metagRoot

F451751

General Info

Members	Datasets	Scaffolds	Average Seq Length
477	302	421	380

Family's Representative Sequence

Representative Sequence	3300044706\|Ga0466964_0033540\|Ga0466964_0033540_355_1638
Length	427
Sequence	MMRQQTTASGGSGHQERAEDAGQVRTGRPKRVLILGSTGSIGTQALDLIAANPDRFEVVGLAAGGGHAAELADQALRFGVSGVAVASATAVEDVQLGLYTQAAKRGYDRGEVRLPRLFGGTDAIIELIDEVPADIVLNGIDGSRGLMPTLRALGTGATLALANKESLVAGGPLVLRAAAPGQLVPVDSEHSALAQCLRGGRGSEVSKLLLTASGGPFRGRSRDELAGVTVDDALAHPTWSMGPLVTVNSATLMNKGLELIEAQLLFGVPYDPIDVVVHPQSIVHSMVTFTDGSTIAQASPPDMRLPISLALGWPDRVPAAAPACDFAAASSWTFEPLDHDAFPAVRLCKEAGAAGGCLPAVLNAANEQAVRAFLAGNSAFTAIVETVSQVLQKADQWRAEPSTVDEVLAAEQWGRTRCAELLGLGRN

Samples

	Sample ID	Description	Type	Environment
1	2565956761	Rhodococcus qingshengii BKS 20-40	Isolate	Rhizosphere
2	2582580736	Prauserella sp. Am3	Isolate	Unclassified
3	2585427649	Amycolatopsis japonica MG417-CF17, DSM 44213	Isolate	Unclassified
4	2643221635	Yonghaparkia sp. Root332	Isolate	Unclassified
5	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
6	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
7	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
8	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
9	2738541308	Rhodococcus sp. OK551	Isolate	Unclassified
10	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
11	2738543005	Rhodococcus sp. OK519	Isolate	Unclassified
12	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
13	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
14	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
15	2808606368	Microbacterium sp. SLBN-1	Isolate	Unclassified
16	2808606447	Microbacterium sp. HAR-UPW-R2A-48	Isolate	Unclassified
17	2808606522	Amycolatopsis sp. BJA-103	Isolate	Unclassified
18	2816332139	Pseudonocardia kunmingensis DSM 45301	Isolate	Unclassified
19	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
20	2844841374	Leifsonia soli DSM 23871	Isolate	Rhizosphere
21	2857720070	Microbacterium sp. R-72113	Isolate	Unclassified
22	2857733635	Salinibacterium sp. R-73062	Isolate	Unclassified
23	2866612099	Amycolatopsis suaedae 8-3EHSu	Isolate	Unclassified
24	2889300758	Rhodococcus sp. PvR099	Isolate	Rhizosphere
25	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
26	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
27	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
28	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
29	2904430863	Curtobacterium oceanosedimentum 1519	Isolate	Rhizosphere
30	2904501621	Curtobacterium sp. 1909	Isolate	Unclassified
31	2904535858	Rhodococcus erythropolis 2017	Isolate	Unclassified
32	2906799679	Microbacterium karelineae TRM80801	Isolate	Unclassified
33	2908674828	Curtobacterium sp. 1517	Isolate	Rhizosphere
34	2908678064	Microbacterium sp. 1518	Isolate	Rhizosphere
35	2909074476	Curtobacterium sp. 1310	Isolate	Rhizosphere
36	2915768154	Amycolatopsis pittospori PIP199	Isolate	Unclassified
37	2917736166	Amycolatopsis dendrobii DR6-1	Isolate	Unclassified
38	2919039151	Curtobacterium sp. 260	Isolate	Rhizosphere
39	2919055335	Leifsonia sp. 1010	Isolate	Rhizosphere
40	2919069694	Microbacterium sp. 1154	Isolate	Unclassified
41	2919523602	Leifsonia shinshuensis 3821	Isolate	Unclassified
42	2922554459	Rhodococcus sp. 66b	Isolate	Unclassified
43	2928142448	Prescottella equi DPS 2018	Isolate	Unclassified
44	2928153084	Leifsonia sp. 563	Isolate	Unclassified
45	2928500415	Curtobacterium oceanosedimentum 1257	Isolate	Rhizosphere
46	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
47	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
48	2939657138	Conyzicola nivalis 2857	Isolate	Rhizosphere
49	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
50	2966921586	Rathayibacter agropyri 617	Isolate	Rhizosphere
51	2974294766	Microbacterium proteolyticum SORGH_AS 209	Isolate	Unclassified
52	2974324384	Microbacterium sp. SORGH_AS 344	Isolate	Unclassified
53	2977251589	Microbacterium sp. SORGH_AS 505	Isolate	Unclassified
54	2977264416	Microbacterium testaceum SORGH_AS 594	Isolate	Unclassified
55	2984580707	Microbacterium paludicola SORGH_AS919	Isolate	Aerial Root
56	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
57	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
58	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
59	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
60	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
61	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
62	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
63	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
64	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
65	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
66	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
67	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
68	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
69	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
70	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
71	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
72	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
73	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
74	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
75	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
76	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
77	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
78	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
79	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
80	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
81	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
82	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
83	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
84	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
85	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
86	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
87	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
88	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
89	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
90	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
91	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
92	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
93	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
94	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
95	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
96	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
97	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
98	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
99	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
100	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
101	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
102	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
103	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
104	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
105	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
106	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
107	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
108	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
109	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
110	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
111	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
112	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
113	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
114	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
115	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
116	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
117	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
118	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
119	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
120	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
121	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
122	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
123	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
124	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
125	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
126	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
127	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
128	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
129	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
130	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
131	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
132	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
133	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
134	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
135	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
136	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
137	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
179	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
182	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
183	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
184	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
185	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
186	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
187	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
188	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
189	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
190	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
191	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
192	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
193	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
194	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
195	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
196	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
197	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
198	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
199	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
200	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
201	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
202	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
203	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
204	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
205	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
206	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
207	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
208	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
209	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
210	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
211	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
212	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
213	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
214	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
215	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
216	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
217	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
218	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
219	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
220	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
221	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
222	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
223	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
224	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
225	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
226	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
227	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
228	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
229	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
230	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
231	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
232	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
233	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
234	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
235	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
236	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
237	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
238	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
239	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
240	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
241	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
242	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
243	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
244	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
245	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
246	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
247	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
248	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
249	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
250	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
251	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
252	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
253	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
254	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
255	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
256	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
257	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
258	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
259	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
260	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
261	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
262	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
263	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
264	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
265	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
266	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
267	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
268	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
269	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
270	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
271	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
272	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
273	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
274	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
275	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
276	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
277	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
278	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
279	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
280	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
281	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
282	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
283	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
284	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
285	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
286	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
287	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
288	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
289	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
290	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
291	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
292	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
293	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
294	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
295	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
296	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
297	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
298	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
299	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
300	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
301	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
302	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	88.05
Metatranscriptomes	0.21
Isolates	11.74

Biome Distribution

Category	Percentage (%)
Aerial Root	0.21
Bulb	0
Endosphere	13.63
Nodule	0.21
Rhizoplane	11.11
Rhizosphere	57.44
Stem	0
Stem Tuber	0
Unclassified	17.4

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24744J21845_10006522	3300002077	Bacteria	2420
2	Ga0006562J51391_1051274	3300003578	Bacteria	3156
3	Ga0055539_1000008	3300003752	Bacteria	537665
4	Ga0055533_1000001	3300003756	Bacteria	1863437
5	Ga0055525_1000329	3300003759	Bacteria	36203
6	Ga0055527_1000001	3300003760	Bacteria	850044
7	Ga0055529_1000018	3300003763	Bacteria	344344
8	Ga0055540_1000029	3300003792	Bacteria	179894
9	Ga0055540_1001773	3300003792	Bacteria	12303
10	Ga0055540_1002004	3300003792	Bacteria	11361
11	Ga0055540_1017923	3300003792	Bacteria	1958
12	Ga0055541_1001710	3300003841	Bacteria	4621
13	Ga0068869_100052276	3300005334	Bacteria	2966
14	Ga0070682_100019260	3300005337	Bacteria	4001
15	Ga0070682_100112013	3300005337	Bacteria	1820
16	Ga0068868_100180737	3300005338	Bacteria	1750
17	Ga0070689_100015797	3300005340	Bacteria	5514
18	Ga0070668_100000140	3300005347	Bacteria	45946
19	Ga0070668_100012969	3300005347	Bacteria	6205
20	Ga0070669_100035590	3300005353	Bacteria	3608
21	Ga0070671_100002923	3300005355	Bacteria	13285
22	Ga0070673_100076968	3300005364	Bacteria	2695
23	Ga0070688_100011544	3300005365	Bacteria	4911
24	Ga0070688_100093340	3300005365	Bacteria	1971
25	Ga0070667_100000604	3300005367	Bacteria	35043
26	Ga0070709_10000299	3300005434	Bacteria	31512
27	Ga0070709_10053436	3300005434	Bacteria	2543
28	Ga0070714_100002658	3300005435	Bacteria	13174
29	Ga0070713_100002813	3300005436	Bacteria	11379
30	Ga0070713_100065841	3300005436	Bacteria	3046
31	Ga0070710_10000090	3300005437	Bacteria	41510
32	Ga0070701_10001398	3300005438	Bacteria	8935
33	Ga0070711_100008955	3300005439	Bacteria	6143
34	Ga0070705_100003490	3300005440	Bacteria	7696
35	Ga0070700_100091377	3300005441	Bacteria	1987
36	Ga0070708_100008971	3300005445	Bacteria	8057
37	Ga0070678_100017707	3300005456	Bacteria	4596
38	Ga0068867_100005134	3300005459	Bacteria	9250
39	Ga0068867_100007257	3300005459	Bacteria	7837
40	Ga0070706_100038284	3300005467	Bacteria	4426
41	Ga0070698_100004377	3300005471	Bacteria	15519
42	Ga0070698_100004722	3300005471	Bacteria	14962
43	Ga0070684_100076739	3300005535	Bacteria	2950
44	Ga0070686_100097337	3300005544	Bacteria	1980
45	Ga0070693_100027859	3300005547	Bacteria	3066
46	Ga0070664_100244651	3300005564	Bacteria	1611
47	Ga0068859_100195455	3300005617	Bacteria	2107
48	Ga0068866_10009283	3300005718	Bacteria	4170
49	Ga0068861_100219158	3300005719	Bacteria	1607
50	Ga0068863_100087333	3300005841	Bacteria	2955
51	Ga0068858_100006639	3300005842	Bacteria	11250
52	Ga0068860_100199293	3300005843	Bacteria	1939
53	Ga0068862_100069563	3300005844	Bacteria	3038
54	Ga0081455_10000011	3300005937	Bacteria	203132
55	Ga0081455_10087536	3300005937	Bacteria	2534
56	Ga0081538_10055831	3300005981	Bacteria	2320
57	Ga0070717_10008227	3300006028	Bacteria	7788
58	Ga0070717_10155509	3300006028	Bacteria	1981
59	Ga0075365_10016904	3300006038	Bacteria	4452
60	Ga0075365_10024618	3300006038	Bacteria	3800
61	Ga0075365_10127853	3300006038	Bacteria	1757
62	Ga0075363_100002576	3300006048	Bacteria	7458
63	Ga0075363_100023949	3300006048	Bacteria	3099
64	Ga0075364_10003911	3300006051	Bacteria	8539
65	Ga0075364_10009119	3300006051	Bacteria	5943
66	Ga0075364_10023071	3300006051	Bacteria	3937
67	Ga0070715_10000417	3300006163	Bacteria	10851
68	Ga0070716_100000110	3300006173	Bacteria	32315
69	Ga0070712_100003847	3300006175	Bacteria	9242
70	Ga0070712_100014896	3300006175	Bacteria	4997
71	Ga0075367_10022894	3300006178	Bacteria	3510
72	Ga0075367_10033178	3300006178	Bacteria	2974
73	Ga0075369_10016645	3300006186	Bacteria	2970
74	Ga0075366_10001079	3300006195	Bacteria	13398
75	Ga0097621_100071819	3300006237	Bacteria	2861
76	Ga0075370_10000287	3300006353	Bacteria	18091
77	Ga0075428_100007408	3300006844	Bacteria	12165
78	Ga0075428_100084453	3300006844	Bacteria	3464
79	Ga0075430_100046740	3300006846	Bacteria	3656
80	Ga0075430_100072600	3300006846	Bacteria	2886
81	Ga0075431_100030163	3300006847	Bacteria	5585
82	Ga0075431_100215532	3300006847	Bacteria	1960
83	Ga0097620_100195440	3300006931	Bacteria	2107
84	Ga0111539_10000070	3300009094	Bacteria	103017
85	Ga0105245_10003195	3300009098	Bacteria	14659
86	Ga0105245_10279231	3300009098	Bacteria	1632
87	Ga0105247_10000456	3300009101	Bacteria	34514
88	Ga0114129_10022769	3300009147	Bacteria	8884
89	Ga0105243_10006505	3300009148	Bacteria	9033
90	Ga0105243_10016111	3300009148	Bacteria	5655
91	Ga0105243_10268725	3300009148	Bacteria	1530
92	Ga0105242_10013523	3300009176	Bacteria	6312
93	Ga0105248_10007739	3300009177	Bacteria	11797
94	Ga0105248_10020824	3300009177	Bacteria	7265
95	Ga0105248_10104920	3300009177	Bacteria	3187
96	Ga0105237_10000346	3300009545	Bacteria	65318
97	Ga0105237_10006355	3300009545	Bacteria	13127
98	Ga0105237_10025145	3300009545	Bacteria	6091
99	Ga0105237_10115422	3300009545	Bacteria	2678
100	Ga0105249_10001439	3300009553	Bacteria	20816
101	Ga0105249_10022452	3300009553	Bacteria	5652
102	Ga0105249_10094788	3300009553	Bacteria	2798
103	Ga0105239_10006651	3300010375	Bacteria	13378
104	Ga0105239_10008590	3300010375	Bacteria	11583
105	Ga0105239_10037332	3300010375	Bacteria	5327
106	Ga0157369_10165471	3300013105	Bacteria	2333
107	Ga0157369_10242055	3300013105	Bacteria	1884
108	Ga0157374_10002901	3300013296	Bacteria	14368
109	Ga0157374_10095382	3300013296	Bacteria	2844
110	Ga0157378_10001141	3300013297	Bacteria	24154
111	Ga0157378_10108368	3300013297	Bacteria	2543
112	Ga0163162_10038367	3300013306	Bacteria	4780
113	Ga0163162_10158061	3300013306	Bacteria	2388
114	Ga0157372_10002481	3300013307	Bacteria	19997
115	Ga0157375_10035053	3300013308	Bacteria	4786
116	Ga0157375_10200089	3300013308	Bacteria	2153
117	Ga0157380_10001262	3300014326	Bacteria	16419
118	Ga0157380_10030567	3300014326	Bacteria	4127
119	Ga0157380_10107587	3300014326	Bacteria	2336
120	Ga0157377_10009031	3300014745	Bacteria	4881
121	Ga0157377_10013413	3300014745	Bacteria	4147
122	Ga0157379_10012668	3300014968	Bacteria	7370
123	Ga0213876_10021368	3300021384	Bacteria	3423
124	Ga0209566_100026	3300025225	Bacteria	367457
125	Ga0209674_100001	3300025226	Bacteria	4013750
126	Ga0209672_100006	3300025228	Bacteria	1004497
127	Ga0209563_100001	3300025230	Bacteria	4013775
128	Ga0209563_100532	3300025230	Bacteria	12875
129	Ga0209258_101418	3300025242	Bacteria	8504
130	Ga0209677_100001	3300025253	Bacteria	4013787
131	Ga0209148_1000015	3300025254	Bacteria	850103
132	Ga0209455_1000013	3300025272	Bacteria	850103
133	Ga0209455_1000886	3300025272	Bacteria	15732
134	Ga0209051_1000042	3300025303	Bacteria	308486
135	Ga0209051_1000374	3300025303	Bacteria	64311
136	Ga0209051_1001633	3300025303	Bacteria	18182
137	Ga0209051_1013833	3300025303	Bacteria	3808
138	Ga0209051_1018676	3300025303	Bacteria	3059
139	Ga0207692_10000065	3300025898	Bacteria	30574
140	Ga0207692_10030595	3300025898	Bacteria	2569
141	Ga0207642_10071216	3300025899	Bacteria	1655
142	Ga0207688_10000504	3300025901	Bacteria	18809
143	Ga0207699_10000424	3300025906	Bacteria	21611
144	Ga0207699_10017868	3300025906	Bacteria	3746
145	Ga0207645_10071106	3300025907	Bacteria	2226
146	Ga0207643_10089749	3300025908	Bacteria	1791
147	Ga0207684_10017506	3300025910	Bacteria	6146
148	Ga0207684_10017833	3300025910	Bacteria	6087
149	Ga0207671_10098200	3300025914	Bacteria	2215
150	Ga0207693_10003860	3300025915	Bacteria	12766
151	Ga0207693_10005934	3300025915	Bacteria	10134
152	Ga0207663_10001352	3300025916	Bacteria	11346
153	Ga0207662_10016330	3300025918	Bacteria	4189
154	Ga0207657_10053323	3300025919	Bacteria	3503
155	Ga0207646_10166975	3300025922	Bacteria	1987
156	Ga0207700_10000126	3300025928	Bacteria	45263
157	Ga0207664_10000148	3300025929	Bacteria	57411
158	Ga0207664_10224247	3300025929	Bacteria	1631
159	Ga0207709_10181690	3300025935	Bacteria	1486
160	Ga0207704_10036916	3300025938	Bacteria	2817
161	Ga0207665_10000252	3300025939	Bacteria	37009
162	Ga0207665_10129044	3300025939	Bacteria	1793
163	Ga0207691_10069809	3300025940	Bacteria	3173
164	Ga0207689_10001274	3300025942	Bacteria	24296
165	Ga0207689_10007841	3300025942	Bacteria	9334
166	Ga0207667_10290538	3300025949	Bacteria	1670
167	Ga0207651_10106315	3300025960	Bacteria	2095
168	Ga0207668_10000208	3300025972	Bacteria	39588
169	Ga0207668_10003448	3300025972	Bacteria	9278
170	Ga0207677_10096029	3300026023	Bacteria	2168
171	Ga0207703_10066469	3300026035	Bacteria	2966
172	Ga0207678_10013112	3300026067	Bacteria	7272
173	Ga0207678_10015092	3300026067	Bacteria	6797
174	Ga0207678_10064089	3300026067	Bacteria	3158
175	Ga0207678_10068191	3300026067	Bacteria	3053
176	Ga0207678_10084667	3300026067	Bacteria	2711
177	Ga0207708_10016133	3300026075	Bacteria	5611
178	Ga0207641_10110733	3300026088	Bacteria	2434
179	Ga0207648_10001489	3300026089	Bacteria	25802
180	Ga0207648_10018534	3300026089	Bacteria	6300
181	Ga0207676_10078906	3300026095	Bacteria	2668
182	Ga0207675_100038640	3300026118	Bacteria	4454
183	Ga0207683_10006024	3300026121	Bacteria	10381
184	Ga0207683_10007846	3300026121	Bacteria	9135
185	Ga0207683_10056151	3300026121	Bacteria	3453
186	Ga0207428_10000093	3300027907	Bacteria	123740
187	Ga0268265_10053244	3300028380	Bacteria	3065
188	Ga0268264_10100005	3300028381	Bacteria	2518
189	Ga0307511_10000158	3300030521	Bacteria	65261
190	Ga0307511_10052480	3300030521	Bacteria	3248
191	Ga0265327_10000154	3300031251	Bacteria	148866
192	Ga0307509_10008175	3300031507	Bacteria	13399
193	Ga0307508_10080422	3300031616	Bacteria	2841
194	Ga0316576_10034606	3300031727	Bacteria	3601
195	Ga0316576_10082992	3300031727	Bacteria	2380
196	Ga0307518_10000403	3300031838	Bacteria	33266
197	Ga0307410_10002879	3300031852	Bacteria	8469
198	Ga0307410_10161768	3300031852	Bacteria	1678
199	Ga0307415_100108671	3300032126	Bacteria	2053
200	Ga0307507_10026256	3300033179	Bacteria	6285
201	Ga0307507_10047378	3300033179	Bacteria	4198
202	Ga0373941_0026720	3300035115	Bacteria	1679
203	Ga0373941_0072809	3300035115	Bacteria	1144
204	Ga0373956_0000712	3300035119	Bacteria	13688
205	Ga0316574_0091044	3300035398	Bacteria	1944
206	Ga0373931_0008224	3300035691	Bacteria	4943
207	Ga0373931_0049164	3300035691	Bacteria	2238
208	Ga0316584_0011852	3300036712	Bacteria	6141
209	Ga0316584_0019126	3300036712	Bacteria	4948
210	Ga0316584_0095530	3300036712	Bacteria	2225
211	Ga0395899_0024205	3300037312	Bacteria	4593
212	Ga0395900_0006652	3300037418	Bacteria	12018
213	Ga0395898_0000131	3300037466	Bacteria	192369
214	Ga0395898_0205327	3300037466	Bacteria	1880
215	Ga0436364_0256774	3300037853	Bacteria	34884
216	Ga0395901_0027454	3300038443	Bacteria	5849
217	Ga0436365_1177168	3300039437	Bacteria	16605
218	Ga0436363_0781631	3300039450	Bacteria	5117
219	Ga0439466_0039127	3300041411	Bacteria	1591
220	Ga0439465_0004950	3300041413	Bacteria	4280
221	Ga0439465_0042105	3300041413	Bacteria	1479
222	Ga0451853_4022059	3300041512	Bacteria	2051
223	Ga0439448_0016471	3300042005	Bacteria	2250
224	Ga0466969_0001505	3300044656	Bacteria	12535
225	Ga0466969_0022590	3300044656	Bacteria	3246
226	Ga0466972_0017975	3300044658	Bacteria	3536
227	Ga0466972_0026736	3300044658	Bacteria	2858
228	Ga0466972_0101387	3300044658	Bacteria	1362
229	Ga0466965_0011847	3300044683	Bacteria	4093
230	Ga0466965_0012764	3300044683	Bacteria	3956
231	Ga0466965_0037625	3300044683	Bacteria	2376
232	Ga0466966_0006804	3300044684	Bacteria	7576
233	Ga0466966_0020283	3300044684	Bacteria	4374
234	Ga0466966_0042755	3300044684	Bacteria	2907
235	Ga0466961_0004780	3300044693	Bacteria	8528
236	Ga0466961_0004902	3300044693	Bacteria	8415
237	Ga0466961_0007565	3300044693	Bacteria	6916
238	Ga0466961_0007869	3300044693	Bacteria	6786
239	Ga0466961_0026917	3300044693	Bacteria	3698
240	Ga0466963_0059008	3300044694	Bacteria	2560
241	Ga0466964_0033540	3300044706	Bacteria	2046
242	Ga0466971_0000060	3300044719	Bacteria	42431
243	Ga0466968_0008354	3300044735	Bacteria	3964
244	Ga0466968_0021189	3300044735	Bacteria	2631
245	Ga0466970_0000558	3300044765	Bacteria	18194
246	Ga0466970_0030152	3300044765	Bacteria	2859
247	Ga0466970_0079736	3300044765	Bacteria	1768
248	Ga0466970_0099294	3300044765	Bacteria	1585
249	Ga0466957_0013361	3300044842	Bacteria	4764
250	Ga0466960_0000215	3300044901	Bacteria	19879
251	Ga0466960_0008748	3300044901	Bacteria	4155
252	Ga0466960_0012670	3300044901	Bacteria	3565
253	Ga0466959_0000813	3300045049	Bacteria	18384
254	Ga0466959_0010322	3300045049	Bacteria	6669
255	Ga0466959_0011628	3300045049	Bacteria	6328
256	Ga0466959_0067299	3300045049	Bacteria	2597
257	Ga0466958_0008792	3300045836	Bacteria	5608
258	Ga0466958_0031090	3300045836	Bacteria	3173
259	Ga0466967_0209708	3300045976	Bacteria	1847
260	Ga0495638_0006493	3300046460	Bacteria	8504
261	Ga0495638_0093979	3300046460	Bacteria	1802
262	Ga0495641_0013742	3300046461	Bacteria	4425
263	Ga0495651_0003391	3300046462	Bacteria	12226
264	Ga0495582_0019401	3300046473	Bacteria	3717
265	Ga0495606_0035417	3300046507	Bacteria	3411
266	Ga0495618_0005443	3300046514	Bacteria	7758
267	Ga0495618_0032069	3300046514	Bacteria	3291
268	Ga0495628_0059084	3300046516	Bacteria	3011
269	Ga0495652_0000965	3300046529	Bacteria	32930
270	Ga0495586_0073290	3300046535	Bacteria	1873
271	Ga0495656_0021750	3300046615	Bacteria	2501
272	Ga0495668_0083195	3300046616	Bacteria	1755
273	Ga0495634_0049912	3300046642	Bacteria	2812
274	Ga0495635_0017952	3300046663	Bacteria	4941
275	Ga0495623_0007379	3300046679	Bacteria	7137
276	Ga0495669_0021394	3300046684	Bacteria	2806
277	Ga0495624_0008396	3300046690	Bacteria	7206
278	Ga0495674_0042540	3300047319	Bacteria	4051
279	Ga0495686_0002058	3300047472	Bacteria	19803
280	Ga0496100_0000009	3300048903	Bacteria	225785
281	Ga0496100_0008299	3300048903	Bacteria	5790
282	Ga0496100_0010615	3300048903	Bacteria	5219
283	Ga0496100_0011910	3300048903	Bacteria	4966
284	Ga0496101_0000077	3300048904	Bacteria	109236
285	Ga0496101_0000288	3300048904	Bacteria	35087
286	Ga0496101_0009771	3300048904	Bacteria	6318
287	Ga0496101_0015917	3300048904	Bacteria	5074
288	Ga0496101_0100015	3300048904	Bacteria	2169
289	Ga0496102_0000037	3300048905	Bacteria	199368
290	Ga0496102_0003075	3300048905	Bacteria	14131
291	Ga0496102_0006379	3300048905	Bacteria	10055
292	Ga0496102_0018186	3300048905	Bacteria	6169
293	Ga0496102_0140058	3300048905	Bacteria	2268
294	Ga0496102_0248019	3300048905	Bacteria	1679
295	Ga0496103_0000004	3300048906	Bacteria	510080
296	Ga0496103_0004671	3300048906	Bacteria	8294
297	Ga0496103_0007467	3300048906	Bacteria	6517
298	Ga0496104_0030240	3300048907	Bacteria	5031
299	Ga0496104_0118906	3300048907	Bacteria	2537
300	Ga0496104_0152408	3300048907	Bacteria	2218
301	Ga0496105_0021274	3300048908	Bacteria	5249
302	Ga0496105_0114787	3300048908	Bacteria	2221
303	Ga0496105_0216029	3300048908	Bacteria	1562
304	Ga0496106_0000234	3300048909	Bacteria	38804
305	Ga0496106_0001893	3300048909	Bacteria	15673
306	Ga0496106_0034496	3300048909	Bacteria	3779
307	Ga0496107_0000516	3300048910	Bacteria	21498
308	Ga0496107_0000543	3300048910	Bacteria	21121
309	Ga0496107_0033449	3300048910	Bacteria	3678
310	Ga0496108_0000985	3300048911	Bacteria	22155
311	Ga0496108_0020519	3300048911	Bacteria	5433
312	Ga0496108_0023056	3300048911	Bacteria	5121
313	Ga0496108_0024497	3300048911	Bacteria	4969
314	Ga0496108_0121927	3300048911	Bacteria	2237
315	Ga0496109_0000861	3300048912	Bacteria	25315
316	Ga0496109_0008171	3300048912	Bacteria	8876
317	Ga0496109_0058701	3300048912	Bacteria	3515
318	Ga0496109_0138540	3300048912	Bacteria	2275
319	Ga0496110_0122427	3300048913	Bacteria	2345
320	Ga0496111_0033827	3300048914	Bacteria	3646
321	Ga0496112_0031961	3300048915	Bacteria	5109
322	Ga0496113_0048674	3300048916	Bacteria	3155
323	Ga0496113_0094444	3300048916	Bacteria	2310
324	Ga0496113_0182687	3300048916	Bacteria	1663
325	Ga0496113_0287258	3300048916	Bacteria	1316
326	Ga0496114_0000351	3300048917	Bacteria	33725
327	Ga0496114_0000849	3300048917	Bacteria	22880
328	Ga0496114_0003981	3300048917	Bacteria	11408
329	Ga0496114_0005631	3300048917	Bacteria	9828
330	Ga0496114_0097476	3300048917	Bacteria	2505
331	Ga0496115_0001951	3300048918	Bacteria	14718
332	Ga0496115_0006208	3300048918	Bacteria	8740
333	Ga0496116_0000056	3300048919	Bacteria	282554
334	Ga0496116_0033286	3300048919	Bacteria	3659
335	Ga0496117_0000003	3300048920	Bacteria	1881097
336	Ga0496117_0001286	3300048920	Bacteria	36999
337	Ga0496117_0002183	3300048920	Bacteria	25524
338	Ga0496117_0027818	3300048920	Bacteria	4393
339	Ga0496117_0029522	3300048920	Bacteria	4226
340	Ga0496117_0039546	3300048920	Bacteria	3479
341	Ga0496118_0000001	3300048921	Bacteria	1881100
342	Ga0496118_0000341	3300048921	Bacteria	79469
343	Ga0496118_0017511	3300048921	Bacteria	6517
344	Ga0496118_0018141	3300048921	Bacteria	6363
345	Ga0496119_0048447	3300048922	Bacteria	2634
346	Ga0496120_0006402	3300048923	Bacteria	9048
347	Ga0496120_0027250	3300048923	Bacteria	3518
348	Ga0496121_0000023	3300048924	Bacteria	463448
349	Ga0496121_0004550	3300048924	Bacteria	18538
350	Ga0496122_0000038	3300048925	Bacteria	295624
351	Ga0496122_0028807	3300048925	Bacteria	4700
352	Ga0496122_0158499	3300048925	Bacteria	1384
353	Ga0496123_0005870	3300048926	Bacteria	12159
354	Ga0496123_0006035	3300048926	Bacteria	11906
355	Ga0496123_0056258	3300048926	Bacteria	2573
356	Ga0496124_0000014	3300048927	Bacteria	463448
357	Ga0496125_0000020	3300048928	Bacteria	463448
358	Ga0496125_0072078	3300048928	Bacteria	2694
359	Ga0496126_0000023	3300048929	Bacteria	463448
360	Ga0496126_0000735	3300048929	Bacteria	59474
361	Ga0496126_0024059	3300048929	Bacteria	5886
362	Ga0496126_0031077	3300048929	Bacteria	5050
363	Ga0496126_0146835	3300048929	Bacteria	2025
364	Ga0501031_0140012	3300049568	Bacteria	1581
365	Ga0501032_0024588	3300049569	Bacteria	4157
366	Ga0501034_0013366	3300049571	Bacteria	8452
367	Ga0501034_0016382	3300049571	Bacteria	7608
368	Ga0501034_0017370	3300049571	Bacteria	7378
369	Ga0501034_0021181	3300049571	Bacteria	6630
370	Ga0501034_0078914	3300049571	Bacteria	3295
371	Ga0501034_0091892	3300049571	Bacteria	3032
372	Ga0501037_0201100	3300049573	Bacteria	1408
373	Ga0501039_0036262	3300049575	Bacteria	3805
374	Ga0501047_0001409	3300049581	Bacteria	23584
375	Ga0501069_0171182	3300049585	Bacteria	1253
376	Ga0501070_0000483	3300049586	Bacteria	36192
377	Ga0501070_0003397	3300049586	Bacteria	13820
378	Ga0501070_0019010	3300049586	Bacteria	5763
379	Ga0501071_0038291	3300049587	Bacteria	3426
380	Ga0501072_0094485	3300049588	Bacteria	2376
381	Ga0501073_0147240	3300049589	Bacteria	1632
382	Ga0501080_0386130	3300049742	Bacteria	1261
383	Ga0501083_0221990	3300049744	Bacteria	1231
384	Ga0501035_0001462	3300049822	Bacteria	24206
385	Ga0501035_0048873	3300049822	Bacteria	3792
386	Ga0501044_0000898	3300049823	Bacteria	35963
387	nmdc:mga03683_5153_c1	3300050489	Bacteria	4392
388	nmdc:mga03n38_3463_c1	3300050490	Bacteria	5073
389	nmdc:mga03n38_6382_c1	3300050490	Bacteria	4092
390	nmdc:mga00v17_24999_c1	3300050491	Bacteria	3467
391	nmdc:mga00v17_40860_c1	3300050491	Bacteria	2783
392	nmdc:mga00v17_4696_c1	3300050491	Bacteria	7137
393	nmdc:mga0yw44_14358_c1	3300050492	Bacteria	4204
394	nmdc:mga0yw44_7309_c1	3300050492	Bacteria	5422
395	nmdc:mga0k408_3524_c1	3300050493	Bacteria	8269
396	nmdc:mga06z11_3014_c1	3300050494	Bacteria	6478
397	nmdc:mga06z11_33757_c1	3300050494	Bacteria	2506
398	nmdc:mga07m45_3242_c1	3300050496	Bacteria	7816
399	nmdc:mga07m45_3435_c1	3300050496	Bacteria	7630
400	nmdc:mga05p37_150800_c1	3300050507	Bacteria	2843
401	nmdc:mga0qj67_7034_c1	3300050509	Bacteria	8295
402	nmdc:mga06r32_28414_c1	3300050510	Bacteria	5233
403	nmdc:mga08y16_14030_c1	3300050511	Bacteria	8435
404	nmdc:mga0sz30_17558_c1	3300050516	Bacteria	1652
405	nmdc:mga0sz30_2922_c1	3300050516	Bacteria	6127
406	nmdc:mga0sz30_59162_c1	3300050516	Bacteria	1635
407	Ga0495601_0022328	3300053077	Bacteria	3883
408	Ga0495612_0015854	3300053078	Bacteria	3020
409	Ga0500643_005848	3300053087	Bacteria	5229
410	Ga0500559_0005028	3300053136	Bacteria	6135
411	Ga0500559_0010379	3300053136	Bacteria	4001
412	Ga0500559_0010874	3300053136	Bacteria	3900
413	Ga0500573_0020966	3300053140	Bacteria	3743
414	Ga0500573_0024247	3300053140	Bacteria	3487
415	Ga0500573_0028821	3300053140	Bacteria	3199
416	Ga0500577_0001503	3300053142	Bacteria	5947
417	Ga0500577_0015736	3300053142	Bacteria	2370
418	Ga0500616_0038013	3300053153	Bacteria	2602
419	Ga0500645_000195	3300053730	Bacteria	47101
420	Ga0466962_0001778	3300061719	Bacteria	10143
421	Ga0466962_0007816	3300061719	Bacteria	5126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009148	Ga0105243_10268725	Ga0105243_102687252	307
2	3300035115	Ga0373941_0072809	Ga0373941_0072809_198_1133	307
3	3300031507	Ga0307509_10008175	Ga0307509_100081759	317
4	3300013105	Ga0157369_10242055	Ga0157369_102420552	321
5	3300044658	Ga0466972_0017975	Ga0466972_0017975_1558_2640	322
6	3300044684	Ga0466966_0042755	Ga0466966_0042755_186_1268	322
7	3300003578	Ga0006562J51391_1051274	Ga0006562J51391_10512741	323
8	3300044735	Ga0466968_0021189	Ga0466968_0021189_608_1687	323
9	3300044901	Ga0466960_0012670	Ga0466960_0012670_509_1588	323
10	3300048916	Ga0496113_0287258	Ga0496113_0287258_181_1272	323
11	3300048920	Ga0496117_0002183	Ga0496117_0002183_1181_2272	323
12	3300003752	Ga0055539_1000008	Ga0055539_1000008428	324
13	3300003756	Ga0055533_1000001	Ga0055533_1000001642	324
14	3300003759	Ga0055525_1000329	Ga0055525_100032924	324
15	3300003841	Ga0055541_1001710	Ga0055541_10017103	324
16	3300025225	Ga0209566_100026	Ga0209566_10002681	324
17	3300025226	Ga0209674_100001	Ga0209674_100001643	324
18	3300025230	Ga0209563_100001	Ga0209563_100001643	324
19	3300025253	Ga0209677_100001	Ga0209677_100001643	324
20	3300044693	Ga0466961_0026917	Ga0466961_0026917_415_1497	326
21	3300045049	Ga0466959_0011628	Ga0466959_0011628_1503_2585	327
22	3300049571	Ga0501034_0078914	Ga0501034_0078914_1282_2358	327
23	3300048925	Ga0496122_0028807	Ga0496122_0028807_2924_4009	328
24	3300048926	Ga0496123_0056258	Ga0496123_0056258_135_1220	328
25	3300053142	Ga0500577_0015736	Ga0500577_0015736_579_1661	329
26	3300025272	Ga0209455_1000886	Ga0209455_10008866	330
27	3300049571	Ga0501034_0013366	Ga0501034_0013366_4104_5180	330
28	3300053142	Ga0500577_0001503	Ga0500577_0001503_2328_3410	332
29	3300049744	Ga0501083_0221990	Ga0501083_0221990_25_1107	334
30	3300025230	Ga0209563_100532	Ga0209563_1005323	335
31	3300005937	Ga0081455_10087536	Ga0081455_100875362	338
32	3300049571	Ga0501034_0017370	Ga0501034_0017370_3437_4513	340
33	3300053136	Ga0500559_0005028	Ga0500559_0005028_4303_5391	344
34	3300053140	Ga0500573_0028821	Ga0500573_0028821_395_1471	344
35	3300026067	Ga0207678_10084667	Ga0207678_100846672	345
36	3300053136	Ga0500559_0010874	Ga0500559_0010874_1988_3073	345
37	3300006051	Ga0075364_10023071	Ga0075364_100230712	350
38	3300050491	nmdc:mga00v17_40860_c1	nmdc:mga00v17_40860_c1_542_1717	350
39	3300053140	Ga0500573_0024247	Ga0500573_0024247_2288_3370	350
40	3300037466	Ga0395898_0205327	Ga0395898_0205327_150_1247	351
41	3300038443	Ga0395901_0027454	Ga0395901_0027454_114_1211	351
42	3300046473	Ga0495582_0019401	Ga0495582_0019401_22_1077	351
43	3300005471	Ga0070698_100004377	Ga0070698_10000437719	352
44	3300044765	Ga0466970_0030152	Ga0466970_0030152_1734_2810	353
45	3300044901	Ga0466960_0008748	Ga0466960_0008748_1190_2266	353
46	3300010375	Ga0105239_10008590	Ga0105239_100085905	354
47	3300048920	Ga0496117_0001286	Ga0496117_0001286_28927_30045	355
48	3300049571	Ga0501034_0016382	Ga0501034_0016382_1443_2519	355
49	3300049573	Ga0501037_0201100	Ga0501037_0201100_289_1365	355
50	3300053140	Ga0500573_0020966	Ga0500573_0020966_1905_2981	355
51	iso_pu_bacteria	2904430863	2904432755	355
52	iso_pu_bacteria	2904501621	2904503200	355
53	iso_pu_bacteria	2908674828	2908675623	355
54	iso_pu_bacteria	2909074476	2909074670	355
55	iso_pu_bacteria	2919039151	2919040868	355
56	iso_pu_bacteria	2928500415	2928500607	355
57	3300048905	Ga0496102_0248019	Ga0496102_0248019_572_1663	356
58	3300048920	Ga0496117_0029522	Ga0496117_0029522_128_1219	356
59	3300048921	Ga0496118_0018141	Ga0496118_0018141_3685_4776	356
60	iso_pu_bacteria	2808606447	2809226945	356
61	iso_pu_bacteria	2908678064	2908678884	356
62	iso_pu_bacteria	2919055335	2919057957	356
63	iso_pu_bacteria	2919069694	2919071235	356
64	iso_pu_bacteria	2919523602	2919524351	356
65	iso_pu_bacteria	2928153084	2928156033	356
66	iso_pu_bacteria	2939657138	2939657489	356
67	iso_pu_bacteria	2966921586	2966921656	356
68	iso_pu_bacteria	2974294766	2974297933	356
69	iso_pu_bacteria	2974324384	2974325828	356
70	iso_pu_bacteria	2977251589	2977251743	356
71	iso_pu_bacteria	2977264416	2977266012	356
72	3300003760	Ga0055527_1000001	Ga0055527_1000001251	357
73	3300003763	Ga0055529_1000018	Ga0055529_1000018245	357
74	3300025228	Ga0209672_100006	Ga0209672_100006725	357
75	3300025242	Ga0209258_101418	Ga0209258_1014186	357
76	3300025254	Ga0209148_1000015	Ga0209148_1000015569	357
77	3300025272	Ga0209455_1000013	Ga0209455_1000013569	357
78	3300049571	Ga0501034_0091892	Ga0501034_0091892_1124_2206	357
79	3300049585	Ga0501069_0171182	Ga0501069_0171182_101_1183	357
80	3300049586	Ga0501070_0000483	Ga0501070_0000483_7974_9062	357
81	3300049586	Ga0501070_0003397	Ga0501070_0003397_11497_12579	357
82	3300049587	Ga0501071_0038291	Ga0501071_0038291_1672_2754	357
83	3300049822	Ga0501035_0048873	Ga0501035_0048873_960_2048	357
84	iso_pu_bacteria	2643221635	2644198986	357
85	iso_pu_bacteria	2844841374	2844842310	357
86	iso_pu_bacteria	2857720070	2857722594	357
87	iso_pu_bacteria	2857733635	2857736888	357
88	iso_pu_bacteria	2906799679	2906801142	357
89	iso_pu_bacteria	2984580707	2984581948	357
90	3300006186	Ga0075369_10016645	Ga0075369_100166452	358
91	3300013308	Ga0157375_10200089	Ga0157375_102000892	358
92	3300026121	Ga0207683_10056151	Ga0207683_100561512	358
93	3300037312	Ga0395899_0024205	Ga0395899_0024205_1169_2263	358
94	3300037418	Ga0395900_0006652	Ga0395900_0006652_3952_5046	358
95	3300037466	Ga0395898_0000131	Ga0395898_0000131_30162_31256	358
96	3300044765	Ga0466970_0000558	Ga0466970_0000558_3839_4924	358
97	3300050516	nmdc:mga0sz30_17558_c1	nmdc:mga0sz30_17558_c1_75_1157	358
98	iso_pu_bacteria	2808606368	2808885152	358
99	3300049568	Ga0501031_0140012	Ga0501031_0140012_23_1114	359
100	3300049569	Ga0501032_0024588	Ga0501032_0024588_2338_3429	359
101	3300049581	Ga0501047_0001409	Ga0501047_0001409_2942_4033	359
102	3300049742	Ga0501080_0386130	Ga0501080_0386130_33_1124	359
103	3300049822	Ga0501035_0001462	Ga0501035_0001462_8198_9289	359
104	3300049823	Ga0501044_0000898	Ga0501044_0000898_22088_23179	359
105	3300005340	Ga0070689_100015797	Ga0070689_1000157977	361
106	3300005365	Ga0070688_100011544	Ga0070688_1000115444	361
107	3300005438	Ga0070701_10001398	Ga0070701_1000139810	361
108	3300005441	Ga0070700_100091377	Ga0070700_1000913772	361
109	3300005459	Ga0068867_100005134	Ga0068867_1000051345	361
110	3300005544	Ga0070686_100097337	Ga0070686_1000973372	361
111	3300005564	Ga0070664_100244651	Ga0070664_1002446511	361
112	3300005842	Ga0068858_100006639	Ga0068858_1000066396	361
113	3300005844	Ga0068862_100069563	Ga0068862_1000695632	361
114	3300006178	Ga0075367_10033178	Ga0075367_100331782	361
115	3300006195	Ga0075366_10001079	Ga0075366_1000107911	361
116	3300006237	Ga0097621_100071819	Ga0097621_1000718193	361
117	3300006844	Ga0075428_100084453	Ga0075428_1000844533	361
118	3300006846	Ga0075430_100072600	Ga0075430_1000726002	361
119	3300009094	Ga0111539_10000070	Ga0111539_1000007071	361
120	3300009148	Ga0105243_10016111	Ga0105243_100161117	361
121	3300009177	Ga0105248_10104920	Ga0105248_101049202	361
122	3300013308	Ga0157375_10035053	Ga0157375_100350532	361
123	3300014326	Ga0157380_10107587	Ga0157380_101075872	361
124	3300014745	Ga0157377_10009031	Ga0157377_100090312	361
125	3300025907	Ga0207645_10071106	Ga0207645_100711062	361
126	3300025908	Ga0207643_10089749	Ga0207643_100897492	361
127	3300025918	Ga0207662_10016330	Ga0207662_100163302	361
128	3300025938	Ga0207704_10036916	Ga0207704_100369162	361
129	3300025940	Ga0207691_10069809	Ga0207691_100698093	361
130	3300025942	Ga0207689_10007841	Ga0207689_100078417	361
131	3300025960	Ga0207651_10106315	Ga0207651_101063152	361
132	3300026035	Ga0207703_10066469	Ga0207703_100664692	361
133	3300026075	Ga0207708_10016133	Ga0207708_100161334	361
134	3300026089	Ga0207648_10001489	Ga0207648_100014899	361
135	3300026118	Ga0207675_100038640	Ga0207675_1000386405	361
136	3300026121	Ga0207683_10006024	Ga0207683_100060245	361
137	3300027907	Ga0207428_10000093	Ga0207428_1000009326	361
138	3300028380	Ga0268265_10053244	Ga0268265_100532443	361
139	3300028381	Ga0268264_10100005	Ga0268264_101000052	361
140	3300036712	Ga0316584_0011852	Ga0316584_0011852_2162_3418	361
141	3300044765	Ga0466970_0099294	Ga0466970_0099294_244_1422	361
142	3300046615	Ga0495656_0021750	Ga0495656_0021750_998_2104	361
143	3300046684	Ga0495669_0021394	Ga0495669_0021394_467_1639	361
144	3300050491	nmdc:mga00v17_24999_c1	nmdc:mga00v17_24999_c1_2062_3234	361
145	3300050493	nmdc:mga0k408_3524_c1	nmdc:mga0k408_3524_c1_3118_4290	361
146	3300050494	nmdc:mga06z11_3014_c1	nmdc:mga06z11_3014_c1_1603_2775	361
147	3300050511	nmdc:mga08y16_14030_c1	nmdc:mga08y16_14030_c1_5876_7048	361
148	3300005937	Ga0081455_10000011	Ga0081455_10000011106	363
149	3300009545	Ga0105237_10000346	Ga0105237_1000034632	363
150	3300053153	Ga0500616_0038013	Ga0500616_0038013_161_1339	364
151	3300005434	Ga0070709_10000299	Ga0070709_1000029932	365
152	3300005435	Ga0070714_100002658	Ga0070714_10000265811	365
153	3300005436	Ga0070713_100002813	Ga0070713_1000028131	365
154	3300005437	Ga0070710_10000090	Ga0070710_1000009013	365
155	3300005439	Ga0070711_100008955	Ga0070711_1000089554	365
156	3300005467	Ga0070706_100038284	Ga0070706_1000382842	365
157	3300005471	Ga0070698_100004722	Ga0070698_1000047225	365
158	3300006028	Ga0070717_10008227	Ga0070717_100082273	365
159	3300006028	Ga0070717_10155509	Ga0070717_101555092	365
160	3300006173	Ga0070716_100000110	Ga0070716_10000011026	365
161	3300006175	Ga0070712_100003847	Ga0070712_1000038472	365
162	3300025898	Ga0207692_10000065	Ga0207692_1000006519	365
163	3300025906	Ga0207699_10000424	Ga0207699_1000042417	365
164	3300025910	Ga0207684_10017833	Ga0207684_100178332	365
165	3300025915	Ga0207693_10005934	Ga0207693_100059343	365
166	3300025916	Ga0207663_10001352	Ga0207663_100013524	365
167	3300025922	Ga0207646_10166975	Ga0207646_101669751	365
168	3300025928	Ga0207700_10000126	Ga0207700_1000012635	365
169	3300025929	Ga0207664_10000148	Ga0207664_1000014838	365
170	3300025939	Ga0207665_10000252	Ga0207665_100002526	365
171	3300046514	Ga0495618_0005443	Ga0495618_0005443_234_1391	365
172	3300048929	Ga0496126_0146835	Ga0496126_0146835_32_1177	365
173	3300044706	Ga0466964_0033540	Ga0466964_0033540_355_1638	366
174	3300048905	Ga0496102_0000037	Ga0496102_0000037_130081_131238	366
175	3300048906	Ga0496103_0000004	Ga0496103_0000004_440793_441950	366
176	3300048919	Ga0496116_0000056	Ga0496116_0000056_240745_241902	366
177	3300048920	Ga0496117_0000003	Ga0496117_0000003_1639196_1640353	366
178	3300048921	Ga0496118_0000001	Ga0496118_0000001_1639199_1640356	366
179	3300048903	Ga0496100_0010615	Ga0496100_0010615_415_1572	367
180	3300048904	Ga0496101_0000077	Ga0496101_0000077_67968_69125	367
181	3300048908	Ga0496105_0114787	Ga0496105_0114787_164_1321	367
182	3300048922	Ga0496119_0048447	Ga0496119_0048447_1025_2182	367
183	3300048923	Ga0496120_0006402	Ga0496120_0006402_3023_4180	367
184	3300048924	Ga0496121_0004550	Ga0496121_0004550_14083_15240	367
185	3300048929	Ga0496126_0000735	Ga0496126_0000735_40230_41387	367
186	3300005338	Ga0068868_100180737	Ga0068868_1001807372	368
187	3300005347	Ga0070668_100012969	Ga0070668_1000129694	368
188	3300005367	Ga0070667_100000604	Ga0070667_10000060429	368
189	3300005617	Ga0068859_100195455	Ga0068859_1001954552	368
190	3300006931	Ga0097620_100195440	Ga0097620_1001954402	368
191	3300025972	Ga0207668_10003448	Ga0207668_100034484	368
192	3300026023	Ga0207677_10096029	Ga0207677_100960292	368
193	3300026067	Ga0207678_10015092	Ga0207678_100150926	368
194	3300033179	Ga0307507_10026256	Ga0307507_100262563	368
195	3300044658	Ga0466972_0026736	Ga0466972_0026736_819_2021	368
196	3300044765	Ga0466970_0079736	Ga0466970_0079736_34_1236	368
197	3300048903	Ga0496100_0000009	Ga0496100_0000009_188923_190059	368
198	3300048904	Ga0496101_0000288	Ga0496101_0000288_19263_20399	368
199	3300048905	Ga0496102_0018186	Ga0496102_0018186_4553_5689	368
200	3300048906	Ga0496103_0007467	Ga0496103_0007467_1349_2485	368
201	3300048909	Ga0496106_0000234	Ga0496106_0000234_17748_18884	368
202	3300048910	Ga0496107_0000543	Ga0496107_0000543_2226_3362	368
203	3300048911	Ga0496108_0024497	Ga0496108_0024497_1875_3011	368
204	3300048912	Ga0496109_0000861	Ga0496109_0000861_17562_18698	368
205	3300048914	Ga0496111_0033827	Ga0496111_0033827_990_2126	368
206	3300048917	Ga0496114_0000351	Ga0496114_0000351_24143_25279	368
207	3300048917	Ga0496114_0097476	Ga0496114_0097476_311_1801	368
208	3300048918	Ga0496115_0006208	Ga0496115_0006208_4387_5523	368
209	3300048919	Ga0496116_0033286	Ga0496116_0033286_1304_2440	368
210	3300048920	Ga0496117_0039546	Ga0496117_0039546_155_1291	368
211	3300048921	Ga0496118_0017511	Ga0496118_0017511_4033_5169	368
212	3300048923	Ga0496120_0027250	Ga0496120_0027250_136_1272	368
213	3300048924	Ga0496121_0000023	Ga0496121_0000023_201705_202841	368
214	3300048925	Ga0496122_0000038	Ga0496122_0000038_201705_202841	368
215	3300048926	Ga0496123_0006035	Ga0496123_0006035_9229_10365	368
216	3300048927	Ga0496124_0000014	Ga0496124_0000014_201705_202841	368
217	3300048928	Ga0496125_0000020	Ga0496125_0000020_260608_261744	368
218	3300048929	Ga0496126_0000023	Ga0496126_0000023_201705_202841	368
219	iso_pu_bacteria	2866612099	2866616888	368
220	iso_pu_bacteria	8003314358	8003322427	368
221	3300005445	Ga0070708_100008971	Ga0070708_1000089712	369
222	3300006847	Ga0075431_100030163	Ga0075431_1000301634	369
223	3300025910	Ga0207684_10017506	Ga0207684_100175063	369
224	3300031838	Ga0307518_10000403	Ga0307518_100004035	369
225	3300048913	Ga0496110_0122427	Ga0496110_0122427_1123_2328	369
226	3300049571	Ga0501034_0021181	Ga0501034_0021181_2959_4239	369
227	3300049575	Ga0501039_0036262	Ga0501039_0036262_1481_2761	369
228	3300050507	nmdc:mga05p37_150800_c1	nmdc:mga05p37_150800_c1_47_1219	369
229	3300050510	nmdc:mga06r32_28414_c1	nmdc:mga06r32_28414_c1_1842_3014	369
230	iso_pu_bacteria	2585427649	2586059367	369
231	iso_pu_bacteria	2808606522	2809591878	369
232	iso_pu_bacteria	2915768154	2915775729	369
233	iso_pu_bacteria	2917736166	2917741961	369
234	3300005347	Ga0070668_100000140	Ga0070668_10000014039	370
235	3300005719	Ga0068861_100219158	Ga0068861_1002191582	370
236	3300025972	Ga0207668_10000208	Ga0207668_1000020832	370
237	3300031251	Ga0265327_10000154	Ga0265327_1000015427	370
238	3300031727	Ga0316576_10082992	Ga0316576_100829922	370
239	3300044656	Ga0466969_0001505	Ga0466969_0001505_8343_9563	370
240	3300044693	Ga0466961_0004902	Ga0466961_0004902_1876_3096	370
241	3300044719	Ga0466971_0000060	Ga0466971_0000060_2726_3946	370
242	3300045049	Ga0466959_0000813	Ga0466959_0000813_15191_16411	370
243	3300045836	Ga0466958_0031090	Ga0466958_0031090_403_1623	370
244	3300046462	Ga0495651_0003391	Ga0495651_0003391_8708_9928	370
245	3300046514	Ga0495618_0032069	Ga0495618_0032069_607_1827	370
246	3300046516	Ga0495628_0059084	Ga0495628_0059084_561_1781	370
247	3300046529	Ga0495652_0000965	Ga0495652_0000965_17330_18550	370
248	3300046535	Ga0495586_0073290	Ga0495586_0073290_181_1401	370
249	3300046642	Ga0495634_0049912	Ga0495634_0049912_1505_2725	370
250	3300046663	Ga0495635_0017952	Ga0495635_0017952_43_1263	370
251	3300046679	Ga0495623_0007379	Ga0495623_0007379_267_1487	370
252	3300047319	Ga0495674_0042540	Ga0495674_0042540_755_1975	370
253	3300053077	Ga0495601_0022328	Ga0495601_0022328_1017_2237	370
254	3300053078	Ga0495612_0015854	Ga0495612_0015854_1017_2237	370
255	3300061719	Ga0466962_0001778	Ga0466962_0001778_6035_7255	370
256	3300005337	Ga0070682_100112013	Ga0070682_1001120131	371
257	3300005353	Ga0070669_100035590	Ga0070669_1000355902	371
258	3300030521	Ga0307511_10000158	Ga0307511_1000015843	371
259	3300031852	Ga0307410_10161768	Ga0307410_101617682	371
260	3300032126	Ga0307415_100108671	Ga0307415_1001086712	371
261	3300033179	Ga0307507_10047378	Ga0307507_100473784	371
262	3300044656	Ga0466969_0022590	Ga0466969_0022590_822_2054	371
263	3300044684	Ga0466966_0006804	Ga0466966_0006804_2059_3291	371
264	3300044693	Ga0466961_0007869	Ga0466961_0007869_1160_2392	371
265	3300045049	Ga0466959_0010322	Ga0466959_0010322_1358_2590	371
266	iso_pu_bacteria	2582580736	2583150498	371
267	iso_pu_bacteria	2816332139	2816504613	371
268	3300031727	Ga0316576_10034606	Ga0316576_100346063	372
269	3300035398	Ga0316574_0091044	Ga0316574_0091044_68_1300	372
270	3300036712	Ga0316584_0095530	Ga0316584_0095530_883_2115	372
271	3300006847	Ga0075431_100215532	Ga0075431_1002155322	373
272	3300041512	Ga0451853_4022059	Ga0451853_4022059_563_1717	373
273	3300046507	Ga0495606_0035417	Ga0495606_0035417_1909_3057	373
274	3300030521	Ga0307511_10052480	Ga0307511_100524802	374
275	3300031616	Ga0307508_10080422	Ga0307508_100804222	374
276	iso_pu_bacteria	2738541264	2738666604	374
277	iso_pu_bacteria	2738541356	2739145448	374
278	3300003792	Ga0055540_1000029	Ga0055540_1000029140	375
279	3300006048	Ga0075363_100023949	Ga0075363_1000239492	375
280	3300025303	Ga0209051_1000042	Ga0209051_1000042285	375
281	3300046616	Ga0495668_0083195	Ga0495668_0083195_330_1487	375
282	3300048917	Ga0496114_0003981	Ga0496114_0003981_7439_8617	375
283	3300048928	Ga0496125_0072078	Ga0496125_0072078_880_2037	375
284	iso_pu_bacteria	2565956761	2566996457	375
285	iso_pu_bacteria	2738541308	2738889992	375
286	iso_pu_bacteria	2738543005	2739205361	375
287	iso_pu_bacteria	2738543011	2739238763	375
288	iso_pu_bacteria	2744054611	2744957084	375
289	iso_pu_bacteria	2889300758	2889301038	375
290	iso_pu_bacteria	2904535858	2904538971	375
291	iso_pu_bacteria	2922554459	2922555634	375
292	iso_pu_bacteria	2928142448	2928144934	375
293	iso_pu_bacteria	2939743619	2939744556	375
294	3300035119	Ga0373956_0000712	Ga0373956_0000712_834_2198	376
295	3300005436	Ga0070713_100065841	Ga0070713_1000658413	377
296	3300013105	Ga0157369_10165471	Ga0157369_101654713	377
297	3300021384	Ga0213876_10021368	Ga0213876_100213682	377
298	3300025929	Ga0207664_10224247	Ga0207664_102242472	377
299	3300039437	Ga0436365_1177168	Ga0436365_1177168_2449_3591	377
300	3300045976	Ga0466967_0209708	Ga0466967_0209708_471_1730	377
301	3300048916	Ga0496113_0094444	Ga0496113_0094444_500_1678	377
302	3300048920	Ga0496117_0027818	Ga0496117_0027818_1573_2712	377
303	3300048921	Ga0496118_0000341	Ga0496118_0000341_42639_43778	377
304	3300048925	Ga0496122_0158499	Ga0496122_0158499_133_1311	377
305	3300048926	Ga0496123_0005870	Ga0496123_0005870_9532_10710	377
306	3300048929	Ga0496126_0031077	Ga0496126_0031077_1603_2781	377
307	3300049589	Ga0501073_0147240	Ga0501073_0147240_188_1378	377
308	iso_pu_bacteria	2902810491	2902815485	377
309	3300025914	Ga0207671_10098200	Ga0207671_100982002	378
310	3300042005	Ga0439448_0016471	Ga0439448_0016471_159_1295	378
311	3300044683	Ga0466965_0037625	Ga0466965_0037625_372_1508	378
312	3300009177	Ga0105248_10020824	Ga0105248_100208243	379
313	3300009545	Ga0105237_10006355	Ga0105237_1000635512	379
314	3300046460	Ga0495638_0006493	Ga0495638_0006493_3450_4589	379
315	3300048903	Ga0496100_0011910	Ga0496100_0011910_656_1795	379
316	3300048904	Ga0496101_0015917	Ga0496101_0015917_3433_4572	379
317	3300048905	Ga0496102_0006379	Ga0496102_0006379_190_1329	379
318	3300048907	Ga0496104_0030240	Ga0496104_0030240_2850_3989	379
319	3300048908	Ga0496105_0021274	Ga0496105_0021274_868_2007	379
320	3300048909	Ga0496106_0034496	Ga0496106_0034496_2062_3201	379
321	3300048910	Ga0496107_0033449	Ga0496107_0033449_502_1641	379
322	3300048912	Ga0496109_0138540	Ga0496109_0138540_374_1513	379
323	3300048917	Ga0496114_0005631	Ga0496114_0005631_1077_2216	379
324	3300049586	Ga0501070_0019010	Ga0501070_0019010_2186_3349	379
325	3300049588	Ga0501072_0094485	Ga0501072_0094485_949_2112	379
326	3300002077	JGI24744J21845_10006522	JGI24744J21845_100065222	380
327	3300003792	Ga0055540_1001773	Ga0055540_10017738	380
328	3300003792	Ga0055540_1002004	Ga0055540_10020047	380
329	3300003792	Ga0055540_1017923	Ga0055540_10179232	380
330	3300005334	Ga0068869_100052276	Ga0068869_1000522762	380
331	3300005337	Ga0070682_100019260	Ga0070682_1000192603	380
332	3300005355	Ga0070671_100002923	Ga0070671_1000029232	380
333	3300005364	Ga0070673_100076968	Ga0070673_1000769682	380
334	3300005365	Ga0070688_100093340	Ga0070688_1000933402	380
335	3300005434	Ga0070709_10053436	Ga0070709_100534362	380
336	3300005440	Ga0070705_100003490	Ga0070705_1000034905	380
337	3300005456	Ga0070678_100017707	Ga0070678_1000177073	380
338	3300005459	Ga0068867_100007257	Ga0068867_1000072577	380
339	3300005535	Ga0070684_100076739	Ga0070684_1000767392	380
340	3300005547	Ga0070693_100027859	Ga0070693_1000278592	380
341	3300005718	Ga0068866_10009283	Ga0068866_100092833	380
342	3300005841	Ga0068863_100087333	Ga0068863_1000873332	380
343	3300005843	Ga0068860_100199293	Ga0068860_1001992932	380
344	3300005981	Ga0081538_10055831	Ga0081538_100558312	380
345	3300006038	Ga0075365_10016904	Ga0075365_100169044	380
346	3300006038	Ga0075365_10024618	Ga0075365_100246182	380
347	3300006038	Ga0075365_10127853	Ga0075365_101278531	380
348	3300006048	Ga0075363_100002576	Ga0075363_1000025765	380
349	3300006051	Ga0075364_10003911	Ga0075364_100039118	380
350	3300006051	Ga0075364_10009119	Ga0075364_100091192	380
351	3300006163	Ga0070715_10000417	Ga0070715_1000041711	380
352	3300006175	Ga0070712_100014896	Ga0070712_1000148964	380
353	3300006178	Ga0075367_10022894	Ga0075367_100228943	380
354	3300006353	Ga0075370_10000287	Ga0075370_100002876	380
355	3300006844	Ga0075428_100007408	Ga0075428_1000074082	380
356	3300006846	Ga0075430_100046740	Ga0075430_1000467403	380
357	3300009098	Ga0105245_10003195	Ga0105245_100031954	380
358	3300009098	Ga0105245_10279231	Ga0105245_102792312	380
359	3300009101	Ga0105247_10000456	Ga0105247_1000045617	380
360	3300009147	Ga0114129_10022769	Ga0114129_100227696	380
361	3300009148	Ga0105243_10006505	Ga0105243_100065058	380
362	3300009176	Ga0105242_10013523	Ga0105242_100135232	380
363	3300009177	Ga0105248_10007739	Ga0105248_100077394	380
364	3300009545	Ga0105237_10025145	Ga0105237_100251453	380
365	3300009545	Ga0105237_10115422	Ga0105237_101154222	380
366	3300009553	Ga0105249_10001439	Ga0105249_1000143921	380
367	3300009553	Ga0105249_10022452	Ga0105249_100224523	380
368	3300009553	Ga0105249_10094788	Ga0105249_100947883	380
369	3300010375	Ga0105239_10006651	Ga0105239_100066516	380
370	3300010375	Ga0105239_10037332	Ga0105239_100373325	380
371	3300013296	Ga0157374_10002901	Ga0157374_1000290112	380
372	3300013296	Ga0157374_10095382	Ga0157374_100953822	380
373	3300013297	Ga0157378_10001141	Ga0157378_1000114120	380
374	3300013297	Ga0157378_10108368	Ga0157378_101083683	380
375	3300013306	Ga0163162_10038367	Ga0163162_100383674	380
376	3300013306	Ga0163162_10158061	Ga0163162_101580612	380
377	3300013307	Ga0157372_10002481	Ga0157372_1000248111	380
378	3300014326	Ga0157380_10001262	Ga0157380_1000126217	380
379	3300014326	Ga0157380_10030567	Ga0157380_100305672	380
380	3300014745	Ga0157377_10013413	Ga0157377_100134131	380
381	3300014968	Ga0157379_10012668	Ga0157379_100126686	380
382	3300025303	Ga0209051_1000374	Ga0209051_100037428	380
383	3300025303	Ga0209051_1001633	Ga0209051_10016337	380
384	3300025303	Ga0209051_1013833	Ga0209051_10138332	380
385	3300025303	Ga0209051_1018676	Ga0209051_10186763	380
386	3300025898	Ga0207692_10030595	Ga0207692_100305952	380
387	3300025899	Ga0207642_10071216	Ga0207642_100712162	380
388	3300025901	Ga0207688_10000504	Ga0207688_1000050410	380
389	3300025906	Ga0207699_10017868	Ga0207699_100178682	380
390	3300025915	Ga0207693_10003860	Ga0207693_1000386013	380
391	3300025919	Ga0207657_10053323	Ga0207657_100533232	380
392	3300025935	Ga0207709_10181690	Ga0207709_101816902	380
393	3300025939	Ga0207665_10129044	Ga0207665_101290442	380
394	3300025942	Ga0207689_10001274	Ga0207689_1000127418	380
395	3300025949	Ga0207667_10290538	Ga0207667_102905382	380
396	3300026067	Ga0207678_10013112	Ga0207678_100131126	380
397	3300026067	Ga0207678_10064089	Ga0207678_100640892	380
398	3300026067	Ga0207678_10068191	Ga0207678_100681912	380
399	3300026088	Ga0207641_10110733	Ga0207641_101107332	380
400	3300026089	Ga0207648_10018534	Ga0207648_100185346	380
401	3300026095	Ga0207676_10078906	Ga0207676_100789062	380
402	3300026121	Ga0207683_10007846	Ga0207683_100078463	380
403	3300031852	Ga0307410_10002879	Ga0307410_100028792	380
404	3300035115	Ga0373941_0026720	Ga0373941_0026720_498_1640	380
405	3300035691	Ga0373931_0008224	Ga0373931_0008224_2358_3500	380
406	3300035691	Ga0373931_0049164	Ga0373931_0049164_200_1357	380
407	3300036712	Ga0316584_0019126	Ga0316584_0019126_648_1814	380
408	3300037853	Ga0436364_0256774	Ga0436364_0256774_23079_24242	380
409	3300039450	Ga0436363_0781631	Ga0436363_0781631_3900_5096	380
410	3300041411	Ga0439466_0039127	Ga0439466_0039127_214_1374	380
411	3300041413	Ga0439465_0004950	Ga0439465_0004950_1527_2687	380
412	3300041413	Ga0439465_0042105	Ga0439465_0042105_111_1253	380
413	3300044658	Ga0466972_0101387	Ga0466972_0101387_30_1172	380
414	3300044683	Ga0466965_0011847	Ga0466965_0011847_2935_4077	380
415	3300044683	Ga0466965_0012764	Ga0466965_0012764_270_1457	380
416	3300044684	Ga0466966_0020283	Ga0466966_0020283_2880_4079	380
417	3300044693	Ga0466961_0004780	Ga0466961_0004780_6100_7287	380
418	3300044693	Ga0466961_0007565	Ga0466961_0007565_1418_2560	380
419	3300044694	Ga0466963_0059008	Ga0466963_0059008_745_1932	380
420	3300044735	Ga0466968_0008354	Ga0466968_0008354_115_1257	380
421	3300044842	Ga0466957_0013361	Ga0466957_0013361_356_1543	380
422	3300044901	Ga0466960_0000215	Ga0466960_0000215_4170_5375	380
423	3300045049	Ga0466959_0067299	Ga0466959_0067299_500_1642	380
424	3300045836	Ga0466958_0008792	Ga0466958_0008792_882_2024	380
425	3300046460	Ga0495638_0093979	Ga0495638_0093979_229_1395	380
426	3300046461	Ga0495641_0013742	Ga0495641_0013742_184_1344	380
427	3300046690	Ga0495624_0008396	Ga0495624_0008396_5044_6204	380
428	3300047472	Ga0495686_0002058	Ga0495686_0002058_15622_16770	380
429	3300048903	Ga0496100_0008299	Ga0496100_0008299_1501_2658	380
430	3300048904	Ga0496101_0009771	Ga0496101_0009771_618_1775	380
431	3300048904	Ga0496101_0100015	Ga0496101_0100015_945_2141	380
432	3300048905	Ga0496102_0003075	Ga0496102_0003075_5306_6463	380
433	3300048905	Ga0496102_0140058	Ga0496102_0140058_177_1373	380
434	3300048906	Ga0496103_0004671	Ga0496103_0004671_2206_3363	380
435	3300048907	Ga0496104_0118906	Ga0496104_0118906_761_1903	380
436	3300048907	Ga0496104_0152408	Ga0496104_0152408_864_2006	380
437	3300048908	Ga0496105_0216029	Ga0496105_0216029_215_1372	380
438	3300048909	Ga0496106_0001893	Ga0496106_0001893_6291_7448	380
439	3300048910	Ga0496107_0000516	Ga0496107_0000516_19310_20467	380
440	3300048911	Ga0496108_0000985	Ga0496108_0000985_7411_8553	380
441	3300048911	Ga0496108_0020519	Ga0496108_0020519_1065_2207	380
442	3300048911	Ga0496108_0023056	Ga0496108_0023056_1331_2485	380
443	3300048911	Ga0496108_0121927	Ga0496108_0121927_885_2102	380
444	3300048912	Ga0496109_0008171	Ga0496109_0008171_235_1377	380
445	3300048912	Ga0496109_0058701	Ga0496109_0058701_100_1242	380
446	3300048915	Ga0496112_0031961	Ga0496112_0031961_1556_2698	380
447	3300048916	Ga0496113_0048674	Ga0496113_0048674_556_1698	380
448	3300048916	Ga0496113_0182687	Ga0496113_0182687_336_1478	380
449	3300048917	Ga0496114_0000849	Ga0496114_0000849_15663_16820	380
450	3300048918	Ga0496115_0001951	Ga0496115_0001951_8613_9770	380
451	3300048929	Ga0496126_0024059	Ga0496126_0024059_4616_5782	380
452	3300050489	nmdc:mga03683_5153_c1	nmdc:mga03683_5153_c1_1068_2222	380
453	3300050490	nmdc:mga03n38_3463_c1	nmdc:mga03n38_3463_c1_3511_4665	380
454	3300050490	nmdc:mga03n38_6382_c1	nmdc:mga03n38_6382_c1_1998_3152	380
455	3300050491	nmdc:mga00v17_4696_c1	nmdc:mga00v17_4696_c1_57_1199	380
456	3300050492	nmdc:mga0yw44_14358_c1	nmdc:mga0yw44_14358_c1_1050_2222	380
457	3300050492	nmdc:mga0yw44_7309_c1	nmdc:mga0yw44_7309_c1_3126_4280	380
458	3300050494	nmdc:mga06z11_33757_c1	nmdc:mga06z11_33757_c1_116_1270	380
459	3300050496	nmdc:mga07m45_3242_c1	nmdc:mga07m45_3242_c1_6400_7554	380
460	3300050496	nmdc:mga07m45_3435_c1	nmdc:mga07m45_3435_c1_4873_6027	380
461	3300050509	nmdc:mga0qj67_7034_c1	nmdc:mga0qj67_7034_c1_3228_4370	380
462	3300050516	nmdc:mga0sz30_2922_c1	nmdc:mga0sz30_2922_c1_3116_4258	380
463	3300050516	nmdc:mga0sz30_59162_c1	nmdc:mga0sz30_59162_c1_74_1216	380
464	3300053087	Ga0500643_005848	Ga0500643_005848_4007_5173	380
465	3300053136	Ga0500559_0010379	Ga0500559_0010379_1743_2909	380
466	3300053730	Ga0500645_000195	Ga0500645_000195_35089_36255	380
467	3300061719	Ga0466962_0007816	Ga0466962_0007816_164_1306	380
468	iso_pu_bacteria	2643221687	2644486401	380
469	iso_pu_bacteria	2643221715	2644637320	380
470	iso_pu_bacteria	2738541274	2738706123	380
471	iso_pu_bacteria	2738543028	2739332977	380
472	iso_pu_bacteria	2842134933	2842138396	380
473	iso_pu_bacteria	2902792274	2902798488	380
474	iso_pu_bacteria	2902799365	2902801586	380
475	iso_pu_bacteria	2902837492	2902840182	380
476	iso_pu_bacteria	2929212328	2929214976	380
477	iso_pu_bacteria	2939582691	2939587357	380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08436

DXP_redisom_C

1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain

183

266

0.99 PF13288

DXPR_C

DXP reductoisomerase C-terminal domain

298

417

0.96 PF02670

DXP_reductoisom

1-deoxy-D-xylulose 5-phosphate reductoisomerase

32

171

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3zhx-assembly1.cif.gz_A	structure of mycobacterium tuberculosis dxr in complex with a fosmidomycin analogue	0.9919	2	373
2y1e-assembly1.cif.gz_A	x-ray structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase, dxr, rv2870c, from mycobacterium tuberculosis, in complex with manganese.	0.9904	2	373
2y1d-assembly1.cif.gz_A	x-ray structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase, dxr, rv2870c, from mycobacterium tuberculosis, in complex with a 3,4- dichlorophenyl-substituted fosmidomycin analogue and manganese.	0.99	2	373
3zi0-assembly1.cif.gz_A	structure of mycobacterium tuberculosis dxr in complex with a fosmidomycin analogue	0.9887	2	372
2jcx-assembly1.cif.gz_A	x-ray structure of mutant 1-deoxy-d-xylulose 5-phosphate reductoisomerase, dxr, rv2870c, from mycobacterium tuberculosis, in complex with fosmidomycin and nadph	0.988	2	373

ID	Description	Score	Start	End	Superfamily
3zhyB03	Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif	1.006	290	373	1.10.1740.10
3zhzA03	Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif	1.002	290	373	1.10.1740.10
2jd0A03	Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif	1.002	290	373	1.10.1740.10
2y1dA03	Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif	1	290	373	1.10.1740.10
3zi0A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9762	2	137	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A1P8YLI4-F1-model_v4	DXP reductoisomerase C-terminal domain protein	0.9988	195	375	GO:0016853 GO:0030145 GO:0030604 GO:0051484 GO:0070402
AF-A0A502ELP1-F1-model_v4	1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (EC 1.1.1.267) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase)	0.9983	2	375	GO:0016853 GO:0030145 GO:0030604 GO:0051484 GO:0070402
AF-A0A1G7CAS4-F1-model_v4	deleted	0.998	2	380
AF-A0A7Z7ILB0-F1-model_v4	1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (EC 1.1.1.267) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase)	0.998	2	375	GO:0016853 GO:0030145 GO:0030604 GO:0051484 GO:0070402
AF-A0A7G1IIH5-F1-model_v4	1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (EC 1.1.1.267) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase)	0.9976	42	373	GO:0016853 GO:0030145 GO:0030604 GO:0051484 GO:0070402

Feature Viewer

pLDDT	pTM	Quality
95	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F451751

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08436

DXP_redisom_C

1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain

183

266

0.99

PF13288

DXPR_C

DXP reductoisomerase C-terminal domain

298

417

0.96

PF02670

DXP_reductoisom

1-deoxy-D-xylulose 5-phosphate reductoisomerase

32

171

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map