F451566

General Info

Members Datasets Scaffolds Average Seq Length
476 370 326 207

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0151026|Ga0466970_0151026_66_764
Length 232
Sequence VRLATNCQLAHGRDAGRQSLIDLVATMKLALILPLALAAFIGAARAEEADDIHEATTAEAEAFNARLYAGPPGKTAYACFVRRYDAEHLAQHPKQKVASMKLLVSAETDAEDKQLHNSFRIGFRYRHRSGDFDSSGSCHHAVFTKEGNEIRLGCGVDCEGGGLGIALSKDDKSAVVRLESIRVWLHNKPTEDDDRRLEAGSDDGIFRLDRADSSECAALATDRKELAALRHK

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
12 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
13 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
14 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
15 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
16 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
17 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
18 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
19 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
20 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
27 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
28 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
29 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
30 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
31 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
32 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
33 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
34 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
35 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
36 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
37 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
38 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
39 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
40 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
41 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
42 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
43 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
44 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
45 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
46 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
47 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
48 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
49 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
50 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
51 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
52 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
53 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
54 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
55 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
56 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
57 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
58 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
59 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
60 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
61 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
62 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
63 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
64 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
65 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
66 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
67 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
68 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
69 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
70 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
71 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
72 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
73 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
74 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
75 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
76 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
77 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
78 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
79 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
80 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
81 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
82 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
83 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
84 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
85 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
86 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
87 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
88 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
89 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
90 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
91 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
92 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
93 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
94 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
95 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
96 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
97 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
98 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
99 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
100 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
101 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
102 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
103 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
104 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
105 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
106 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
107 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
108 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
109 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
110 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
111 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
112 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
113 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
114 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
115 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
116 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
117 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
118 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
119 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
120 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
121 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
122 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
123 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
124 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
125 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
126 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
127 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
128 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
129 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
130 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
131 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
132 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
133 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
134 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
135 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
136 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
137 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
138 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
141 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
145 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
146 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
147 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
148 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
149 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
150 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
151 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
152 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
153 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
154 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
155 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
156 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
157 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
158 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
159 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
160 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
161 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
162 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
163 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
164 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
165 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
166 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
167 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
168 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
169 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
170 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
176 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
177 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
180 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
184 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
185 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
186 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
187 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
188 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
189 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
190 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
191 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
194 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
197 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
199 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
225 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
236 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
327 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
328 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
331 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
332 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
333 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
338 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
339 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
340 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
341 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
342 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
343 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
344 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
345 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
346 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
347 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
348 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
349 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
350 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
351 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
352 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
353 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
354 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
355 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
356 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
357 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
358 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
359 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
360 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
361 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
362 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
363 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
364 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
365 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
366 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
367 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
368 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
369 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
370 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.49
Metatranscriptomes 0
Isolates 31.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.65
Nodule 25.21
Rhizoplane 5.67
Rhizosphere 37.61
Stem 0
Stem Tuber 0
Unclassified 13.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C3015 2010549000 Bacteria 1803
2 RicEn_FSXC8364_b1 2010549000 Bacteria 842
3 JGI24739J22299_10102631 3300001989 Bacteria 862
4 JGI25165J46597_1019337 3300003214 Bacteria 898
5 JGI25153J46596_10003132 3300003215 Bacteria 9329
6 JGI25153J46596_10009452 3300003215 Bacteria 4528
7 JGI25153J46596_10015838 3300003215 Bacteria 3049
8 rootH2_10008302 3300003320 Bacteria 1724
9 rootL2_10073210 3300003322 Bacteria 1373
10 JGI25160J50197_1002079 3300003354 Bacteria 9515
11 JGI25160J50197_1003509 3300003354 Bacteria 7001
12 Ga0055531_10010256 3300003794 Bacteria 4683
13 Ga0055543_1003926 3300004625 Bacteria 4202
14 Ga0065165_1001577 3300005262 Bacteria 23479
15 Ga0065165_1003271 3300005262 Bacteria 11689
16 Ga0065165_1011199 3300005262 Bacteria 3774
17 Ga0065165_1050656 3300005262 Bacteria 1181
18 Ga0065165_1059423 3300005262 Bacteria 1052
19 Ga0070658_10250004 3300005327 Bacteria 1504
20 Ga0070683_100097917 3300005329 Bacteria 2760
21 Ga0070670_100507858 3300005331 Bacteria 1072
22 Ga0070660_100102558 3300005339 Bacteria 2268
23 Ga0070668_100030699 3300005347 Bacteria 4088
24 Ga0070671_100016959 3300005355 Bacteria 5890
25 Ga0070673_100517379 3300005364 Bacteria 1081
26 Ga0070673_100753664 3300005364 Unclassified 897
27 Ga0070659_100444543 3300005366 Bacteria 1099
28 Ga0070667_100323630 3300005367 Bacteria 1392
29 Ga0070709_10462023 3300005434 Bacteria 958
30 Ga0070663_100005879 3300005455 Bacteria 7336
31 Ga0070663_100053037 3300005455 Bacteria 2894
32 Ga0070663_100106479 3300005455 Bacteria 2100
33 Ga0070678_100638102 3300005456 Bacteria 954
34 Ga0068853_100397368 3300005539 Bacteria 1290
35 Ga0070693_100542664 3300005547 Bacteria 831
36 Ga0070665_100051102 3300005548 Bacteria 4147
37 Ga0068855_100547770 3300005563 Bacteria 1253
38 Ga0068855_101031586 3300005563 Bacteria 863
39 Ga0068857_100601401 3300005577 Bacteria 1039
40 Ga0068854_100162174 3300005578 Bacteria 1732
41 Ga0068856_100089112 3300005614 Bacteria 3068
42 Ga0068852_100043310 3300005616 Bacteria 3817
43 Ga0068852_101052249 3300005616 Bacteria 833
44 Ga0068866_10047267 3300005718 Bacteria 2169
45 Ga0068858_100204734 3300005842 Bacteria 1867
46 Ga0075365_10112788 3300006038 Bacteria 1870
47 Ga0075365_10139093 3300006038 Bacteria 1685
48 Ga0075365_10232532 3300006038 Bacteria 1294
49 Ga0075368_10015524 3300006042 Bacteria 2828
50 Ga0075363_100006916 3300006048 Bacteria 5187
51 Ga0075364_10019010 3300006051 Bacteria 4309
52 Ga0075364_10049374 3300006051 Bacteria 2744
53 Ga0075362_10072825 3300006177 Bacteria 1572
54 Ga0075367_10018947 3300006178 Bacteria 3807
55 Ga0075367_10052326 3300006178 Bacteria 2416
56 Ga0075369_10028102 3300006186 Bacteria 2356
57 Ga0075369_10042505 3300006186 Bacteria 1949
58 Ga0075366_10049739 3300006195 Bacteria 2488
59 Ga0075370_10011798 3300006353 Bacteria 4600
60 Ga0075370_10112791 3300006353 Bacteria 1579
61 Ga0068865_100108403 3300006881 Bacteria 2044
62 Ga0099824_1027371 3300006942 Bacteria 2769
63 Ga0099823_1022671 3300006944 Bacteria 5798
64 Ga0105240_10022867 3300009093 Bacteria 8282
65 Ga0105240_10060844 3300009093 Bacteria 4707
66 Ga0105245_10009619 3300009098 Bacteria 8432
67 Ga0105245_10188078 3300009098 Bacteria 1976
68 Ga0105247_10012238 3300009101 Bacteria 5155
69 Ga0105243_10115908 3300009148 Bacteria 2250
70 Ga0105241_10052021 3300009174 Bacteria 3126
71 Ga0105241_10078928 3300009174 Bacteria 2573
72 Ga0105241_10088821 3300009174 Bacteria 2434
73 Ga0105248_10111921 3300009177 Bacteria 3079
74 Ga0105237_10009071 3300009545 Bacteria 10687
75 Ga0105237_10047396 3300009545 Bacteria 4320
76 Ga0105237_10217744 3300009545 Bacteria 1909
77 Ga0105237_10722444 3300009545 Bacteria 1003
78 Ga0105237_10917667 3300009545 Bacteria 883
79 Ga0105238_10186125 3300009551 Bacteria 2053
80 Ga0105238_11186658 3300009551 Bacteria 787
81 Ga0105249_10155796 3300009553 Bacteria 2203
82 Ga0099796_10249767 3300010159 Bacteria 736
83 Ga0105239_10048157 3300010375 Bacteria 4673
84 Ga0105239_10132157 3300010375 Bacteria 2777
85 Ga0105239_10143828 3300010375 Bacteria 2658
86 Ga0105239_10454974 3300010375 Bacteria 1452
87 Ga0105239_10533090 3300010375 Bacteria 1336
88 Ga0105239_10782977 3300010375 Bacteria 1092
89 Ga0105246_10016029 3300011119 Bacteria 4741
90 Ga0105246_10502104 3300011119 Bacteria 1030
91 Ga0157371_10341892 3300013102 Bacteria 1088
92 Ga0157374_10081002 3300013296 Bacteria 3080
93 Ga0157378_10393500 3300013297 Bacteria 1364
94 Ga0157378_10505251 3300013297 Bacteria 1208
95 Ga0163162_10041842 3300013306 Bacteria 4584
96 Ga0163162_10403251 3300013306 Bacteria 1500
97 Ga0163163_10502220 3300014325 Bacteria 1275
98 Ga0157377_10165116 3300014745 Bacteria 1380
99 Ga0157379_10047294 3300014968 Bacteria 3838
100 Ga0157376_10135003 3300014969 Bacteria 2207
101 Ga0157376_10483044 3300014969 Bacteria 1214
102 Ga0214544_1000001 3300021320 Bacteria 783667
103 Ga0214542_1000005 3300021321 Bacteria 389646
104 Ga0214542_1027073 3300021321 Bacteria 2684
105 Ga0214545_1000003 3300021324 Bacteria 720274
106 Ga0214545_1019813 3300021324 Bacteria 5618
107 Ga0214543_1000002 3300021327 Bacteria 712733
108 Ga0207425_1009648 3300025245 Bacteria 2391
109 Ga0209677_105397 3300025253 Bacteria 3345
110 Ga0209148_1000578 3300025254 Bacteria 33857
111 Ga0209233_1006411 3300025261 Bacteria 3795
112 Ga0209233_1008559 3300025261 Bacteria 3156
113 Ga0209455_1000876 3300025272 Bacteria 15927
114 Ga0209564_1007418 3300025295 Bacteria 5672
115 Ga0209758_1000026 3300025297 Bacteria 582706
116 Ga0209758_1000479 3300025297 Bacteria 65956
117 Ga0209758_1001536 3300025297 Bacteria 26563
118 Ga0209758_1005453 3300025297 Bacteria 9789
119 Ga0209758_1009114 3300025297 Bacteria 6256
120 Ga0209256_1011640 3300025299 Bacteria 3488
121 Ga0209256_1027256 3300025299 Bacteria 1631
122 Ga0207426_1001455 3300025302 Bacteria 19596
123 Ga0207426_1002534 3300025302 Bacteria 11465
124 Ga0207426_1006447 3300025302 Bacteria 5109
125 Ga0209257_1005738 3300025304 Bacteria 8496
126 Ga0209257_1009389 3300025304 Bacteria 5259
127 Ga0209257_1032969 3300025304 Bacteria 1634
128 Ga0207697_10017910 3300025315 Bacteria 2908
129 Ga0207710_10099959 3300025900 Bacteria 1367
130 Ga0207688_10032427 3300025901 Bacteria 2887
131 Ga0207647_10001122 3300025904 Bacteria 20595
132 Ga0207705_10261151 3300025909 Bacteria 1322
133 Ga0207654_10031489 3300025911 Bacteria 2922
134 Ga0207654_10057695 3300025911 Bacteria 2257
135 Ga0207695_10000006 3300025913 Bacteria 1135309
136 Ga0207671_10010732 3300025914 Bacteria 7530
137 Ga0207671_10275206 3300025914 Bacteria 1327
138 Ga0207681_10056349 3300025923 Bacteria 2681
139 Ga0207694_10793821 3300025924 Bacteria 800
140 Ga0207650_10157843 3300025925 Bacteria 1795
141 Ga0207687_10178430 3300025927 Bacteria 1644
142 Ga0207644_10121422 3300025931 Bacteria 1989
143 Ga0207704_10182468 3300025938 Bacteria 1518
144 Ga0207691_10172815 3300025940 Bacteria 1891
145 Ga0207679_10764990 3300025945 Bacteria 879
146 Ga0207667_10127423 3300025949 Bacteria 2622
147 Ga0207667_10480015 3300025949 Bacteria 1262
148 Ga0207651_10678450 3300025960 Unclassified 906
149 Ga0207640_10570459 3300025981 Bacteria 954
150 Ga0207639_10170430 3300026041 Bacteria 1843
151 Ga0207678_10010858 3300026067 Bacteria 8004
152 Ga0207678_10026500 3300026067 Bacteria 5056
153 Ga0207678_10153723 3300026067 Bacteria 1964
154 Ga0207678_10563925 3300026067 Bacteria 997
155 Ga0207702_10318363 3300026078 Bacteria 1481
156 Ga0207641_10070060 3300026088 Bacteria 3013
157 Ga0207698_10180252 3300026142 Bacteria 1870
158 Ga0207698_10950709 3300026142 Bacteria 868
159 Ga0209389_1000057 3300027296 Bacteria 107632
160 Ga0209389_1000408 3300027296 Bacteria 25517
161 Ga0209589_1003940 3300027357 Bacteria 25831
162 Ga0209489_100226 3300027361 Bacteria 94384
163 Ga0209489_104278 3300027361 Bacteria 26522
164 Ga0209700_100085 3300027363 Bacteria 128517
165 Ga0268266_10027864 3300028379 Bacteria 4804
166 Ga0307510_10095926 3300033180 Bacteria 2784
167 Ga0307510_10288502 3300033180 Bacteria 1108
168 Ga0395899_0082714 3300037312 Bacteria 2335
169 Ga0395900_0001375 3300037418 Bacteria 29263
170 Ga0395900_0257509 3300037418 Bacteria 1744
171 Ga0395900_0271350 3300037418 Bacteria 1691
172 Ga0395898_0011882 3300037466 Bacteria 9015
173 Ga0395905_0108724 3300037471 Bacteria 2603
174 Ga0395901_0030065 3300038443 Bacteria 5595
175 Ga0395901_0166424 3300038443 Bacteria 2315
176 Ga0451793_0784623 3300041452 Bacteria 1193
177 Ga0451795_0933452 3300041456 Bacteria 1278
178 Ga0451853_2229847 3300041512 Bacteria 1017
179 Ga0466972_0002026 3300044658 Bacteria 9923
180 Ga0466972_0016778 3300044658 Bacteria 3661
181 Ga0466972_0171634 3300044658 Bacteria 1018
182 Ga0466965_0016877 3300044683 Bacteria 3482
183 Ga0466966_0005947 3300044684 Bacteria 8051
184 Ga0466961_0000863 3300044693 Bacteria 18927
185 Ga0466961_0046672 3300044693 Bacteria 2770
186 Ga0466963_0085767 3300044694 Bacteria 2138
187 Ga0466964_0042955 3300044706 Bacteria 1833
188 Ga0466964_0419494 3300044706 Bacteria 703
189 Ga0466971_0022035 3300044719 Bacteria 2836
190 Ga0466968_0046951 3300044735 Bacteria 1835
191 Ga0466968_0143233 3300044735 Bacteria 1094
192 Ga0466970_0151026 3300044765 Bacteria 1282
193 Ga0466957_0187308 3300044842 Bacteria 1354
194 Ga0466957_0194247 3300044842 Bacteria 1331
195 Ga0466960_0031869 3300044901 Bacteria 2435
196 Ga0466959_0093008 3300045049 Bacteria 2164
197 Ga0466967_0084535 3300045976 Bacteria 2871
198 Ga0495592_0022986 3300046454 Bacteria 4745
199 Ga0495651_0008654 3300046462 Bacteria 7809
200 Ga0495653_0116906 3300046463 Bacteria 1906
201 Ga0495664_0063668 3300046477 Bacteria 2198
202 Ga0495664_0135981 3300046477 Bacteria 1489
203 Ga0495583_0208717 3300046506 Bacteria 792
204 Ga0495606_0006533 3300046507 Bacteria 10724
205 Ga0495606_0125239 3300046507 Bacteria 1533
206 Ga0495608_0091559 3300046511 Bacteria 1966
207 Ga0495608_0127347 3300046511 Bacteria 1631
208 Ga0495618_0278851 3300046514 Bacteria 1043
209 Ga0495628_0219577 3300046516 Bacteria 1428
210 Ga0495631_0095638 3300046518 Bacteria 1279
211 Ga0495632_0112881 3300046519 Bacteria 1275
212 Ga0495643_0134777 3300046522 Bacteria 1237
213 Ga0495643_0215910 3300046522 Bacteria 913
214 Ga0495652_0191470 3300046529 Bacteria 1560
215 Ga0495652_0506168 3300046529 Bacteria 837
216 Ga0495587_0243726 3300046536 Bacteria 1011
217 Ga0495587_0296337 3300046536 Bacteria 905
218 Ga0495645_0087057 3300046543 Bacteria 2235
219 Ga0495622_0137235 3300046557 Bacteria 1111
220 Ga0495667_0056924 3300046559 Bacteria 2570
221 Ga0495668_0034541 3300046616 Bacteria 2836
222 Ga0495634_0044257 3300046642 Bacteria 3014
223 Ga0495625_0149639 3300046660 Bacteria 1570
224 Ga0495635_0023808 3300046663 Bacteria 4267
225 Ga0495657_0005091 3300046675 Bacteria 10441
226 Ga0495657_0070700 3300046675 Bacteria 2280
227 Ga0495623_0019288 3300046679 Bacteria 4408
228 Ga0495646_0027624 3300046680 Bacteria 3559
229 Ga0495658_0414056 3300046683 Bacteria 860
230 Ga0495613_0151876 3300046689 Bacteria 1651
231 Ga0495624_0314592 3300046690 Bacteria 943
232 Ga0495624_0361619 3300046690 Bacteria 873
233 Ga0495649_0008578 3300046694 Bacteria 6138
234 Ga0495600_0003192 3300046809 Bacteria 9599
235 Ga0495600_0063812 3300046809 Bacteria 2407
236 Ga0495581_0084235 3300047315 Bacteria 1842
237 Ga0495604_0001817 3300047317 Bacteria 17374
238 Ga0495604_0279801 3300047317 Bacteria 1127
239 Ga0495674_0083125 3300047319 Bacteria 2745
240 Ga0495676_0042637 3300047321 Bacteria 3722
241 Ga0495680_0004783 3300047322 Bacteria 12853
242 Ga0495683_0107408 3300047323 Bacteria 1336
243 Ga0495687_024634 3300047443 Bacteria 2857
244 Ga0495675_0010677 3300047444 Bacteria 5744
245 Ga0495673_0073475 3300047469 Bacteria 1433
246 Ga0495593_0101512 3300047673 Bacteria 1475
247 Ga0495602_0141079 3300048088 Bacteria 1907
248 Ga0496100_0296133 3300048903 Bacteria 1210
249 Ga0496101_0107733 3300048904 Bacteria 2094
250 Ga0496102_0003789 3300048905 Bacteria 12786
251 Ga0496102_0027530 3300048905 Bacteria 5076
252 Ga0496104_0002743 3300048907 Bacteria 15154
253 Ga0496104_0029503 3300048907 Bacteria 5089
254 Ga0496104_0114217 3300048907 Bacteria 2589
255 Ga0496104_0182849 3300048907 Bacteria 2007
256 Ga0496105_0056554 3300048908 Bacteria 3238
257 Ga0496105_0059798 3300048908 Bacteria 3144
258 Ga0496107_0008411 3300048910 Bacteria 7141
259 Ga0496107_0187249 3300048910 Bacteria 1537
260 Ga0496107_0229177 3300048910 Bacteria 1382
261 Ga0496108_0025878 3300048911 Bacteria 4839
262 Ga0496108_0315345 3300048911 Bacteria 1363
263 Ga0496108_0505451 3300048911 Bacteria 1055
264 Ga0496110_0023688 3300048913 Bacteria 5223
265 Ga0496110_0040385 3300048913 Bacteria 4067
266 Ga0496111_0046070 3300048914 Bacteria 3139
267 Ga0496112_0043463 3300048915 Bacteria 4399
268 Ga0496113_0086238 3300048916 Bacteria 2412
269 Ga0496113_0203112 3300048916 Bacteria 1575
270 Ga0496114_0058730 3300048917 Bacteria 3212
271 Ga0496115_0001860 3300048918 Bacteria 15092
272 Ga0496115_0171677 3300048918 Bacteria 1793
273 Ga0496118_0154411 3300048921 Bacteria 1431
274 Ga0496118_0205111 3300048921 Bacteria 1163
275 Ga0496119_0006768 3300048922 Bacteria 10513
276 Ga0496119_0032207 3300048922 Bacteria 3498
277 Ga0496120_0010148 3300048923 Bacteria 6597
278 Ga0496121_0058967 3300048924 Bacteria 3168
279 Ga0496121_0123570 3300048924 Bacteria 1950
280 Ga0496121_0140028 3300048924 Bacteria 1796
281 Ga0496121_0157463 3300048924 Bacteria 1665
282 Ga0496122_0192764 3300048925 Bacteria 1201
283 Ga0496123_0170077 3300048926 Bacteria 1151
284 Ga0496124_0094099 3300048927 Bacteria 2438
285 Ga0496124_0193650 3300048927 Bacteria 1553
286 Ga0496125_0060549 3300048928 Bacteria 3042
287 Ga0496125_0061781 3300048928 Bacteria 3002
288 Ga0496125_0187292 3300048928 Bacteria 1371
289 Ga0496126_0214325 3300048929 Bacteria 1620
290 Ga0495682_0043335 3300049460 Bacteria 1648
291 nmdc:mga03n38_18035_c1 3300050490 Bacteria 2778
292 nmdc:mga00v17_6086_c1 3300050491 Bacteria 6385
293 nmdc:mga0yw44_23704_c1 3300050492 Bacteria 3462
294 nmdc:mga0yw44_416239_c1 3300050492 Bacteria 910
295 nmdc:mga0k408_206439_c1 3300050493 Bacteria 1173
296 nmdc:mga07m45_58915_c1 3300050496 Bacteria 2173
297 nmdc:mga07m45_92163_c1 3300050496 Bacteria 1737
298 nmdc:mga0sz30_107966_c1 3300050516 Bacteria 1218
299 nmdc:mga0sz30_28757_c1 3300050516 Bacteria 2288
300 nmdc:mga0sz30_50358_c1 3300050516 Bacteria 1766
301 Ga0495601_0441654 3300053077 Bacteria 842
302 Ga0495619_0282609 3300053085 Bacteria 1150
303 Ga0500578_0030986 3300053086 Bacteria 3437
304 Ga0500643_000057 3300053087 Bacteria 131401
305 Ga0500583_0001553 3300053092 Bacteria 6638
306 Ga0500566_0001729 3300053094 Bacteria 12815
307 Ga0500566_0152206 3300053094 Bacteria 1215
308 Ga0500555_005133 3300053103 Bacteria 3713
309 Ga0500569_166327 3300053109 Bacteria 747
310 Ga0500572_012619 3300053111 Bacteria 2074
311 Ga0500595_013390 3300053119 Bacteria 3143
312 Ga0500608_045010 3300053122 Bacteria 2120
313 Ga0500608_089985 3300053122 Bacteria 1436
314 Ga0500614_061536 3300053123 Bacteria 1010
315 Ga0500621_076701 3300053126 Bacteria 1344
316 Ga0500642_0023889 3300053130 Bacteria 2462
317 Ga0500658_0086486 3300053134 Bacteria 1349
318 Ga0500559_0019052 3300053136 Bacteria 2900
319 Ga0500568_0021396 3300053139 Bacteria 2782
320 Ga0500590_112720 3300053148 Bacteria 1287
321 Ga0500619_057717 3300053154 Bacteria 1270
322 Ga0500620_066123 3300053155 Bacteria 1237
323 Ga0500638_025857 3300053162 Bacteria 2809
324 Ga0500638_074021 3300053162 Bacteria 1625
325 Ga0500636_0004999 3300053177 Bacteria 7525
326 Ga0500636_0143716 3300053177 Bacteria 1318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0108724 Ga0395905_0108724_687_1268 193
2 3300005329 Ga0070683_100097917 Ga0070683_1000979173 194
3 3300005364 Ga0070673_100753664 Ga0070673_1007536642 194
4 3300005455 Ga0070663_100005879 Ga0070663_1000058797 194
5 3300005548 Ga0070665_100051102 Ga0070665_1000511023 194
6 3300005718 Ga0068866_10047267 Ga0068866_100472673 194
7 3300006881 Ga0068865_100108403 Ga0068865_1001084032 194
8 3300009098 Ga0105245_10009619 Ga0105245_100096197 194
9 3300009545 Ga0105237_10217744 Ga0105237_102177441 194
10 3300011119 Ga0105246_10502104 Ga0105246_105021041 194
11 3300013297 Ga0157378_10505251 Ga0157378_105052512 194
12 3300013306 Ga0163162_10041842 Ga0163162_100418424 194
13 3300014745 Ga0157377_10165116 Ga0157377_101651161 194
14 3300014968 Ga0157379_10047294 Ga0157379_100472943 194
15 3300014969 Ga0157376_10135003 Ga0157376_101350033 194
16 3300025909 Ga0207705_10261151 Ga0207705_102611512 194
17 3300025927 Ga0207687_10178430 Ga0207687_101784302 194
18 3300025938 Ga0207704_10182468 Ga0207704_101824683 194
19 3300025940 Ga0207691_10172815 Ga0207691_101728152 194
20 3300025945 Ga0207679_10764990 Ga0207679_107649901 194
21 3300025960 Ga0207651_10678450 Ga0207651_106784501 194
22 3300026067 Ga0207678_10010858 Ga0207678_100108587 194
23 3300028379 Ga0268266_10027864 Ga0268266_100278643 194
24 3300047317 Ga0495604_0001817 Ga0495604_0001817_11909_12571 194
25 3300048905 Ga0496102_0003789 Ga0496102_0003789_3599_4246 194
26 3300048907 Ga0496104_0114217 Ga0496104_0114217_895_1542 194
27 3300048908 Ga0496105_0059798 Ga0496105_0059798_2222_2869 194
28 3300048910 Ga0496107_0008411 Ga0496107_0008411_4926_5573 194
29 3300048911 Ga0496108_0505451 Ga0496108_0505451_264_911 194
30 3300048913 Ga0496110_0040385 Ga0496110_0040385_186_833 194
31 3300048914 Ga0496111_0046070 Ga0496111_0046070_2167_2814 194
32 3300048916 Ga0496113_0086238 Ga0496113_0086238_618_1265 194
33 3300048917 Ga0496114_0058730 Ga0496114_0058730_167_814 194
34 3300048918 Ga0496115_0001860 Ga0496115_0001860_9383_10030 194
35 3300048921 Ga0496118_0205111 Ga0496118_0205111_565_1152 195
36 3300037312 Ga0395899_0082714 Ga0395899_0082714_1277_1945 196
37 3300037418 Ga0395900_0001375 Ga0395900_0001375_13789_14457 196
38 3300037466 Ga0395898_0011882 Ga0395898_0011882_1328_1996 196
39 3300038443 Ga0395901_0030065 Ga0395901_0030065_4701_5369 196
40 iso_pu_bacteria 2513237104 2513717064 196
41 3300010159 Ga0099796_10249767 Ga0099796_102497671 198
42 3300044693 Ga0466961_0046672 Ga0466961_0046672_767_1375 198
43 3300044719 Ga0466971_0022035 Ga0466971_0022035_1102_1710 198
44 3300044842 Ga0466957_0187308 Ga0466957_0187308_522_1130 198
45 3300045049 Ga0466959_0093008 Ga0466959_0093008_191_799 198
46 3300003320 rootH2_10008302 rootH2_100083023 199
47 3300021320 Ga0214544_1000001 Ga0214544_1000001190 199
48 3300021321 Ga0214542_1000005 Ga0214542_1000005190 199
49 3300021324 Ga0214545_1000003 Ga0214545_1000003574 199
50 3300021327 Ga0214543_1000002 Ga0214543_1000002191 199
51 3300048924 Ga0496121_0123570 Ga0496121_0123570_927_1616 201
52 iso_pu_bacteria 2507262055 2507511168 202
53 iso_pu_bacteria 2508501009 2508544977 202
54 iso_pu_bacteria 2508501042 2508693713 202
55 iso_pu_bacteria 2513237139 2513874790 202
56 iso_pu_bacteria 2513237161 2514010492 202
57 iso_pu_bacteria 2515154112 2515625266 202
58 iso_pu_bacteria 2617270735 2617353564 202
59 iso_pu_bacteria 2802429603 2805916791 202
60 iso_pu_bacteria 2824600985 2824603984 202
61 iso_pu_bacteria 2824609381 2824611565 202
62 iso_pu_bacteria 2824653114 2824655411 202
63 iso_pu_bacteria 2824671348 2824673551 202
64 iso_pu_bacteria 2824679649 2824680925 202
65 iso_pu_bacteria 2824687955 2824690326 202
66 iso_pu_bacteria 2824696289 2824701264 202
67 iso_pu_bacteria 2824732956 2824734729 202
68 iso_pu_bacteria 2824746037 2824747698 202
69 iso_pu_bacteria 2824753945 2824754596 202
70 iso_pu_bacteria 2824763712 2824765358 202
71 iso_pu_bacteria 2824773399 2824773457 202
72 iso_pu_bacteria 2838122688 2838128037 202
73 iso_pu_bacteria 2841941048 2841943334 202
74 iso_pu_bacteria 2841949485 2841953937 202
75 iso_pu_bacteria 2841957949 2841962030 202
76 iso_pu_bacteria 2841966195 2841968030 202
77 iso_pu_bacteria 2841974524 2841981284 202
78 iso_pu_bacteria 2841983080 2841988133 202
79 iso_pu_bacteria 2842038055 2842042559 202
80 iso_pu_bacteria 2842045827 2842050602 202
81 iso_pu_bacteria 2844315083 2844316764 202
82 iso_pu_bacteria 2847930680 2847938708 202
83 iso_pu_bacteria 2847939898 2847944094 202
84 iso_pu_bacteria 2857509624 2857512333 202
85 iso_pu_bacteria 2874590934 2874597902 202
86 iso_pu_bacteria 2874628541 2874631379 202
87 iso_pu_bacteria 2874645413 2874651430 202
88 iso_pu_bacteria 2876771140 2876776502 202
89 iso_pu_bacteria 2876818435 2876824908 202
90 iso_pu_bacteria 2879074833 2879081635 202
91 iso_pu_bacteria 2879083081 2879088317 202
92 iso_pu_bacteria 2879127579 2879134190 202
93 iso_pu_bacteria 2879142872 2879147850 202
94 iso_pu_bacteria 2885366525 2885366791 202
95 iso_pu_bacteria 2885409591 2885415875 202
96 iso_pu_bacteria 2888388044 2888389265 202
97 iso_pu_bacteria 2888419890 2888421793 202
98 iso_pu_bacteria 2903727486 2903733819 202
99 iso_pu_bacteria 2904711408 2904719395 202
100 iso_pu_bacteria 2906602504 2906606756 202
101 iso_pu_bacteria 2906626472 2906627482 202
102 iso_pu_bacteria 2906643746 2906644917 202
103 iso_pu_bacteria 2908775508 2908781747 202
104 iso_pu_bacteria 2922393267 2922401151 202
105 iso_pu_bacteria 2929615660 2929619418 202
106 iso_pu_bacteria 2929624759 2929628112 202
107 iso_pu_bacteria 2933577622 2933581338 202
108 iso_pu_bacteria 2935608549 2935612604 202
109 iso_pu_bacteria 2935648319 2935653500 202
110 iso_pu_bacteria 2935656913 2935662249 202
111 iso_pu_bacteria 2935769743 2935776166 202
112 iso_pu_bacteria 2935777560 2935785268 202
113 iso_pu_bacteria 2935785616 2935792023 202
114 iso_pu_bacteria 2935793552 2935800327 202
115 iso_pu_bacteria 2935819856 2935824093 202
116 iso_pu_bacteria 2935847175 2935852760 202
117 iso_pu_bacteria 2935908558 2935912087 202
118 iso_pu_bacteria 2935916978 2935922298 202
119 iso_pu_bacteria 2935926038 2935929116 202
120 iso_pu_bacteria 2935934488 2935935747 202
121 iso_pu_bacteria 2935942939 2935947313 202
122 iso_pu_bacteria 2935951376 2935953593 202
123 iso_pu_bacteria 2935967501 2935968619 202
124 iso_pu_bacteria 2935975950 2935976801 202
125 iso_pu_bacteria 2935984226 2935992111 202
126 iso_pu_bacteria 2936011229 2936016551 202
127 iso_pu_bacteria 2936019824 2936025135 202
128 iso_pu_bacteria 2936028420 2936034026 202
129 iso_pu_bacteria 2936046547 2936052034 202
130 iso_pu_bacteria 2936055302 2936059807 202
131 iso_pu_bacteria 3005506211 3005511368 202
132 iso_pu_bacteria 3005718088 3005719529 202
133 iso_pu_bacteria 8016511872 8016516620 202
134 iso_pu_bacteria 8016522445 8016524005 202
135 iso_pu_bacteria 8016530956 8016537543 202
136 iso_pu_bacteria 8016539877 8016541813 202
137 iso_pu_bacteria 8016548790 8016551461 202
138 iso_pu_bacteria 8016557553 8016559844 202
139 iso_pu_bacteria 8016566248 8016567198 202
140 iso_pu_bacteria 8016575299 8016579914 202
141 iso_pu_bacteria 8016583857 8016588932 202
142 iso_pu_bacteria 8016595262 8016597784 202
143 iso_pu_bacteria 8016613128 8016620491 202
144 iso_pu_bacteria 8016622563 8016629492 202
145 iso_pu_bacteria 8019530166 8019537220 202
146 iso_pu_bacteria 8019538911 8019538930 202
147 iso_pu_bacteria 8019547302 8019548429 202
148 iso_pu_bacteria 8019619141 8019624973 202
149 iso_pu_bacteria 8019629233 8019637208 202
150 iso_pu_bacteria 8019638758 8019642382 202
151 iso_pu_bacteria 8019648815 8019650197 202
152 iso_pu_bacteria 8019668869 8019674602 202
153 iso_pu_bacteria 8019678201 8019681499 202
154 iso_pu_bacteria 8019687851 8019694283 202
155 iso_pu_bacteria 8055742211 8055749325 202
156 iso_pu_bacteria 8056967851 8056973576 202
157 iso_pu_bacteria 2513237095 2513650883 203
158 iso_pu_bacteria 2513237102 2513700472 203
159 iso_pu_bacteria 2524023205 2524438049 203
160 iso_pu_bacteria 2744054633 2745080995 203
161 iso_pu_bacteria 2791355196 2793061894 203
162 iso_pu_bacteria 2816332527 2818238303 203
163 iso_pu_bacteria 2824617872 2824622471 203
164 iso_pu_bacteria 2824626560 2824630349 203
165 iso_pu_bacteria 2824635225 2824638323 203
166 iso_pu_bacteria 2824644064 2824645937 203
167 iso_pu_bacteria 2824714736 2824716058 203
168 iso_pu_bacteria 2824723954 2824725914 203
169 iso_pu_bacteria 2849076700 2849081681 203
170 iso_pu_bacteria 2874612657 2874619705 203
171 iso_pu_bacteria 2874620515 2874626181 203
172 iso_pu_bacteria 2881364244 2881365941 203
173 iso_pu_bacteria 2881665667 2881667491 203
174 iso_pu_bacteria 2888378607 2888381373 203
175 iso_pu_bacteria 2904666416 2904669199 203
176 iso_pu_bacteria 3005594810 3005596373 203
177 iso_pu_bacteria 8006926726 8006930131 203
178 3300041456 Ga0451795_0933452 Ga0451795_0933452_47_664 205
179 3300001989 JGI24739J22299_10102631 JGI24739J22299_101026311 206
180 3300003214 JGI25165J46597_1019337 JGI25165J46597_10193371 206
181 3300003215 JGI25153J46596_10003132 JGI25153J46596_100031328 206
182 3300003215 JGI25153J46596_10015838 JGI25153J46596_100158386 206
183 3300003354 JGI25160J50197_1002079 JGI25160J50197_10020798 206
184 3300003354 JGI25160J50197_1003509 JGI25160J50197_10035093 206
185 3300004625 Ga0055543_1003926 Ga0055543_10039267 206
186 3300005262 Ga0065165_1001577 Ga0065165_100157719 206
187 3300005262 Ga0065165_1003271 Ga0065165_10032718 206
188 3300005262 Ga0065165_1050656 Ga0065165_10506561 206
189 3300005262 Ga0065165_1059423 Ga0065165_10594232 206
190 3300005327 Ga0070658_10250004 Ga0070658_102500042 206
191 3300005366 Ga0070659_100444543 Ga0070659_1004445431 206
192 3300005434 Ga0070709_10462023 Ga0070709_104620231 206
193 3300005455 Ga0070663_100053037 Ga0070663_1000530373 206
194 3300005539 Ga0068853_100397368 Ga0068853_1003973682 206
195 3300005547 Ga0070693_100542664 Ga0070693_1005426641 206
196 3300005563 Ga0068855_101031586 Ga0068855_1010315861 206
197 3300005578 Ga0068854_100162174 Ga0068854_1001621742 206
198 3300005616 Ga0068852_100043310 Ga0068852_1000433103 206
199 3300006038 Ga0075365_10112788 Ga0075365_101127882 206
200 3300006038 Ga0075365_10139093 Ga0075365_101390932 206
201 3300006051 Ga0075364_10049374 Ga0075364_100493743 206
202 3300006178 Ga0075367_10052326 Ga0075367_100523261 206
203 3300006186 Ga0075369_10028102 Ga0075369_100281022 206
204 3300006186 Ga0075369_10042505 Ga0075369_100425052 206
205 3300006353 Ga0075370_10011798 Ga0075370_100117982 206
206 3300006353 Ga0075370_10112791 Ga0075370_101127913 206
207 3300006944 Ga0099823_1022671 Ga0099823_10226717 206
208 3300009093 Ga0105240_10022867 Ga0105240_100228679 206
209 3300009098 Ga0105245_10188078 Ga0105245_101880784 206
210 3300009174 Ga0105241_10052021 Ga0105241_100520214 206
211 3300009174 Ga0105241_10088821 Ga0105241_100888212 206
212 3300009545 Ga0105237_10009071 Ga0105237_100090719 206
213 3300009545 Ga0105237_10722444 Ga0105237_107224441 206
214 3300009545 Ga0105237_10917667 Ga0105237_109176671 206
215 3300009551 Ga0105238_11186658 Ga0105238_111866582 206
216 3300010375 Ga0105239_10048157 Ga0105239_100481574 206
217 3300010375 Ga0105239_10132157 Ga0105239_101321573 206
218 3300010375 Ga0105239_10143828 Ga0105239_101438284 206
219 3300010375 Ga0105239_10454974 Ga0105239_104549742 206
220 3300010375 Ga0105239_10533090 Ga0105239_105330902 206
221 3300013102 Ga0157371_10341892 Ga0157371_103418922 206
222 3300014969 Ga0157376_10483044 Ga0157376_104830442 206
223 3300021321 Ga0214542_1027073 Ga0214542_10270732 206
224 3300021324 Ga0214545_1019813 Ga0214545_10198132 206
225 3300025253 Ga0209677_105397 Ga0209677_1053973 206
226 3300025254 Ga0209148_1000578 Ga0209148_100057821 206
227 3300025261 Ga0209233_1006411 Ga0209233_10064115 206
228 3300025261 Ga0209233_1008559 Ga0209233_10085592 206
229 3300025272 Ga0209455_1000876 Ga0209455_10008767 206
230 3300025295 Ga0209564_1007418 Ga0209564_10074182 206
231 3300025297 Ga0209758_1000479 Ga0209758_100047928 206
232 3300025297 Ga0209758_1001536 Ga0209758_10015369 206
233 3300025297 Ga0209758_1005453 Ga0209758_10054536 206
234 3300025297 Ga0209758_1009114 Ga0209758_10091145 206
235 3300025302 Ga0207426_1001455 Ga0207426_100145513 206
236 3300025302 Ga0207426_1002534 Ga0207426_10025348 206
237 3300025302 Ga0207426_1006447 Ga0207426_10064473 206
238 3300025304 Ga0209257_1032969 Ga0209257_10329692 206
239 3300025911 Ga0207654_10031489 Ga0207654_100314894 206
240 3300025913 Ga0207695_10000006 Ga0207695_100000061056 206
241 3300025914 Ga0207671_10010732 Ga0207671_100107329 206
242 3300025924 Ga0207694_10793821 Ga0207694_107938212 206
243 3300025949 Ga0207667_10127423 Ga0207667_101274232 206
244 3300026041 Ga0207639_10170430 Ga0207639_101704302 206
245 3300026067 Ga0207678_10153723 Ga0207678_101537232 206
246 3300026067 Ga0207678_10563925 Ga0207678_105639251 206
247 3300026078 Ga0207702_10318363 Ga0207702_103183632 206
248 3300026142 Ga0207698_10180252 Ga0207698_101802521 206
249 3300027296 Ga0209389_1000057 Ga0209389_100005738 206
250 3300027361 Ga0209489_100226 Ga0209489_10022627 206
251 3300027363 Ga0209700_100085 Ga0209700_10008555 206
252 3300033180 Ga0307510_10095926 Ga0307510_100959266 206
253 3300033180 Ga0307510_10288502 Ga0307510_102885021 206
254 3300037418 Ga0395900_0257509 Ga0395900_0257509_184_804 206
255 3300041452 Ga0451793_0784623 Ga0451793_0784623_345_965 206
256 3300041512 Ga0451853_2229847 Ga0451853_2229847_163_783 206
257 3300044658 Ga0466972_0171634 Ga0466972_0171634_234_911 206
258 3300044683 Ga0466965_0016877 Ga0466965_0016877_2726_3346 206
259 3300044684 Ga0466966_0005947 Ga0466966_0005947_5453_6103 206
260 3300044693 Ga0466961_0000863 Ga0466961_0000863_16044_16694 206
261 3300044694 Ga0466963_0085767 Ga0466963_0085767_10_630 206
262 3300044706 Ga0466964_0042955 Ga0466964_0042955_660_1280 206
263 3300044735 Ga0466968_0143233 Ga0466968_0143233_15_635 206
264 3300044765 Ga0466970_0151026 Ga0466970_0151026_66_764 206
265 3300044842 Ga0466957_0194247 Ga0466957_0194247_677_1297 206
266 3300045976 Ga0466967_0084535 Ga0466967_0084535_621_1241 206
267 3300046454 Ga0495592_0022986 Ga0495592_0022986_3034_3678 206
268 3300046462 Ga0495651_0008654 Ga0495651_0008654_1881_2525 206
269 3300046463 Ga0495653_0116906 Ga0495653_0116906_740_1384 206
270 3300046477 Ga0495664_0063668 Ga0495664_0063668_1001_1645 206
271 3300046477 Ga0495664_0135981 Ga0495664_0135981_356_1012 206
272 3300046506 Ga0495583_0208717 Ga0495583_0208717_31_651 206
273 3300046507 Ga0495606_0006533 Ga0495606_0006533_9121_9741 206
274 3300046511 Ga0495608_0091559 Ga0495608_0091559_533_1177 206
275 3300046511 Ga0495608_0127347 Ga0495608_0127347_918_1586 206
276 3300046514 Ga0495618_0278851 Ga0495618_0278851_101_769 206
277 3300046516 Ga0495628_0219577 Ga0495628_0219577_59_715 206
278 3300046518 Ga0495631_0095638 Ga0495631_0095638_495_1115 206
279 3300046522 Ga0495643_0134777 Ga0495643_0134777_601_1221 206
280 3300046522 Ga0495643_0215910 Ga0495643_0215910_32_652 206
281 3300046529 Ga0495652_0191470 Ga0495652_0191470_339_1007 206
282 3300046529 Ga0495652_0506168 Ga0495652_0506168_73_717 206
283 3300046536 Ga0495587_0243726 Ga0495587_0243726_312_980 206
284 3300046536 Ga0495587_0296337 Ga0495587_0296337_98_742 206
285 3300046543 Ga0495645_0087057 Ga0495645_0087057_69_713 206
286 3300046557 Ga0495622_0137235 Ga0495622_0137235_382_1050 206
287 3300046559 Ga0495667_0056924 Ga0495667_0056924_1464_2108 206
288 3300046642 Ga0495634_0044257 Ga0495634_0044257_1102_1746 206
289 3300046660 Ga0495625_0149639 Ga0495625_0149639_776_1396 206
290 3300046663 Ga0495635_0023808 Ga0495635_0023808_2264_2932 206
291 3300046675 Ga0495657_0005091 Ga0495657_0005091_6017_6661 206
292 3300046675 Ga0495657_0070700 Ga0495657_0070700_85_753 206
293 3300046679 Ga0495623_0019288 Ga0495623_0019288_1931_2575 206
294 3300046680 Ga0495646_0027624 Ga0495646_0027624_1526_2170 206
295 3300046683 Ga0495658_0414056 Ga0495658_0414056_146_814 206
296 3300046689 Ga0495613_0151876 Ga0495613_0151876_79_747 206
297 3300046690 Ga0495624_0314592 Ga0495624_0314592_29_697 206
298 3300046690 Ga0495624_0361619 Ga0495624_0361619_200_844 206
299 3300046694 Ga0495649_0008578 Ga0495649_0008578_1962_2582 206
300 3300046809 Ga0495600_0003192 Ga0495600_0003192_1203_1847 206
301 3300046809 Ga0495600_0063812 Ga0495600_0063812_1605_2273 206
302 3300047315 Ga0495581_0084235 Ga0495581_0084235_1122_1790 206
303 3300047317 Ga0495604_0279801 Ga0495604_0279801_109_777 206
304 3300047319 Ga0495674_0083125 Ga0495674_0083125_198_842 206
305 3300047321 Ga0495676_0042637 Ga0495676_0042637_2669_3337 206
306 3300047322 Ga0495680_0004783 Ga0495680_0004783_11454_12098 206
307 3300047323 Ga0495683_0107408 Ga0495683_0107408_234_878 206
308 3300047444 Ga0495675_0010677 Ga0495675_0010677_3437_4081 206
309 3300047469 Ga0495673_0073475 Ga0495673_0073475_632_1252 206
310 3300047673 Ga0495593_0101512 Ga0495593_0101512_249_917 206
311 3300048088 Ga0495602_0141079 Ga0495602_0141079_307_975 206
312 3300048904 Ga0496101_0107733 Ga0496101_0107733_1389_2057 206
313 3300048907 Ga0496104_0002743 Ga0496104_0002743_9197_9865 206
314 3300048907 Ga0496104_0182849 Ga0496104_0182849_755_1414 206
315 3300048910 Ga0496107_0229177 Ga0496107_0229177_60_680 206
316 3300048911 Ga0496108_0315345 Ga0496108_0315345_442_1101 206
317 3300048918 Ga0496115_0171677 Ga0496115_0171677_634_1302 206
318 3300048921 Ga0496118_0154411 Ga0496118_0154411_364_1002 206
319 3300048922 Ga0496119_0006768 Ga0496119_0006768_9322_9990 206
320 3300048923 Ga0496120_0010148 Ga0496120_0010148_5311_5979 206
321 3300048924 Ga0496121_0058967 Ga0496121_0058967_2254_2874 206
322 3300048924 Ga0496121_0140028 Ga0496121_0140028_335_979 206
323 3300048924 Ga0496121_0157463 Ga0496121_0157463_567_1235 206
324 3300048925 Ga0496122_0192764 Ga0496122_0192764_302_970 206
325 3300048927 Ga0496124_0094099 Ga0496124_0094099_846_1514 206
326 3300048928 Ga0496125_0060549 Ga0496125_0060549_322_966 206
327 3300048928 Ga0496125_0187292 Ga0496125_0187292_225_893 206
328 3300048929 Ga0496126_0214325 Ga0496126_0214325_817_1437 206
329 3300049460 Ga0495682_0043335 Ga0495682_0043335_740_1360 206
330 3300050492 nmdc:mga0yw44_23704_c1 nmdc:mga0yw44_23704_c1_1782_2402 206
331 3300050493 nmdc:mga0k408_206439_c1 nmdc:mga0k408_206439_c1_475_1155 206
332 3300050496 nmdc:mga07m45_58915_c1 nmdc:mga07m45_58915_c1_1050_1730 206
333 3300050516 nmdc:mga0sz30_107966_c1 nmdc:mga0sz30_107966_c1_67_687 206
334 3300050516 nmdc:mga0sz30_28757_c1 nmdc:mga0sz30_28757_c1_847_1527 206
335 3300050516 nmdc:mga0sz30_50358_c1 nmdc:mga0sz30_50358_c1_698_1342 206
336 3300053077 Ga0495601_0441654 Ga0495601_0441654_91_759 206
337 3300053085 Ga0495619_0282609 Ga0495619_0282609_330_998 206
338 3300053086 Ga0500578_0030986 Ga0500578_0030986_1052_1672 206
339 3300053087 Ga0500643_000057 Ga0500643_000057_130090_130710 206
340 3300053092 Ga0500583_0001553 Ga0500583_0001553_524_1144 206
341 3300053094 Ga0500566_0001729 Ga0500566_0001729_6387_7037 206
342 3300053094 Ga0500566_0152206 Ga0500566_0152206_376_996 206
343 3300053103 Ga0500555_005133 Ga0500555_005133_1375_1995 206
344 3300053109 Ga0500569_166327 Ga0500569_166327_110_730 206
345 3300053111 Ga0500572_012619 Ga0500572_012619_295_915 206
346 3300053119 Ga0500595_013390 Ga0500595_013390_740_1360 206
347 3300053122 Ga0500608_045010 Ga0500608_045010_405_1025 206
348 3300053122 Ga0500608_089985 Ga0500608_089985_34_654 206
349 3300053123 Ga0500614_061536 Ga0500614_061536_46_666 206
350 3300053126 Ga0500621_076701 Ga0500621_076701_305_925 206
351 3300053130 Ga0500642_0023889 Ga0500642_0023889_635_1255 206
352 3300053134 Ga0500658_0086486 Ga0500658_0086486_65_685 206
353 3300053136 Ga0500559_0019052 Ga0500559_0019052_685_1353 206
354 3300053139 Ga0500568_0021396 Ga0500568_0021396_340_960 206
355 3300053148 Ga0500590_112720 Ga0500590_112720_363_983 206
356 3300053154 Ga0500619_057717 Ga0500619_057717_211_831 206
357 3300053155 Ga0500620_066123 Ga0500620_066123_305_925 206
358 3300053162 Ga0500638_025857 Ga0500638_025857_618_1238 206
359 3300053162 Ga0500638_074021 Ga0500638_074021_779_1447 206
360 3300053177 Ga0500636_0004999 Ga0500636_0004999_4942_5562 206
361 3300053177 Ga0500636_0143716 Ga0500636_0143716_619_1239 206
362 iso_pu_bacteria 2513237094 2513637323 206
363 iso_pu_bacteria 2617270741 2617373289 206
364 iso_pu_bacteria 2932784394 2932785717 206
365 iso_pu_bacteria 2932794094 2932799055 206
366 iso_pu_bacteria 2932801729 2932808529 206
367 iso_pu_bacteria 2932828146 2932830781 206
368 iso_pu_bacteria 2935638405 2935639907 206
369 iso_pu_bacteria 2935665750 2935667239 206
370 iso_pu_bacteria 2935703347 2935704995 206
371 iso_pu_bacteria 2935801545 2935803603 206
372 iso_pu_bacteria 2935827899 2935829390 206
373 iso_pu_bacteria 2935837841 2935842632 206
374 iso_pu_bacteria 2935883170 2935884731 206
375 iso_pu_bacteria 2935992306 2935995291 206
376 iso_pu_bacteria 2936002035 2936004178 206
377 iso_pu_bacteria 2941531003 2941533552 206
378 iso_pu_bacteria 2941538514 2941544521 206
379 iso_pu_bacteria 3005483717 3005487504 206
380 iso_pu_bacteria 3005587118 3005592933 206
381 iso_pu_bacteria 8017057580 8017059931 206
382 iso_pu_bacteria 8019576017 8019579428 206
383 iso_pu_bacteria 8019586578 8019587137 206
384 iso_pu_bacteria 8019608314 8019614330 206
385 2010549000 RicEn_C3015 RicEn_55090 207
386 2010549000 RicEn_FSXC8364_b1 RicEn_225190 207
387 3300003215 JGI25153J46596_10009452 JGI25153J46596_100094527 207
388 3300003322 rootL2_10073210 rootL2_100732102 207
389 3300003794 Ga0055531_10010256 Ga0055531_100102565 207
390 3300005262 Ga0065165_1011199 Ga0065165_10111993 207
391 3300005331 Ga0070670_100507858 Ga0070670_1005078582 207
392 3300005339 Ga0070660_100102558 Ga0070660_1001025583 207
393 3300005347 Ga0070668_100030699 Ga0070668_1000306992 207
394 3300005355 Ga0070671_100016959 Ga0070671_1000169596 207
395 3300005364 Ga0070673_100517379 Ga0070673_1005173792 207
396 3300005367 Ga0070667_100323630 Ga0070667_1003236302 207
397 3300005455 Ga0070663_100106479 Ga0070663_1001064792 207
398 3300005456 Ga0070678_100638102 Ga0070678_1006381021 207
399 3300005563 Ga0068855_100547770 Ga0068855_1005477702 207
400 3300005577 Ga0068857_100601401 Ga0068857_1006014012 207
401 3300005614 Ga0068856_100089112 Ga0068856_1000891123 207
402 3300005616 Ga0068852_101052249 Ga0068852_1010522491 207
403 3300005842 Ga0068858_100204734 Ga0068858_1002047342 207
404 3300006038 Ga0075365_10232532 Ga0075365_102325322 207
405 3300006042 Ga0075368_10015524 Ga0075368_100155242 207
406 3300006048 Ga0075363_100006916 Ga0075363_1000069166 207
407 3300006051 Ga0075364_10019010 Ga0075364_100190106 207
408 3300006177 Ga0075362_10072825 Ga0075362_100728252 207
409 3300006178 Ga0075367_10018947 Ga0075367_100189473 207
410 3300006195 Ga0075366_10049739 Ga0075366_100497391 207
411 3300006942 Ga0099824_1027371 Ga0099824_10273712 207
412 3300009093 Ga0105240_10060844 Ga0105240_100608445 207
413 3300009101 Ga0105247_10012238 Ga0105247_100122386 207
414 3300009148 Ga0105243_10115908 Ga0105243_101159082 207
415 3300009174 Ga0105241_10078928 Ga0105241_100789281 207
416 3300009177 Ga0105248_10111921 Ga0105248_101119213 207
417 3300009545 Ga0105237_10047396 Ga0105237_100473966 207
418 3300009551 Ga0105238_10186125 Ga0105238_101861252 207
419 3300009553 Ga0105249_10155796 Ga0105249_101557963 207
420 3300010375 Ga0105239_10782977 Ga0105239_107829772 207
421 3300011119 Ga0105246_10016029 Ga0105246_100160292 207
422 3300013296 Ga0157374_10081002 Ga0157374_100810022 207
423 3300013297 Ga0157378_10393500 Ga0157378_103935002 207
424 3300013306 Ga0163162_10403251 Ga0163162_104032512 207
425 3300014325 Ga0163163_10502220 Ga0163163_105022202 207
426 3300025245 Ga0207425_1009648 Ga0207425_10096481 207
427 3300025297 Ga0209758_1000026 Ga0209758_1000026130 207
428 3300025299 Ga0209256_1011640 Ga0209256_10116404 207
429 3300025299 Ga0209256_1027256 Ga0209256_10272562 207
430 3300025304 Ga0209257_1005738 Ga0209257_10057387 207
431 3300025304 Ga0209257_1009389 Ga0209257_10093893 207
432 3300025315 Ga0207697_10017910 Ga0207697_100179102 207
433 3300025900 Ga0207710_10099959 Ga0207710_100999592 207
434 3300025901 Ga0207688_10032427 Ga0207688_100324273 207
435 3300025904 Ga0207647_10001122 Ga0207647_100011223 207
436 3300025911 Ga0207654_10057695 Ga0207654_100576951 207
437 3300025914 Ga0207671_10275206 Ga0207671_102752061 207
438 3300025923 Ga0207681_10056349 Ga0207681_100563495 207
439 3300025925 Ga0207650_10157843 Ga0207650_101578432 207
440 3300025931 Ga0207644_10121422 Ga0207644_101214222 207
441 3300025949 Ga0207667_10480015 Ga0207667_104800152 207
442 3300025981 Ga0207640_10570459 Ga0207640_105704591 207
443 3300026067 Ga0207678_10026500 Ga0207678_100265004 207
444 3300026088 Ga0207641_10070060 Ga0207641_100700605 207
445 3300026142 Ga0207698_10950709 Ga0207698_109507091 207
446 3300027296 Ga0209389_1000408 Ga0209389_10004081 207
447 3300027357 Ga0209589_1003940 Ga0209589_100394023 207
448 3300027361 Ga0209489_104278 Ga0209489_1042783 207
449 3300037418 Ga0395900_0271350 Ga0395900_0271350_264_911 207
450 3300038443 Ga0395901_0166424 Ga0395901_0166424_1112_1759 207
451 3300044658 Ga0466972_0002026 Ga0466972_0002026_4332_4955 207
452 3300044658 Ga0466972_0016778 Ga0466972_0016778_2347_2970 207
453 3300044706 Ga0466964_0419494 Ga0466964_0419494_41_664 207
454 3300044735 Ga0466968_0046951 Ga0466968_0046951_613_1236 207
455 3300044901 Ga0466960_0031869 Ga0466960_0031869_322_945 207
456 3300046507 Ga0495606_0125239 Ga0495606_0125239_536_1159 207
457 3300046519 Ga0495632_0112881 Ga0495632_0112881_310_933 207
458 3300046616 Ga0495668_0034541 Ga0495668_0034541_143_766 207
459 3300047443 Ga0495687_024634 Ga0495687_024634_2185_2808 207
460 3300048903 Ga0496100_0296133 Ga0496100_0296133_138_761 207
461 3300048905 Ga0496102_0027530 Ga0496102_0027530_2009_2632 207
462 3300048907 Ga0496104_0029503 Ga0496104_0029503_156_779 207
463 3300048908 Ga0496105_0056554 Ga0496105_0056554_1832_2455 207
464 3300048910 Ga0496107_0187249 Ga0496107_0187249_469_1092 207
465 3300048911 Ga0496108_0025878 Ga0496108_0025878_2171_2794 207
466 3300048913 Ga0496110_0023688 Ga0496110_0023688_565_1188 207
467 3300048915 Ga0496112_0043463 Ga0496112_0043463_414_1037 207
468 3300048916 Ga0496113_0203112 Ga0496113_0203112_528_1151 207
469 3300048922 Ga0496119_0032207 Ga0496119_0032207_457_1080 207
470 3300048926 Ga0496123_0170077 Ga0496123_0170077_68_691 207
471 3300048927 Ga0496124_0193650 Ga0496124_0193650_597_1220 207
472 3300048928 Ga0496125_0061781 Ga0496125_0061781_473_1096 207
473 3300050490 nmdc:mga03n38_18035_c1 nmdc:mga03n38_18035_c1_2072_2695 207
474 3300050491 nmdc:mga00v17_6086_c1 nmdc:mga00v17_6086_c1_1538_2161 207
475 3300050492 nmdc:mga0yw44_416239_c1 nmdc:mga0yw44_416239_c1_220_843 207
476 3300050496 nmdc:mga07m45_92163_c1 nmdc:mga07m45_92163_c1_380_1003 207

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zep-assembly1.cif.gz_x m. smegmatis hibernating state 70s ribosome structure 0.6961 61 111
5xfs-assembly1.cif.gz_C crystal structure of pe8-ppe15 in complex with espg5 from m. tuberculosis 0.6256 71 110
4kxr-assembly1.cif.gz_C structure of the mycobacterium tuberculosis type vii secretion system chaperone espg5 in complex with pe25-ppe41 dimer 0.5042 71 120
1qwd-assembly1.cif.gz_B crystal structure of a bacterial lipocalin, the blc gene product from e. coli 0.4734 35 204
2aco-assembly1.cif.gz_B xray structure of blc dimer in complex with vaccenic acid 0.467 35 204
ID Description Score Start End Superfamily
af_F6PBY5_48_260_3.40.570.10 Alpha Beta;3-Layer(aba) Sandwich;Extracellular Endonuclease; Chain A;Extracellular Endonuclease, subunit A 0.6028 72 120 3.40.570.10
1wznC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;S-adenosyl-L-methionine-dependent methyltransferases 0.5117 74 119 2.20.25.110
af_Q554M4_1_186_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.5109 61 119 3.90.950.10
af_E7FFF0_376_485_3.30.1120.160 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.5085 52 111 3.30.1120.160
af_A0A1D6MXK3_62_207_2.60.270.50 Mainly Beta;Sandwich;Mutm (Fpg) Protein; Chain: A, domain 2; 0.4888 71 144 2.60.270.50
ID Description Score Start End GO Terms
AF-A0A401TYS8-F1-model_v4 Uncharacterized protein 0.9184 76 207
AF-A0A1B1UAX5-F1-model_v4 Uncharacterized protein 0.9005 49 120
AF-A0A401TYS8-F1-model_v4 Uncharacterized protein 0.8989 76 207
AF-A0A176YZU2-F1-model_v4 Lysozyme inhibitor LprI N-terminal domain-containing protein 0.8603 1 207
AF-A0A7Y4HA76-F1-model_v4 Uncharacterized protein 0.8551 17 187

Feature Viewer

pLDDT pTM Quality
78.59 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map