F451667

General Info

Members Datasets Scaffolds Average Seq Length
477 215 954 200

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10222089|Ga0081539_102220892
Length 211
Sequence MGKMKRLPIGILGSGKGSNCRAILERIRLGDLAAELRLVVSDVLDAPILDIAREFGVANAYLPPGRFRTRLEPQIEEQLTQMLLDAGVELVVLAGFMRVLHQPMLKAFPRRIINIHPSLLPKFPGLEAWKQALVAGETVTGCTVHYVDERIDHGQILAQRELRIWPNDTPNSLHSRIQVLEHELYPAVIAELCQKYAQSVGQPGGDDTEAP

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 5.87
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 38.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10222089 3300005985 Unclassified 859
2 MBSR1b_contig_1384014 2162886012 Unclassified 1287
3 CNXas_1000001 3300000545 Bacteria 91563
4 JGI24743J22301_10001691 3300001991 Unclassified 3140
5 JGI24035J26624_1000699 3300002126 Bacteria 3114
6 JGI25406J46586_10000296 3300003203 Bacteria 22317
7 JGI25405J52794_10000421 3300003911 Bacteria 5972
8 JGI25405J52794_10005599 3300003911 Unclassified 2270
9 Ga0065714_10245764 3300005288 Bacteria 785
10 Ga0065704_10021197 3300005289 Bacteria 2112
11 Ga0065704_10077928 3300005289 Bacteria 4580
12 Ga0065704_10078902 3300005289 Bacteria 4308
13 Ga0065704_10112763 3300005289 Unclassified 1927
14 Ga0065712_10000022 3300005290 Unclassified 3517
15 Ga0065712_10000289 3300005290 Bacteria 15961
16 Ga0065712_10075790 3300005290 Bacteria 3755
17 Ga0065712_10082959 3300005290 Bacteria 2868
18 Ga0065712_10156503 3300005290 Bacteria 1331
19 Ga0065712_10183394 3300005290 Unclassified 1181
20 Ga0065712_10275133 3300005290 Unclassified 900
21 Ga0065715_10000301 3300005293 Bacteria 17479
22 Ga0065715_10000862 3300005293 Bacteria 10705
23 Ga0065715_10002362 3300005293 Bacteria 16129
24 Ga0065715_10015067 3300005293 Bacteria 4442
25 Ga0065715_10105424 3300005293 Bacteria 2893
26 Ga0065715_10158083 3300005293 Unclassified 1656
27 Ga0065715_10171456 3300005293 Bacteria 1543
28 Ga0065715_10574426 3300005293 Unclassified 725
29 Ga0065707_10087047 3300005295 Bacteria 5190
30 Ga0070683_100099164 3300005329 Unclassified 2742
31 Ga0070683_100236675 3300005329 Bacteria 1736
32 Ga0070690_100007963 3300005330 Bacteria 6082
33 Ga0070670_100326551 3300005331 Unclassified 1345
34 Ga0068869_100433007 3300005334 Bacteria 1087
35 Ga0070680_100039136 3300005336 Unclassified 3837
36 Ga0068868_100034237 3300005338 Unclassified 3921
37 Ga0068868_100126572 3300005338 Unclassified 2088
38 Ga0070660_100188347 3300005339 Unclassified 1671
39 Ga0070689_100006993 3300005340 Bacteria 7862
40 Ga0070689_100095236 3300005340 Unclassified 2351
41 Ga0070689_100404059 3300005340 Bacteria 1155
42 Ga0070687_100097328 3300005343 Unclassified 1640
43 Ga0070692_10127126 3300005345 Unclassified 1428
44 Ga0070668_100259349 3300005347 Unclassified 1445
45 Ga0070668_100486944 3300005347 Unclassified 1066
46 Ga0070675_100015747 3300005354 Bacteria 5984
47 Ga0070675_100053065 3300005354 Bacteria 3334
48 Ga0070675_100494797 3300005354 Bacteria 1101
49 Ga0070671_100289533 3300005355 Bacteria 1394
50 Ga0070671_100324388 3300005355 Unclassified 1312
51 Ga0070673_100112105 3300005364 Unclassified 2264
52 Ga0070673_100212216 3300005364 Unclassified 1672
53 Ga0070688_100001607 3300005365 Bacteria 11316
54 Ga0070688_100003135 3300005365 Bacteria 8455
55 Ga0070688_100020042 3300005365 Bacteria 3882
56 Ga0070688_100024012 3300005365 Bacteria 3591
57 Ga0070688_100189733 3300005365 Unclassified 1431
58 Ga0070659_100003784 3300005366 Bacteria 10801
59 Ga0070667_100047068 3300005367 Unclassified 3629
60 Ga0070667_100248267 3300005367 Unclassified 1591
61 Ga0070667_100477413 3300005367 Unclassified 1141
62 Ga0070714_100085294 3300005435 Unclassified 2758
63 Ga0070714_100129089 3300005435 Bacteria 2257
64 Ga0070714_100181048 3300005435 Unclassified 1918
65 Ga0070714_100353097 3300005435 Bacteria 1381
66 Ga0070713_100097855 3300005436 Bacteria 2536
67 Ga0070713_100145926 3300005436 Unclassified 2100
68 Ga0070713_100222454 3300005436 Bacteria 1713
69 Ga0070713_100716421 3300005436 Bacteria 956
70 Ga0070711_100023985 3300005439 Bacteria 3975
71 Ga0070711_100027938 3300005439 Bacteria 3708
72 Ga0070711_100117340 3300005439 Unclassified 1963
73 Ga0070711_100833543 3300005439 Unclassified 784
74 Ga0070705_100037283 3300005440 Unclassified 2741
75 Ga0070700_100014062 3300005441 Bacteria 4512
76 Ga0070708_100003012 3300005445 Bacteria 13081
77 Ga0070708_100013499 3300005445 Bacteria 6692
78 Ga0070708_100022513 3300005445 Bacteria 5346
79 Ga0070708_100038306 3300005445 Unclassified 4189
80 Ga0070708_100051387 3300005445 Unclassified 3652
81 Ga0070708_100058476 3300005445 Unclassified 3435
82 Ga0070708_100165257 3300005445 Unclassified 2064
83 Ga0070708_100334646 3300005445 Bacteria 1427
84 Ga0070708_100429030 3300005445 Unclassified 1247
85 Ga0070708_100432021 3300005445 Unclassified 1242
86 Ga0070708_101108731 3300005445 Bacteria 741
87 Ga0070663_100071289 3300005455 Bacteria 2528
88 Ga0070662_100019957 3300005457 Bacteria 4561
89 Ga0070662_100817543 3300005457 Unclassified 793
90 Ga0070681_10011532 3300005458 Bacteria 8749
91 Ga0070685_10144729 3300005466 Unclassified 1500
92 Ga0070685_10181646 3300005466 Unclassified 1355
93 Ga0070706_100000060 3300005467 Bacteria 131097
94 Ga0070706_100009196 3300005467 Bacteria 9202
95 Ga0070706_100047504 3300005467 Bacteria 3961
96 Ga0070706_100059876 3300005467 Bacteria 3515
97 Ga0070706_100062284 3300005467 Bacteria 3447
98 Ga0070706_100175427 3300005467 Unclassified 2001
99 Ga0070706_100219087 3300005467 Unclassified 1776
100 Ga0070706_100486797 3300005467 Bacteria 1148
101 Ga0070706_100875028 3300005467 Unclassified 830
102 Ga0070706_101130383 3300005467 Unclassified 721
103 Ga0070707_100000404 3300005468 Bacteria 42569
104 Ga0070707_100002340 3300005468 Bacteria 18075
105 Ga0070707_100006226 3300005468 Bacteria 11111
106 Ga0070707_100015749 3300005468 Bacteria 7097
107 Ga0070707_100021944 3300005468 Bacteria 6038
108 Ga0070707_100052557 3300005468 Bacteria 3907
109 Ga0070707_100075421 3300005468 Unclassified 3253
110 Ga0070707_100171130 3300005468 Bacteria 2117
111 Ga0070707_100297018 3300005468 Unclassified 1570
112 Ga0070707_100511931 3300005468 Bacteria 1162
113 Ga0070698_100000476 3300005471 Bacteria 42469
114 Ga0070698_100002315 3300005471 Bacteria 21073
115 Ga0070698_100067873 3300005471 Unclassified 3585
116 Ga0070698_100075241 3300005471 Unclassified 3381
117 Ga0070698_100469394 3300005471 Unclassified 1195
118 Ga0070698_100476442 3300005471 Bacteria 1185
119 Ga0070699_100013719 3300005518 Bacteria 6972
120 Ga0070699_100133089 3300005518 Bacteria 2193
121 Ga0070699_100137483 3300005518 Bacteria 2156
122 Ga0070699_100393281 3300005518 Unclassified 1253
123 Ga0070679_100009804 3300005530 Bacteria 9061
124 Ga0070684_100000426 3300005535 Bacteria 28892
125 Ga0070684_100037171 3300005535 Unclassified 4174
126 Ga0070684_100071560 3300005535 Bacteria 3052
127 Ga0070684_100221916 3300005535 Bacteria 1724
128 Ga0070697_100001934 3300005536 Bacteria 15848
129 Ga0070697_100005229 3300005536 Bacteria 9972
130 Ga0070697_100006054 3300005536 Bacteria 9361
131 Ga0070697_100022258 3300005536 Bacteria 5029
132 Ga0070697_100057923 3300005536 Bacteria 3152
133 Ga0070697_100059859 3300005536 Bacteria 3103
134 Ga0070697_100146444 3300005536 Bacteria 1988
135 Ga0070697_100217258 3300005536 Unclassified 1629
136 Ga0070697_100247999 3300005536 Bacteria 1522
137 Ga0070697_100305855 3300005536 Bacteria 1367
138 Ga0070672_100123719 3300005543 Unclassified 2120
139 Ga0070672_100510049 3300005543 Bacteria 1041
140 Ga0070686_100036655 3300005544 Bacteria 3038
141 Ga0070686_100056511 3300005544 Bacteria 2518
142 Ga0070665_100005096 3300005548 Bacteria 13628
143 Ga0070665_100216397 3300005548 Bacteria 1916
144 Ga0070665_100635509 3300005548 Bacteria 1080
145 Ga0070704_100094758 3300005549 Bacteria 2234
146 Ga0070664_100576985 3300005564 Bacteria 1042
147 Ga0068856_100023587 3300005614 Bacteria 5982
148 Ga0068856_101113859 3300005614 Unclassified 807
149 Ga0070702_100074558 3300005615 Bacteria 2014
150 Ga0070702_100075332 3300005615 Bacteria 2005
151 Ga0068859_100004725 3300005617 Bacteria 13835
152 Ga0068864_100582836 3300005618 Unclassified 1084
153 Ga0068863_100004916 3300005841 Bacteria 13171
154 Ga0068863_100098774 3300005841 Bacteria 2773
155 Ga0068863_100397929 3300005841 Unclassified 1347
156 Ga0068863_100931182 3300005841 Bacteria 870
157 Ga0068858_100025164 3300005842 Bacteria 5539
158 Ga0068858_100038847 3300005842 Bacteria 4415
159 Ga0068858_100210034 3300005842 Bacteria 1842
160 Ga0068858_100767274 3300005842 Unclassified 940
161 Ga0068860_100047859 3300005843 Bacteria 4075
162 Ga0081455_10000783 3300005937 Bacteria 40885
163 Ga0081455_10008251 3300005937 Bacteria 10858
164 Ga0081455_10009869 3300005937 Bacteria 9770
165 Ga0081455_10012282 3300005937 Bacteria 8547
166 Ga0081455_10013392 3300005937 Bacteria 8111
167 Ga0081455_10067225 3300005937 Bacteria 2987
168 Ga0081455_10149179 3300005937 Unclassified 1805
169 Ga0081455_10158582 3300005937 Unclassified 1737
170 Ga0081455_10280051 3300005937 Unclassified 1205
171 Ga0081540_1000274 3300005983 Bacteria 53893
172 Ga0081540_1047053 3300005983 Bacteria 2172
173 Ga0081540_1093896 3300005983 Bacteria 1312
174 Ga0081540_1097722 3300005983 Bacteria 1273
175 Ga0081539_10000153 3300005985 Bacteria 159919
176 Ga0081539_10006516 3300005985 Bacteria 11154
177 Ga0081539_10133554 3300005985 Bacteria 1215
178 Ga0081539_10156772 3300005985 Unclassified 1089
179 Ga0070717_10001341 3300006028 Bacteria 16912
180 Ga0070717_10005653 3300006028 Bacteria 9134
181 Ga0070717_10024821 3300006028 Bacteria 4763
182 Ga0070717_10038113 3300006028 Unclassified 3906
183 Ga0070717_10640925 3300006028 Bacteria 964
184 Ga0070715_10027753 3300006163 Bacteria 2264
185 Ga0070715_10083941 3300006163 Bacteria 1452
186 Ga0070715_10106696 3300006163 Unclassified 1315
187 Ga0070715_10167276 3300006163 Unclassified 1092
188 Ga0070715_10313308 3300006163 Unclassified 844
189 Ga0070716_100056813 3300006173 Unclassified 2246
190 Ga0070716_100065854 3300006173 Unclassified 2111
191 Ga0070716_100124917 3300006173 Unclassified 1617
192 Ga0070716_100491852 3300006173 Unclassified 903
193 Ga0070712_100035008 3300006175 Bacteria 3406
194 Ga0070712_100062385 3300006175 Bacteria 2635
195 Ga0070712_100073662 3300006175 Bacteria 2450
196 Ga0070712_100144510 3300006175 Bacteria 1819
197 Ga0070712_100176083 3300006175 Unclassified 1663
198 Ga0070712_100223734 3300006175 Bacteria 1491
199 Ga0070712_100230599 3300006175 Unclassified 1470
200 Ga0097621_100078967 3300006237 Unclassified 2735
201 Ga0068871_100007756 3300006358 Bacteria 7684
202 Ga0068871_100442374 3300006358 Unclassified 1164
203 Ga0075434_100497566 3300006871 Bacteria 1240
204 Ga0075436_100530458 3300006914 Unclassified 863
205 Ga0097620_100004724 3300006931 Bacteria 13835
206 Ga0075435_100188125 3300007076 Bacteria 1747
207 Ga0099794_10178915 3300007265 Bacteria 1082
208 Ga0099795_10007766 3300007788 Bacteria 3018
209 Ga0099795_10265399 3300007788 Unclassified 745
210 Ga0105240_10068382 3300009093 Bacteria 4399
211 Ga0111539_10064939 3300009094 Bacteria 4316
212 Ga0111539_10816746 3300009094 Bacteria 1085
213 Ga0111539_11007889 3300009094 Bacteria 968
214 Ga0105245_10867636 3300009098 Unclassified 943
215 Ga0105247_10132449 3300009101 Bacteria 1626
216 Ga0105247_10155504 3300009101 Bacteria 1510
217 Ga0105247_10621432 3300009101 Unclassified 803
218 Ga0114129_10827758 3300009147 Bacteria 1179
219 Ga0105241_10442434 3300009174 Unclassified 1148
220 Ga0105241_10576959 3300009174 Unclassified 1013
221 Ga0105248_11083927 3300009177 Bacteria 905
222 Ga0105237_10877807 3300009545 Unclassified 904
223 Ga0105249_10001372 3300009553 Bacteria 21285
224 Ga0105249_10066772 3300009553 Bacteria 3312
225 Ga0105249_10234957 3300009553 Unclassified 1810
226 Ga0105249_10754893 3300009553 Bacteria 1035
227 Ga0099796_10010257 3300010159 Bacteria 2570
228 Ga0099796_10148254 3300010159 Unclassified 922
229 Ga0105239_10064660 3300010375 Bacteria 4016
230 Ga0105239_10192476 3300010375 Bacteria 2283
231 Ga0105246_10260375 3300011119 Bacteria 1382
232 Ga0157314_1009565 3300012500 Unclassified 821
233 Ga0157371_10254430 3300013102 Unclassified 1265
234 Ga0157370_10196534 3300013104 Bacteria 1872
235 Ga0157369_10032197 3300013105 Bacteria 5768
236 Ga0157374_10009307 3300013296 Bacteria 8426
237 Ga0157374_10036610 3300013296 Bacteria 4496
238 Ga0157374_10110468 3300013296 Bacteria 2644
239 Ga0157374_10166429 3300013296 Bacteria 2148
240 Ga0157374_10230333 3300013296 Unclassified 1820
241 Ga0157374_10381583 3300013296 Unclassified 1404
242 Ga0157374_11018882 3300013296 Unclassified 847
243 Ga0157374_11271353 3300013296 Unclassified 758
244 Ga0157378_10013775 3300013297 Bacteria 7073
245 Ga0157378_10042153 3300013297 Unclassified 4050
246 Ga0157378_10107461 3300013297 Bacteria 2553
247 Ga0157378_10129691 3300013297 Bacteria 2333
248 Ga0157378_10241071 3300013297 Bacteria 1727
249 Ga0157378_11872074 3300013297 Unclassified 649
250 Ga0163162_10046877 3300013306 Bacteria 4333
251 Ga0163162_10164442 3300013306 Bacteria 2342
252 Ga0157372_10017451 3300013307 Bacteria 7705
253 Ga0157372_10063621 3300013307 Unclassified 4138
254 Ga0157372_10324616 3300013307 Unclassified 1792
255 Ga0157375_10001670 3300013308 Bacteria 19081
256 Ga0157375_10051714 3300013308 Bacteria 4036
257 Ga0157375_10397205 3300013308 Unclassified 1545
258 Ga0157375_10815457 3300013308 Bacteria 1081
259 Ga0163163_10021464 3300014325 Bacteria 6095
260 Ga0163163_10051799 3300014325 Bacteria 4047
261 Ga0163163_10583824 3300014325 Unclassified 1181
262 Ga0163163_10745426 3300014325 Unclassified 1043
263 Ga0182008_10026900 3300014497 Unclassified 2916
264 Ga0157379_10001478 3300014968 Bacteria 19371
265 Ga0157379_10192366 3300014968 Bacteria 1844
266 Ga0157376_10009805 3300014969 Bacteria 6980
267 Ga0157376_10021883 3300014969 Bacteria 4972
268 Ga0157376_10045274 3300014969 Bacteria 3621
269 Ga0157376_10155899 3300014969 Unclassified 2065
270 Ga0182006_1058654 3300015261 Unclassified 1459
271 Ga0182005_1016957 3300015265 Unclassified 2018
272 Ga0163161_10138824 3300017792 Unclassified 1839
273 Ga0207666_1000291 3300025271 Bacteria 7123
274 Ga0207673_1005343 3300025290 Unclassified 1563
275 Ga0207673_1017252 3300025290 Bacteria 964
276 Ga0207697_10001627 3300025315 Bacteria 12141
277 Ga0207697_10001769 3300025315 Bacteria 11585
278 Ga0207697_10010101 3300025315 Bacteria 4052
279 Ga0207697_10171474 3300025315 Unclassified 949
280 Ga0207697_10276439 3300025315 Bacteria 744
281 Ga0207653_10025180 3300025885 Unclassified 1902
282 Ga0207692_10083431 3300025898 Unclassified 1714
283 Ga0207710_10187791 3300025900 Bacteria 1016
284 Ga0207688_10046919 3300025901 Unclassified 2412
285 Ga0207680_10052274 3300025903 Bacteria 2447
286 Ga0207647_10000620 3300025904 Bacteria 27662
287 Ga0207685_10183675 3300025905 Bacteria 971
288 Ga0207685_10305629 3300025905 Bacteria 788
289 Ga0207645_10158510 3300025907 Unclassified 1480
290 Ga0207705_10290604 3300025909 Bacteria 1252
291 Ga0207684_10000118 3300025910 Bacteria 145120
292 Ga0207684_10016206 3300025910 Bacteria 6402
293 Ga0207684_10019786 3300025910 Bacteria 5758
294 Ga0207684_10053120 3300025910 Unclassified 3439
295 Ga0207684_10063410 3300025910 Bacteria 3137
296 Ga0207684_10073925 3300025910 Bacteria 2895
297 Ga0207684_10106916 3300025910 Bacteria 2394
298 Ga0207684_10149674 3300025910 Bacteria 2008
299 Ga0207684_10171602 3300025910 Unclassified 1869
300 Ga0207684_10289856 3300025910 Unclassified 1411
301 Ga0207684_10308113 3300025910 Unclassified 1365
302 Ga0207684_10584404 3300025910 Unclassified 954
303 Ga0207707_10007183 3300025912 Bacteria 9699
304 Ga0207693_10003687 3300025915 Bacteria 13073
305 Ga0207693_10011897 3300025915 Bacteria 7035
306 Ga0207693_10012118 3300025915 Bacteria 6969
307 Ga0207693_10042094 3300025915 Bacteria 3596
308 Ga0207693_10383631 3300025915 Bacteria 1099
309 Ga0207693_10383776 3300025915 Bacteria 1099
310 Ga0207693_10655305 3300025915 Unclassified 815
311 Ga0207693_10824708 3300025915 Unclassified 714
312 Ga0207663_10032062 3300025916 Bacteria 3116
313 Ga0207663_10119969 3300025916 Unclassified 1799
314 Ga0207660_10019628 3300025917 Bacteria 4521
315 Ga0207662_10018451 3300025918 Bacteria 3959
316 Ga0207657_10172328 3300025919 Bacteria 1753
317 Ga0207652_10200640 3300025921 Bacteria 1795
318 Ga0207646_10002817 3300025922 Bacteria 20240
319 Ga0207646_10003129 3300025922 Bacteria 18977
320 Ga0207646_10014198 3300025922 Bacteria 7571
321 Ga0207646_10025056 3300025922 Bacteria 5460
322 Ga0207646_10026279 3300025922 Bacteria 5316
323 Ga0207646_10078532 3300025922 Bacteria 2950
324 Ga0207646_10158147 3300025922 Bacteria 2044
325 Ga0207646_10370802 3300025922 Bacteria 1293
326 Ga0207646_10405062 3300025922 Bacteria 1232
327 Ga0207646_10504045 3300025922 Bacteria 1090
328 Ga0207659_10001388 3300025926 Bacteria 14459
329 Ga0207659_10041586 3300025926 Unclassified 3219
330 Ga0207700_10078074 3300025928 Unclassified 2574
331 Ga0207700_10395542 3300025928 Bacteria 1210
332 Ga0207664_10136612 3300025929 Bacteria 2069
333 Ga0207664_10297115 3300025929 Unclassified 1420
334 Ga0207644_10098579 3300025931 Unclassified 2191
335 Ga0207690_10051058 3300025932 Bacteria 2764
336 Ga0207706_10011276 3300025933 Bacteria 8145
337 Ga0207670_10023890 3300025936 Bacteria 3812
338 Ga0207670_10339078 3300025936 Bacteria 1187
339 Ga0207669_10171814 3300025937 Bacteria 1543
340 Ga0207704_10550416 3300025938 Unclassified 937
341 Ga0207665_10018850 3300025939 Bacteria 4535
342 Ga0207665_10019764 3300025939 Bacteria 4426
343 Ga0207665_10091034 3300025939 Unclassified 2114
344 Ga0207665_10131993 3300025939 Bacteria 1774
345 Ga0207665_10324614 3300025939 Unclassified 1156
346 Ga0207665_10399958 3300025939 Unclassified 1046
347 Ga0207691_10097210 3300025940 Bacteria 2632
348 Ga0207691_10274997 3300025940 Bacteria 1450
349 Ga0207691_11086355 3300025940 Unclassified 666
350 Ga0207711_10129083 3300025941 Bacteria 2265
351 Ga0207661_10003264 3300025944 Bacteria 11248
352 Ga0207661_10069745 3300025944 Bacteria 2867
353 Ga0207679_10004301 3300025945 Bacteria 8856
354 Ga0207679_10672181 3300025945 Unclassified 938
355 Ga0207651_10755884 3300025960 Unclassified 859
356 Ga0207712_10104776 3300025961 Bacteria 2110
357 Ga0207668_10229941 3300025972 Unclassified 1494
358 Ga0207703_10002412 3300026035 Bacteria 16241
359 Ga0207703_10092818 3300026035 Unclassified 2542
360 Ga0207703_10337309 3300026035 Bacteria 1384
361 Ga0207678_10004933 3300026067 Bacteria 11982
362 Ga0207678_10301768 3300026067 Unclassified 1376
363 Ga0207708_10001549 3300026075 Bacteria 17159
364 Ga0207641_10137631 3300026088 Unclassified 2199
365 Ga0207641_10151847 3300026088 Bacteria 2098
366 Ga0207641_10847854 3300026088 Unclassified 906
367 Ga0207648_10031239 3300026089 Bacteria 4708
368 Ga0207676_10096144 3300026095 Bacteria 2444
369 Ga0207676_10320032 3300026095 Unclassified 1424
370 Ga0207683_10392986 3300026121 Unclassified 1275
371 Ga0207683_10554399 3300026121 Bacteria 1063
372 Ga0207698_10199937 3300026142 Bacteria 1789
373 Ga0209971_1073943 3300027682 Bacteria 828
374 Ga0268266_10069258 3300028379 Unclassified 3056
375 Ga0268266_10085646 3300028379 Bacteria 2754
376 Ga0268266_10279181 3300028379 Bacteria 1553
377 Ga0268264_10005881 3300028381 Bacteria 10381
378 Ga0307513_10020532 3300031456 Bacteria 7833
379 Ga0373936_0080662 3300035113 Bacteria 1354
380 Ga0373953_0054776 3300035117 Bacteria 1618
381 Ga0373956_0263333 3300035119 Unclassified 820
382 Ga0373955_0038521 3300035172 Unclassified 2548
383 Ga0373935_0082936 3300035692 Bacteria 2086
384 Ga0373935_0102546 3300035692 Bacteria 1888
385 Ga0373927_0307251 3300035695 Bacteria 1044
386 Ga0373927_0578376 3300035695 Unclassified 742
387 Ga0373933_0154026 3300035724 Unclassified 1457
388 Ga0373947_0088115 3300035725 Bacteria 1931
389 Ga0373947_0411334 3300035725 Unclassified 913
390 Ga0373937_0078853 3300036401 Unclassified 3044
391 Ga0373937_0717248 3300036401 Unclassified 947
392 Ga0373925_0111148 3300037068 Unclassified 2117
393 Ga0373925_0391537 3300037068 Bacteria 1133
394 Ga0373925_0704281 3300037068 Unclassified 833
395 Ga0395899_0096002 3300037312 Bacteria 2144
396 Ga0395900_0014166 3300037418 Bacteria 8142
397 Ga0395898_0009349 3300037466 Bacteria 10299
398 Ga0395905_0012194 3300037471 Bacteria 8279
399 Ga0395905_0710138 3300037471 Bacteria 908
400 Ga0395901_0000503 3300038443 Bacteria 45231
401 Ga0395901_0286066 3300038443 Bacteria 1712
402 Ga0395901_0756096 3300038443 Unclassified 965
403 Ga0436363_0282151 3300039450 Bacteria 1126
404 Ga0439451_009963 3300042009 Bacteria 1918
405 Ga0439458_0040244 3300042157 Unclassified 1132
406 Ga0495603_0058240 3300046455 Unclassified 2285
407 Ga0495629_0066118 3300046459 Bacteria 2523
408 Ga0495629_0246480 3300046459 Unclassified 1230
409 Ga0495653_0503873 3300046463 Unclassified 754
410 Ga0495580_0038297 3300046472 Unclassified 3435
411 Ga0495582_0164770 3300046473 Unclassified 1261
412 Ga0495664_0059718 3300046477 Unclassified 2270
413 Ga0495594_0070948 3300046499 Bacteria 1937
414 Ga0495618_0200573 3300046514 Unclassified 1263
415 Ga0495618_0356961 3300046514 Bacteria 900
416 Ga0495628_0161992 3300046516 Unclassified 1699
417 Ga0495630_0006120 3300046517 Bacteria 8529
418 Ga0495630_0045825 3300046517 Unclassified 3268
419 Ga0495652_0389418 3300046529 Unclassified 989
420 Ga0495640_0065163 3300046533 Bacteria 2461
421 Ga0495587_0145344 3300046536 Unclassified 1352
422 Ga0495645_0051569 3300046543 Bacteria 2993
423 Ga0495634_0045601 3300046642 Bacteria 2962
424 Ga0495634_0245910 3300046642 Unclassified 1096
425 Ga0495599_0453964 3300046678 Unclassified 758
426 Ga0495646_0091420 3300046680 Unclassified 1756
427 Ga0495647_0039079 3300046681 Bacteria 1797
428 Ga0495658_0040653 3300046683 Bacteria 2586
429 Ga0495658_0058858 3300046683 Unclassified 2199
430 Ga0495669_0135209 3300046684 Unclassified 1162
431 Ga0495613_0162259 3300046689 Unclassified 1589
432 Ga0495613_0466320 3300046689 Unclassified 854
433 Ga0495624_0045860 3300046690 Unclassified 2781
434 Ga0495674_0055878 3300047319 Unclassified 3460
435 Ga0495674_0087156 3300047319 Bacteria 2672
436 Ga0495674_0683042 3300047319 Unclassified 807
437 Ga0495680_0330074 3300047322 Bacteria 1066
438 Ga0495684_0004639 3300047471 Bacteria 10726
439 Ga0495602_0074005 3300048088 Bacteria 2897
440 Ga0496100_0303378 3300048903 Unclassified 1196
441 Ga0496101_0057395 3300048904 Bacteria 2816
442 Ga0496101_0791910 3300048904 Unclassified 748
443 Ga0496102_0030187 3300048905 Bacteria 4852
444 Ga0496102_0190349 3300048905 Bacteria 1933
445 Ga0496102_0685539 3300048905 Unclassified 948
446 Ga0496104_0022548 3300048907 Bacteria 5784
447 Ga0496104_0044612 3300048907 Bacteria 4166
448 Ga0496104_0045219 3300048907 Bacteria 4140
449 Ga0496105_0037945 3300048908 Unclassified 3968
450 Ga0496106_0417893 3300048909 Unclassified 1078
451 Ga0496106_0427087 3300048909 Bacteria 1065
452 Ga0496107_0024893 3300048910 Unclassified 4237
453 Ga0496108_0004604 3300048911 Bacteria 11106
454 Ga0496108_0116261 3300048911 Bacteria 2291
455 Ga0496108_0246620 3300048911 Unclassified 1554
456 Ga0496109_0002248 3300048912 Bacteria 16049
457 Ga0496109_0173515 3300048912 Bacteria 2023
458 Ga0496110_0156099 3300048913 Unclassified 2067
459 Ga0496112_0007222 3300048915 Bacteria 9845
460 Ga0496112_0479037 3300048915 Unclassified 1181
461 Ga0496113_0012471 3300048916 Bacteria 5712
462 Ga0496114_0006954 3300048917 Bacteria 8914
463 Ga0496114_0124040 3300048917 Bacteria 2224
464 Ga0496115_0026761 3300048918 Bacteria 4505
465 Ga0496115_0039925 3300048918 Unclassified 3729
466 Ga0496115_0046186 3300048918 Bacteria 3480
467 Ga0496115_0282025 3300048918 Unclassified 1364
468 nmdc:mga05p37_876689_c1 3300050507 Bacteria 971
469 nmdc:mga08y16_330731_c1 3300050511 Unclassified 1567
470 nmdc:mga0n895_601108_c1 3300050512 Bacteria 1102
471 nmdc:mga0rr50_497373_c1 3300050513 Bacteria 1036
472 nmdc:mga0rr50_62550_c1 3300050513 Bacteria 2808
473 nmdc:mga08x19_199663_c1 3300050514 Unclassified 1370
474 nmdc:mga08x19_23644_c1 3300050514 Unclassified 3813
475 Ga0495619_0229420 3300053085 Unclassified 1286
476 Ga0495619_0268048 3300053085 Unclassified 1183
477 Ga0500566_0142703 3300053094 Unclassified 1269
478 Ga0081539_10222089
479 MBSR1b_contig_1384014
480 CNXas_1000001
481 JGI24743J22301_10001691
482 JGI24035J26624_1000699
483 JGI25406J46586_10000296
484 JGI25405J52794_10000421
485 JGI25405J52794_10005599
486 Ga0065714_10245764
487 Ga0065704_10021197
488 Ga0065704_10077928
489 Ga0065704_10078902
490 Ga0065704_10112763
491 Ga0065712_10000022
492 Ga0065712_10000289
493 Ga0065712_10075790
494 Ga0065712_10082959
495 Ga0065712_10156503
496 Ga0065712_10183394
497 Ga0065712_10275133
498 Ga0065715_10000301
499 Ga0065715_10000862
500 Ga0065715_10002362
501 Ga0065715_10015067
502 Ga0065715_10105424
503 Ga0065715_10158083
504 Ga0065715_10171456
505 Ga0065715_10574426
506 Ga0065707_10087047
507 Ga0070683_100099164
508 Ga0070683_100236675
509 Ga0070690_100007963
510 Ga0070670_100326551
511 Ga0068869_100433007
512 Ga0070680_100039136
513 Ga0068868_100034237
514 Ga0068868_100126572
515 Ga0070660_100188347
516 Ga0070689_100006993
517 Ga0070689_100095236
518 Ga0070689_100404059
519 Ga0070687_100097328
520 Ga0070692_10127126
521 Ga0070668_100259349
522 Ga0070668_100486944
523 Ga0070675_100015747
524 Ga0070675_100053065
525 Ga0070675_100494797
526 Ga0070671_100289533
527 Ga0070671_100324388
528 Ga0070673_100112105
529 Ga0070673_100212216
530 Ga0070688_100001607
531 Ga0070688_100003135
532 Ga0070688_100020042
533 Ga0070688_100024012
534 Ga0070688_100189733
535 Ga0070659_100003784
536 Ga0070667_100047068
537 Ga0070667_100248267
538 Ga0070667_100477413
539 Ga0070714_100085294
540 Ga0070714_100129089
541 Ga0070714_100181048
542 Ga0070714_100353097
543 Ga0070713_100097855
544 Ga0070713_100145926
545 Ga0070713_100222454
546 Ga0070713_100716421
547 Ga0070711_100023985
548 Ga0070711_100027938
549 Ga0070711_100117340
550 Ga0070711_100833543
551 Ga0070705_100037283
552 Ga0070700_100014062
553 Ga0070708_100003012
554 Ga0070708_100013499
555 Ga0070708_100022513
556 Ga0070708_100038306
557 Ga0070708_100051387
558 Ga0070708_100058476
559 Ga0070708_100165257
560 Ga0070708_100334646
561 Ga0070708_100429030
562 Ga0070708_100432021
563 Ga0070708_101108731
564 Ga0070663_100071289
565 Ga0070662_100019957
566 Ga0070662_100817543
567 Ga0070681_10011532
568 Ga0070685_10144729
569 Ga0070685_10181646
570 Ga0070706_100000060
571 Ga0070706_100009196
572 Ga0070706_100047504
573 Ga0070706_100059876
574 Ga0070706_100062284
575 Ga0070706_100175427
576 Ga0070706_100219087
577 Ga0070706_100486797
578 Ga0070706_100875028
579 Ga0070706_101130383
580 Ga0070707_100000404
581 Ga0070707_100002340
582 Ga0070707_100006226
583 Ga0070707_100015749
584 Ga0070707_100021944
585 Ga0070707_100052557
586 Ga0070707_100075421
587 Ga0070707_100171130
588 Ga0070707_100297018
589 Ga0070707_100511931
590 Ga0070698_100000476
591 Ga0070698_100002315
592 Ga0070698_100067873
593 Ga0070698_100075241
594 Ga0070698_100469394
595 Ga0070698_100476442
596 Ga0070699_100013719
597 Ga0070699_100133089
598 Ga0070699_100137483
599 Ga0070699_100393281
600 Ga0070679_100009804
601 Ga0070684_100000426
602 Ga0070684_100037171
603 Ga0070684_100071560
604 Ga0070684_100221916
605 Ga0070697_100001934
606 Ga0070697_100005229
607 Ga0070697_100006054
608 Ga0070697_100022258
609 Ga0070697_100057923
610 Ga0070697_100059859
611 Ga0070697_100146444
612 Ga0070697_100217258
613 Ga0070697_100247999
614 Ga0070697_100305855
615 Ga0070672_100123719
616 Ga0070672_100510049
617 Ga0070686_100036655
618 Ga0070686_100056511
619 Ga0070665_100005096
620 Ga0070665_100216397
621 Ga0070665_100635509
622 Ga0070704_100094758
623 Ga0070664_100576985
624 Ga0068856_100023587
625 Ga0068856_101113859
626 Ga0070702_100074558
627 Ga0070702_100075332
628 Ga0068859_100004725
629 Ga0068864_100582836
630 Ga0068863_100004916
631 Ga0068863_100098774
632 Ga0068863_100397929
633 Ga0068863_100931182
634 Ga0068858_100025164
635 Ga0068858_100038847
636 Ga0068858_100210034
637 Ga0068858_100767274
638 Ga0068860_100047859
639 Ga0081455_10000783
640 Ga0081455_10008251
641 Ga0081455_10009869
642 Ga0081455_10012282
643 Ga0081455_10013392
644 Ga0081455_10067225
645 Ga0081455_10149179
646 Ga0081455_10158582
647 Ga0081455_10280051
648 Ga0081540_1000274
649 Ga0081540_1047053
650 Ga0081540_1093896
651 Ga0081540_1097722
652 Ga0081539_10000153
653 Ga0081539_10006516
654 Ga0081539_10133554
655 Ga0081539_10156772
656 Ga0070717_10001341
657 Ga0070717_10005653
658 Ga0070717_10024821
659 Ga0070717_10038113
660 Ga0070717_10640925
661 Ga0070715_10027753
662 Ga0070715_10083941
663 Ga0070715_10106696
664 Ga0070715_10167276
665 Ga0070715_10313308
666 Ga0070716_100056813
667 Ga0070716_100065854
668 Ga0070716_100124917
669 Ga0070716_100491852
670 Ga0070712_100035008
671 Ga0070712_100062385
672 Ga0070712_100073662
673 Ga0070712_100144510
674 Ga0070712_100176083
675 Ga0070712_100223734
676 Ga0070712_100230599
677 Ga0097621_100078967
678 Ga0068871_100007756
679 Ga0068871_100442374
680 Ga0075434_100497566
681 Ga0075436_100530458
682 Ga0097620_100004724
683 Ga0075435_100188125
684 Ga0099794_10178915
685 Ga0099795_10007766
686 Ga0099795_10265399
687 Ga0105240_10068382
688 Ga0111539_10064939
689 Ga0111539_10816746
690 Ga0111539_11007889
691 Ga0105245_10867636
692 Ga0105247_10132449
693 Ga0105247_10155504
694 Ga0105247_10621432
695 Ga0114129_10827758
696 Ga0105241_10442434
697 Ga0105241_10576959
698 Ga0105248_11083927
699 Ga0105237_10877807
700 Ga0105249_10001372
701 Ga0105249_10066772
702 Ga0105249_10234957
703 Ga0105249_10754893
704 Ga0099796_10010257
705 Ga0099796_10148254
706 Ga0105239_10064660
707 Ga0105239_10192476
708 Ga0105246_10260375
709 Ga0157314_1009565
710 Ga0157371_10254430
711 Ga0157370_10196534
712 Ga0157369_10032197
713 Ga0157374_10009307
714 Ga0157374_10036610
715 Ga0157374_10110468
716 Ga0157374_10166429
717 Ga0157374_10230333
718 Ga0157374_10381583
719 Ga0157374_11018882
720 Ga0157374_11271353
721 Ga0157378_10013775
722 Ga0157378_10042153
723 Ga0157378_10107461
724 Ga0157378_10129691
725 Ga0157378_10241071
726 Ga0157378_11872074
727 Ga0163162_10046877
728 Ga0163162_10164442
729 Ga0157372_10017451
730 Ga0157372_10063621
731 Ga0157372_10324616
732 Ga0157375_10001670
733 Ga0157375_10051714
734 Ga0157375_10397205
735 Ga0157375_10815457
736 Ga0163163_10021464
737 Ga0163163_10051799
738 Ga0163163_10583824
739 Ga0163163_10745426
740 Ga0182008_10026900
741 Ga0157379_10001478
742 Ga0157379_10192366
743 Ga0157376_10009805
744 Ga0157376_10021883
745 Ga0157376_10045274
746 Ga0157376_10155899
747 Ga0182006_1058654
748 Ga0182005_1016957
749 Ga0163161_10138824
750 Ga0207666_1000291
751 Ga0207673_1005343
752 Ga0207673_1017252
753 Ga0207697_10001627
754 Ga0207697_10001769
755 Ga0207697_10010101
756 Ga0207697_10171474
757 Ga0207697_10276439
758 Ga0207653_10025180
759 Ga0207692_10083431
760 Ga0207710_10187791
761 Ga0207688_10046919
762 Ga0207680_10052274
763 Ga0207647_10000620
764 Ga0207685_10183675
765 Ga0207685_10305629
766 Ga0207645_10158510
767 Ga0207705_10290604
768 Ga0207684_10000118
769 Ga0207684_10016206
770 Ga0207684_10019786
771 Ga0207684_10053120
772 Ga0207684_10063410
773 Ga0207684_10073925
774 Ga0207684_10106916
775 Ga0207684_10149674
776 Ga0207684_10171602
777 Ga0207684_10289856
778 Ga0207684_10308113
779 Ga0207684_10584404
780 Ga0207707_10007183
781 Ga0207693_10003687
782 Ga0207693_10011897
783 Ga0207693_10012118
784 Ga0207693_10042094
785 Ga0207693_10383631
786 Ga0207693_10383776
787 Ga0207693_10655305
788 Ga0207693_10824708
789 Ga0207663_10032062
790 Ga0207663_10119969
791 Ga0207660_10019628
792 Ga0207662_10018451
793 Ga0207657_10172328
794 Ga0207652_10200640
795 Ga0207646_10002817
796 Ga0207646_10003129
797 Ga0207646_10014198
798 Ga0207646_10025056
799 Ga0207646_10026279
800 Ga0207646_10078532
801 Ga0207646_10158147
802 Ga0207646_10370802
803 Ga0207646_10405062
804 Ga0207646_10504045
805 Ga0207659_10001388
806 Ga0207659_10041586
807 Ga0207700_10078074
808 Ga0207700_10395542
809 Ga0207664_10136612
810 Ga0207664_10297115
811 Ga0207644_10098579
812 Ga0207690_10051058
813 Ga0207706_10011276
814 Ga0207670_10023890
815 Ga0207670_10339078
816 Ga0207669_10171814
817 Ga0207704_10550416
818 Ga0207665_10018850
819 Ga0207665_10019764
820 Ga0207665_10091034
821 Ga0207665_10131993
822 Ga0207665_10324614
823 Ga0207665_10399958
824 Ga0207691_10097210
825 Ga0207691_10274997
826 Ga0207691_11086355
827 Ga0207711_10129083
828 Ga0207661_10003264
829 Ga0207661_10069745
830 Ga0207679_10004301
831 Ga0207679_10672181
832 Ga0207651_10755884
833 Ga0207712_10104776
834 Ga0207668_10229941
835 Ga0207703_10002412
836 Ga0207703_10092818
837 Ga0207703_10337309
838 Ga0207678_10004933
839 Ga0207678_10301768
840 Ga0207708_10001549
841 Ga0207641_10137631
842 Ga0207641_10151847
843 Ga0207641_10847854
844 Ga0207648_10031239
845 Ga0207676_10096144
846 Ga0207676_10320032
847 Ga0207683_10392986
848 Ga0207683_10554399
849 Ga0207698_10199937
850 Ga0209971_1073943
851 Ga0268266_10069258
852 Ga0268266_10085646
853 Ga0268266_10279181
854 Ga0268264_10005881
855 Ga0307513_10020532
856 Ga0373936_0080662
857 Ga0373953_0054776
858 Ga0373956_0263333
859 Ga0373955_0038521
860 Ga0373935_0082936
861 Ga0373935_0102546
862 Ga0373927_0307251
863 Ga0373927_0578376
864 Ga0373933_0154026
865 Ga0373947_0088115
866 Ga0373947_0411334
867 Ga0373937_0078853
868 Ga0373937_0717248
869 Ga0373925_0111148
870 Ga0373925_0391537
871 Ga0373925_0704281
872 Ga0395899_0096002
873 Ga0395900_0014166
874 Ga0395898_0009349
875 Ga0395905_0012194
876 Ga0395905_0710138
877 Ga0395901_0000503
878 Ga0395901_0286066
879 Ga0395901_0756096
880 Ga0436363_0282151
881 Ga0439451_009963
882 Ga0439458_0040244
883 Ga0495603_0058240
884 Ga0495629_0066118
885 Ga0495629_0246480
886 Ga0495653_0503873
887 Ga0495580_0038297
888 Ga0495582_0164770
889 Ga0495664_0059718
890 Ga0495594_0070948
891 Ga0495618_0200573
892 Ga0495618_0356961
893 Ga0495628_0161992
894 Ga0495630_0006120
895 Ga0495630_0045825
896 Ga0495652_0389418
897 Ga0495640_0065163
898 Ga0495587_0145344
899 Ga0495645_0051569
900 Ga0495634_0045601
901 Ga0495634_0245910
902 Ga0495599_0453964
903 Ga0495646_0091420
904 Ga0495647_0039079
905 Ga0495658_0040653
906 Ga0495658_0058858
907 Ga0495669_0135209
908 Ga0495613_0162259
909 Ga0495613_0466320
910 Ga0495624_0045860
911 Ga0495674_0055878
912 Ga0495674_0087156
913 Ga0495674_0683042
914 Ga0495680_0330074
915 Ga0495684_0004639
916 Ga0495602_0074005
917 Ga0496100_0303378
918 Ga0496101_0057395
919 Ga0496101_0791910
920 Ga0496102_0030187
921 Ga0496102_0190349
922 Ga0496102_0685539
923 Ga0496104_0022548
924 Ga0496104_0044612
925 Ga0496104_0045219
926 Ga0496105_0037945
927 Ga0496106_0417893
928 Ga0496106_0427087
929 Ga0496107_0024893
930 Ga0496108_0004604
931 Ga0496108_0116261
932 Ga0496108_0246620
933 Ga0496109_0002248
934 Ga0496109_0173515
935 Ga0496110_0156099
936 Ga0496112_0007222
937 Ga0496112_0479037
938 Ga0496113_0012471
939 Ga0496114_0006954
940 Ga0496114_0124040
941 Ga0496115_0026761
942 Ga0496115_0039925
943 Ga0496115_0046186
944 Ga0496115_0282025
945 nmdc:mga05p37_876689_c1
946 nmdc:mga08y16_330731_c1
947 nmdc:mga0n895_601108_c1
948 nmdc:mga0rr50_497373_c1
949 nmdc:mga0rr50_62550_c1
950 nmdc:mga08x19_199663_c1
951 nmdc:mga08x19_23644_c1
952 Ga0495619_0229420
953 Ga0495619_0268048
954 Ga0500566_0142703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

7

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9662 4 192
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9651 3 192
3kcq-assembly1.cif.gz_C-2 crystal structure of phosphoribosylglycinamide formyltransferase from anaplasma phagocytophilum 0.9632 2 192
3kcq-assembly2.cif.gz_B crystal structure of phosphoribosylglycinamide formyltransferase from anaplasma phagocytophilum 0.9625 2 184
3kcq-assembly1.cif.gz_A crystal structure of phosphoribosylglycinamide formyltransferase from anaplasma phagocytophilum 0.9622 2 187
ID Description Score Start End Superfamily
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9657 4 192 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9651 3 192 3.40.50.170
3kcqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9625 2 184 3.40.50.170
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9555 2 196 3.40.50.170
4s1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9543 5 189 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A7X7QZ70-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.987 94 186 GO:0004644
GO:0005829
GO:0006189
AF-A0A832HAS7-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9865 2 191 GO:0004644
GO:0005829
GO:0006189
AF-A0A1G0YCK7-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9857 4 187 GO:0004644
GO:0005737
GO:0006189
GO:0015937
AF-A0A6N6PA86-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9764 2 195 GO:0004644
GO:0005829
GO:0006189
AF-A0A530QQT8-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 0.9761 72 183 GO:0004644
GO:0005829
GO:0006189

Map