496117_0003443_9124_10011 282
430 3300048920 Ga0496117_0013690 Ga0496117_0013690_236_1126 282
431 3300048920 Ga0496117_0036589 Ga0496117_0036589_1248_2135 282
432 3300048920 Ga0496117_0119657 Ga0496117_0119657_373_1269 282
433 3300048921 Ga0496118_0000053 Ga0496118_0000053_216915_217763 282
434 3300048921 Ga0496118_0001141 Ga0496118_0001141_13525_14373 282
435 3300048921 Ga0496118_0002529 Ga0496118_0002529_15561_16457 282
436 3300048921 Ga0496118_0002642 Ga0496118_0002642_3242_4090 282
437 3300048921 Ga0496118_0003020 Ga0496118_0003020_167_1054 282
438 3300048921 Ga0496118_0003717 Ga0496118_0003717_7802_8689 282
439 3300048921 Ga0496118_0005698 Ga0496118_0005698_7133_8023 282
440 3300048921 Ga0496118_0060738 Ga0496118_0060738_1426_2343 282
441 3300048921 Ga0496118_0093427 Ga0496118_0093427_992_1840 282
442 3300048922 Ga0496119_0000362 Ga0496119_0000362_1921_2808 282
443 3300048922 Ga0496119_0003643 Ga0496119_0003643_3724_4572 282
444 3300048922 Ga0496119_0003957 Ga0496119_0003957_4915_5763 282
445 3300048922 Ga0496119_0032237 Ga0496119_0032237_288_1136 282
446 3300048922 Ga0496119_0084498 Ga0496119_0084498_598_1488 282
447 3300048923 Ga0496120_0000341 Ga0496120_0000341_15346_16233 282
448 3300048923 Ga0496120_0000854 Ga0496120_0000854_24949_25797 282
449 3300048923 Ga0496120_0001630 Ga0496120_0001630_13909_14757 282
450 3300048923 Ga0496120_0006511 Ga0496120_0006511_2483_3370 282
451 3300048923 Ga0496120_0007234 Ga0496120_0007234_5553_6401 282
452 3300048923 Ga0496120_0092651 Ga0496120_0092651_345_1235 282
453 3300048924 Ga0496121_0000169 Ga0496121_0000169_125927_126814 282
454 3300048924 Ga0496121_0002108 Ga0496121_0002108_25126_26013 282
455 3300048924 Ga0496121_0004258 Ga0496121_0004258_17581_18429 282
456 3300048924 Ga0496121_0166497 Ga0496121_0166497_476_1393 282
457 3300048925 Ga0496122_0005241 Ga0496122_0005241_1879_2727 282
458 3300048925 Ga0496122_0007749 Ga0496122_0007749_3884_4732 282
459 3300048925 Ga0496122_0149113 Ga0496122_0149113_323_1213 282
460 3300048926 Ga0496123_0000816 Ga0496123_0000816_43604_44452 282
461 3300048926 Ga0496123_0010392 Ga0496123_0010392_2919_3767 282
462 3300048927 Ga0496124_0000755 Ga0496124_0000755_40506_41354 282
463 3300048927 Ga0496124_0005857 Ga0496124_0005857_886_1734 282
464 3300048927 Ga0496124_0016457 Ga0496124_0016457_2224_3072 282
465 3300048927 Ga0496124_0074712 Ga0496124_0074712_1014_1862 282
466 3300048927 Ga0496124_0258375 Ga0496124_0258375_90_938 282
467 3300048928 Ga0496125_0004111 Ga0496125_0004111_10945_11793 282
468 3300048929 Ga0496126_0003025 Ga0496126_0003025_20719_21606 282
469 3300049459 Ga0495678_026480 Ga0495678_026480_1090_1938 282
470 3300050491 nmdc:mga00v17_27420_c1 nmdc:mga00v17_27420_c1_1492_2340 282
471 3300050491 nmdc:mga00v17_7363_c1 nmdc:mga00v17_7363_c1_2473_3321 282
472 3300061719 Ga0466962_0006520 Ga0466962_0006520_3218_4099 282
473 iso_pu_bacteria 2506520007 2506577190 282
474 iso_pu_bacteria 2506520008 2506582328 282
475 iso_pu_bacteria 2654587920 2656276555 282
476 iso_pu_bacteria 2687453601 2689444907 282
477 iso_pu_bacteria 2869551831 2869553041 282
478 iso_pu_bacteria 2888373701 2888378187 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

45

324

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8828 1 282
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8798 1 282
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.8777 1 282
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.8745 1 282
1ym5-assembly1.cif.gz_A-2 crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily. 0.8651 1 281
ID Description Score Start End Superfamily
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9722 3 108 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9292 3 108 3.10.310.10
1s7jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9281 1 113 3.10.310.10
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9256 4 112 3.10.310.10
af_K7LH11_6_125_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.896 5 113 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A7X2MSG2-F1-model_v4 Phenazine biosynthesis protein PhzF family 0.9941 131 282 GO:0005737
GO:0009058
GO:0016853
AF-A0A7X7G9G2-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9929 3 72 GO:0005737
GO:0009058
GO:0016853
AF-H3RI16-F1-model_v4 Xylulose-5-phosphate/fructose-6-phosphate phosphoketolase (EC 4.1.2.22, EC 4.1.2.9) 0.9903 69 281 GO:0005975
GO:0009058
GO:0047905
GO:0050193
AF-A0A848Y365-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9894 3 101 GO:0005737
GO:0009058
GO:0016853
AF-A0A4U9HFZ8-F1-model_v4 Trans-2,3-dihydro-3-hydroxyanthranilate isomerase (EC 5.3.3.17) 0.989 1 112 GO:0005737
GO:0009058
GO:0102943

Feature Viewer

pLDDT pTM Quality
95.75 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map