F451479

General Info

Members Datasets Scaffolds Average Seq Length
476 256 952 241

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100601108|Ga0070683_1006011081
Length 249
Sequence VDTDALLAWYDRVRRPLPWRETRDPYALLVSEVMLQQTQALRVVPYYERWLARFPDAPVLAQAPARAVLEAWSGLGYNRRALALQSAARVVADSGWPDDLTELPGVGPYTAAAVASFAWDRQEAAVDTNVRRVLERREGRFVRERVDQLLPPGRAAAFNQAMMELGATVCRPRKPRCGECPVAAGCGGFAAAPRRSGAPPFEQTDRFLRGRVVAALVAGEPVPDANERILAGLERDGLIVRADGHVRLP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 12.61
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100601108 3300005329 Bacteria 1053
2 JGI25406J46586_10054202 3300003203 Bacteria 1327
3 Ga0070683_100004736 3300005329 Bacteria 11254
4 Ga0070683_100037600 3300005329 Bacteria 4431
5 Ga0070670_100033792 3300005331 Bacteria 4404
6 Ga0070670_100092643 3300005331 Bacteria 2598
7 Ga0070680_100021495 3300005336 Bacteria 5129
8 Ga0070682_100049009 3300005337 Bacteria 2632
9 Ga0068868_100219322 3300005338 Bacteria 1592
10 Ga0070660_100076218 3300005339 Bacteria 2626
11 Ga0070689_100058347 3300005340 Bacteria 2998
12 Ga0070691_10031861 3300005341 Bacteria 2474
13 Ga0070661_100066523 3300005344 Bacteria 2648
14 Ga0070668_100453597 3300005347 Bacteria 1103
15 Ga0070675_100266215 3300005354 Bacteria 1503
16 Ga0070674_100089517 3300005356 Bacteria 2217
17 Ga0070674_100110620 3300005356 Bacteria 2016
18 Ga0070673_100492365 3300005364 Bacteria 1108
19 Ga0070688_100056391 3300005365 Bacteria 2467
20 Ga0070688_100069539 3300005365 Bacteria 2248
21 Ga0070659_100251151 3300005366 Bacteria 1466
22 Ga0070709_10028561 3300005434 Bacteria 3328
23 Ga0070709_10138336 3300005434 Bacteria 1670
24 Ga0070700_100017066 3300005441 Bacteria 4145
25 Ga0070700_100116265 3300005441 Bacteria 1786
26 Ga0070700_100361255 3300005441 Bacteria 1080
27 Ga0070694_100411660 3300005444 Bacteria 1061
28 Ga0070708_100077200 3300005445 Bacteria 3009
29 Ga0070663_100246664 3300005455 Bacteria 1412
30 Ga0070678_100005939 3300005456 Bacteria 7104
31 Ga0070678_100238244 3300005456 Bacteria 1520
32 Ga0070662_100436408 3300005457 Bacteria 1085
33 Ga0070681_10038394 3300005458 Bacteria 4801
34 Ga0068867_100179356 3300005459 Bacteria 1683
35 Ga0070685_10264223 3300005466 Bacteria 1146
36 Ga0070706_100016108 3300005467 Bacteria 6903
37 Ga0070707_100001166 3300005468 Bacteria 25844
38 Ga0070707_100494663 3300005468 Bacteria 1184
39 Ga0070698_100084775 3300005471 Bacteria 3156
40 Ga0070699_100170433 3300005518 Bacteria 1929
41 Ga0070679_100004051 3300005530 Bacteria 13496
42 Ga0070684_100000243 3300005535 Bacteria 37686
43 Ga0070684_100063656 3300005535 Bacteria 3234
44 Ga0070684_100080511 3300005535 Bacteria 2881
45 Ga0070684_100452968 3300005535 Bacteria 1186
46 Ga0070672_100008026 3300005543 Bacteria 7210
47 Ga0070672_100061722 3300005543 Bacteria 2956
48 Ga0070686_100015400 3300005544 Bacteria 4429
49 Ga0070686_100037319 3300005544 Bacteria 3013
50 Ga0070696_100253584 3300005546 Bacteria 1331
51 Ga0070693_100166928 3300005547 Bacteria 1407
52 Ga0070665_100097044 3300005548 Bacteria 2952
53 Ga0070704_100133386 3300005549 Bacteria 1928
54 Ga0068855_100643166 3300005563 Bacteria 1140
55 Ga0070664_100793859 3300005564 Bacteria 885
56 Ga0068857_100016885 3300005577 Bacteria 6396
57 Ga0068857_100323410 3300005577 Bacteria 1425
58 Ga0068856_100011791 3300005614 Bacteria 8473
59 Ga0068856_100057685 3300005614 Bacteria 3833
60 Ga0068852_100199978 3300005616 Bacteria 1891
61 Ga0068859_100447077 3300005617 Bacteria 1389
62 Ga0068864_100055503 3300005618 Bacteria 3421
63 Ga0068866_10023186 3300005718 Bacteria 2883
64 Ga0068870_10050115 3300005840 Bacteria 2205
65 Ga0068870_10091044 3300005840 Bacteria 1705
66 Ga0068863_100614277 3300005841 Bacteria 1077
67 Ga0068860_100032918 3300005843 Bacteria 4978
68 Ga0068862_100382855 3300005844 Bacteria 1312
69 Ga0081455_10222774 3300005937 Bacteria 1397
70 Ga0081455_10227918 3300005937 Bacteria 1377
71 Ga0081538_10005954 3300005981 Bacteria 10851
72 Ga0081539_10001152 3300005985 Bacteria 47898
73 Ga0081539_10004006 3300005985 Bacteria 16952
74 Ga0075365_10038308 3300006038 Bacteria 3115
75 Ga0070712_100202982 3300006175 Bacteria 1558
76 Ga0097621_100045283 3300006237 Bacteria 3553
77 Ga0097621_100345025 3300006237 Bacteria 1323
78 Ga0068871_100228423 3300006358 Bacteria 1615
79 Ga0075428_100055707 3300006844 Bacteria 4332
80 Ga0075433_10007633 3300006852 Bacteria 8589
81 Ga0075433_10099384 3300006852 Bacteria 2576
82 Ga0075434_100025839 3300006871 Bacteria 5748
83 Ga0075434_100029380 3300006871 Bacteria 5408
84 Ga0075434_100178763 3300006871 Bacteria 2141
85 Ga0068865_100147445 3300006881 Bacteria 1781
86 Ga0068865_100148638 3300006881 Bacteria 1775
87 Ga0075436_100074287 3300006914 Bacteria 2354
88 Ga0097620_100447057 3300006931 Bacteria 1389
89 Ga0075435_100000520 3300007076 Bacteria 23565
90 Ga0111539_10018541 3300009094 Bacteria 8620
91 Ga0111539_10116509 3300009094 Bacteria 3133
92 Ga0111539_10738265 3300009094 Bacteria 1146
93 Ga0111539_10812031 3300009094 Bacteria 1088
94 Ga0105245_10009810 3300009098 Bacteria 8343
95 Ga0105245_10072713 3300009098 Bacteria 3124
96 Ga0105245_10177943 3300009098 Bacteria 2030
97 Ga0105245_10212545 3300009098 Bacteria 1862
98 Ga0105245_11419660 3300009098 Bacteria 744
99 Ga0105247_10150407 3300009101 Bacteria 1533
100 Ga0114129_10000888 3300009147 Bacteria 38986
101 Ga0114129_10105777 3300009147 Bacteria 3888
102 Ga0114129_10427534 3300009147 Bacteria 1741
103 Ga0114129_10726984 3300009147 Bacteria 1273
104 Ga0105243_10007164 3300009148 Bacteria 8574
105 Ga0105243_10033760 3300009148 Bacteria 3957
106 Ga0105243_10441692 3300009148 Bacteria 1218
107 Ga0105243_10742775 3300009148 Bacteria 961
108 Ga0105241_10084371 3300009174 Bacteria 2494
109 Ga0105242_10515637 3300009176 Bacteria 1140
110 Ga0105242_10859723 3300009176 Bacteria 903
111 Ga0105248_10319129 3300009177 Bacteria 1750
112 Ga0105249_10055793 3300009553 Bacteria 3616
113 Ga0105239_10288890 3300010375 Bacteria 1847
114 Ga0105246_10029552 3300011119 Bacteria 3611
115 Ga0105246_10321582 3300011119 Bacteria 1257
116 Ga0157369_10162293 3300013105 Bacteria 2358
117 Ga0157374_10175141 3300013296 Bacteria 2094
118 Ga0157374_10223281 3300013296 Bacteria 1849
119 Ga0157378_10132394 3300013297 Bacteria 2309
120 Ga0157378_10194604 3300013297 Bacteria 1915
121 Ga0163162_10004234 3300013306 Bacteria 13795
122 Ga0157372_10615512 3300013307 Bacteria 1266
123 Ga0157372_10707728 3300013307 Bacteria 1172
124 Ga0157375_10097760 3300013308 Bacteria 3011
125 Ga0157375_10125099 3300013308 Bacteria 2685
126 Ga0157375_10271882 3300013308 Bacteria 1857
127 Ga0163163_10095181 3300014325 Bacteria 2998
128 Ga0163163_10142705 3300014325 Bacteria 2437
129 Ga0163163_10799598 3300014325 Bacteria 1006
130 Ga0157380_10582384 3300014326 Bacteria 1104
131 Ga0157380_10664749 3300014326 Bacteria 1041
132 Ga0157377_10027865 3300014745 Bacteria 3037
133 Ga0157377_10072171 3300014745 Bacteria 1998
134 Ga0157377_10387231 3300014745 Bacteria 948
135 Ga0157379_10108335 3300014968 Bacteria 2494
136 Ga0157376_10150726 3300014969 Bacteria 2097
137 Ga0207688_10006131 3300025901 Bacteria 6543
138 Ga0207699_10043773 3300025906 Bacteria 2603
139 Ga0207643_10043746 3300025908 Bacteria 2528
140 Ga0207643_10112513 3300025908 Bacteria 1605
141 Ga0207684_10271948 3300025910 Bacteria 1462
142 Ga0207684_10288805 3300025910 Bacteria 1414
143 Ga0207707_10006530 3300025912 Bacteria 10179
144 Ga0207693_10002032 3300025915 Bacteria 17750
145 Ga0207693_10006785 3300025915 Bacteria 9453
146 Ga0207693_10129430 3300025915 Bacteria 1984
147 Ga0207660_10024169 3300025917 Bacteria 4110
148 Ga0207657_10262826 3300025919 Bacteria 1373
149 Ga0207649_10149923 3300025920 Bacteria 1605
150 Ga0207649_10167785 3300025920 Bacteria 1526
151 Ga0207649_10338077 3300025920 Bacteria 1111
152 Ga0207652_10000845 3300025921 Bacteria 29187
153 Ga0207646_10002516 3300025922 Bacteria 21651
154 Ga0207650_10024799 3300025925 Bacteria 4268
155 Ga0207659_10025594 3300025926 Bacteria 3967
156 Ga0207687_10005539 3300025927 Bacteria 8348
157 Ga0207687_10368006 3300025927 Bacteria 1175
158 Ga0207687_10484844 3300025927 Bacteria 1030
159 Ga0207644_10047471 3300025931 Bacteria 3065
160 Ga0207644_10431424 3300025931 Bacteria 1081
161 Ga0207690_10046081 3300025932 Bacteria 2885
162 Ga0207690_10086147 3300025932 Bacteria 2207
163 Ga0207706_10148882 3300025933 Bacteria 2059
164 Ga0207686_10034115 3300025934 Bacteria 3043
165 Ga0207709_10098767 3300025935 Bacteria 1926
166 Ga0207709_10659126 3300025935 Bacteria 834
167 Ga0207670_10049163 3300025936 Bacteria 2819
168 Ga0207669_10233350 3300025937 Bacteria 1359
169 Ga0207704_10275504 3300025938 Bacteria 1276
170 Ga0207665_10530096 3300025939 Bacteria 913
171 Ga0207691_10027172 3300025940 Bacteria 5368
172 Ga0207691_10038872 3300025940 Bacteria 4403
173 Ga0207691_10097119 3300025940 Bacteria 2633
174 Ga0207691_10278324 3300025940 Bacteria 1440
175 Ga0207711_10816317 3300025941 Bacteria 868
176 Ga0207661_10017673 3300025944 Bacteria 5284
177 Ga0207661_10153551 3300025944 Bacteria 1992
178 Ga0207661_10186720 3300025944 Bacteria 1815
179 Ga0207679_10023271 3300025945 Bacteria 4233
180 Ga0207679_10091826 3300025945 Bacteria 2350
181 Ga0207651_10292137 3300025960 Bacteria 1352
182 Ga0207668_10190507 3300025972 Bacteria 1625
183 Ga0207658_10004184 3300025986 Bacteria 10055
184 Ga0207677_10291522 3300026023 Bacteria 1344
185 Ga0207639_10015521 3300026041 Bacteria 5376
186 Ga0207678_10156273 3300026067 Bacteria 1947
187 Ga0207708_10005344 3300026075 Bacteria 9463
188 Ga0207708_10015432 3300026075 Bacteria 5730
189 Ga0207708_10172571 3300026075 Bacteria 1713
190 Ga0207702_10004111 3300026078 Bacteria 13059
191 Ga0207702_10039417 3300026078 Bacteria 3958
192 Ga0207702_10386575 3300026078 Bacteria 1347
193 Ga0207648_10001647 3300026089 Bacteria 24475
194 Ga0207648_10012226 3300026089 Bacteria 8039
195 Ga0207676_10403339 3300026095 Bacteria 1278
196 Ga0207674_10011005 3300026116 Bacteria 10174
197 Ga0207674_10151120 3300026116 Bacteria 2279
198 Ga0207675_100106356 3300026118 Bacteria 2645
199 Ga0207675_100547667 3300026118 Bacteria 1156
200 Ga0207683_10000696 3300026121 Bacteria 30832
201 Ga0207683_10021748 3300026121 Bacteria 5498
202 Ga0207683_10113171 3300026121 Bacteria 2431
203 Ga0207683_10209712 3300026121 Bacteria 1773
204 Ga0207683_10215119 3300026121 Bacteria 1750
205 Ga0268266_10119728 3300028379 Bacteria 2342
206 Ga0268265_10542311 3300028380 Bacteria 1103
207 Ga0268264_10051864 3300028381 Bacteria 3420
208 Ga0265338_10012196 3300028800 Bacteria 9817
209 Ga0307408_100145042 3300031548 Bacteria 1868
210 Ga0307410_10203889 3300031852 Bacteria 1512
211 Ga0307410_10392225 3300031852 Bacteria 1120
212 Ga0307406_10086210 3300031901 Bacteria 2102
213 Ga0307406_10095234 3300031901 Bacteria 2014
214 Ga0307407_10334151 3300031903 Bacteria 1068
215 Ga0307409_100054334 3300031995 Bacteria 3084
216 Ga0307409_100104449 3300031995 Bacteria 2360
217 Ga0307409_100117921 3300031995 Bacteria 2241
218 Ga0307409_100143764 3300031995 Bacteria 2059
219 Ga0307416_100044173 3300032002 Bacteria 3496
220 Ga0307416_100079567 3300032002 Bacteria 2763
221 Ga0307416_100470831 3300032002 Bacteria 1314
222 Ga0307416_101051438 3300032002 Bacteria 918
223 Ga0307414_10145294 3300032004 Bacteria 1863
224 Ga0307415_100077960 3300032126 Bacteria 2355
225 Ga0373945_0127129 3300035116 Bacteria 1018
226 Ga0373956_0133502 3300035119 Bacteria 1163
227 Ga0373957_0027488 3300035120 Bacteria 2067
228 Ga0373931_0160736 3300035691 Bacteria 1317
229 Ga0373935_0127205 3300035692 Bacteria 1708
230 Ga0373947_0004388 3300035725 Bacteria 8271
231 Ga0373937_0043551 3300036401 Bacteria 4098
232 Ga0395899_0006614 3300037312 Bacteria 8983
233 Ga0395899_0033676 3300037312 Bacteria 3847
234 Ga0395899_0239472 3300037312 Bacteria 1249
235 Ga0395900_0004583 3300037418 Bacteria 14585
236 Ga0395900_0015159 3300037418 Bacteria 7859
237 Ga0395900_0018079 3300037418 Bacteria 7195
238 Ga0395900_0027473 3300037418 Bacteria 5829
239 Ga0395900_0031215 3300037418 Bacteria 5472
240 Ga0395900_0337097 3300037418 Bacteria 1484
241 Ga0395898_0007165 3300037466 Bacteria 11841
242 Ga0395898_0009447 3300037466 Bacteria 10245
243 Ga0395898_0020670 3300037466 Bacteria 6683
244 Ga0395898_0052751 3300037466 Bacteria 3972
245 Ga0395898_0062246 3300037466 Bacteria 3624
246 Ga0395898_0179791 3300037466 Bacteria 2022
247 Ga0395905_0008996 3300037471 Bacteria 9800
248 Ga0395905_0014434 3300037471 Bacteria 7542
249 Ga0395905_0071459 3300037471 Bacteria 3253
250 Ga0395905_0087751 3300037471 Bacteria 2916
251 Ga0395905_0135000 3300037471 Bacteria 2321
252 Ga0395905_0144954 3300037471 Bacteria 2234
253 Ga0395905_0530734 3300037471 Bacteria 1077
254 Ga0395901_0004101 3300038443 Bacteria 14687
255 Ga0395901_0024671 3300038443 Bacteria 6174
256 Ga0395901_0030627 3300038443 Bacteria 5544
257 Ga0395901_0046503 3300038443 Bacteria 4508
258 Ga0395901_0059231 3300038443 Bacteria 3983
259 Ga0395901_0149057 3300038443 Bacteria 2458
260 Ga0395901_0642303 3300038443 Bacteria 1065
261 Ga0395901_0702914 3300038443 Bacteria 1008
262 Ga0436365_1097847 3300039437 Bacteria 1275
263 Ga0436362_0305949 3300039453 Bacteria 1384
264 Ga0439438_007821 3300041405 Bacteria 3610
265 Ga0439461_0004893 3300041410 Bacteria 2259
266 Ga0439465_0051543 3300041413 Bacteria 1349
267 Ga0450907_019334 3300042146 Bacteria 1142
268 Ga0439434_0022405 3300042435 Bacteria 1899
269 Ga0439434_0092422 3300042435 Bacteria 969
270 Ga0466969_0084879 3300044656 Bacteria 1506
271 Ga0466963_0001836 3300044694 Bacteria 11574
272 Ga0466963_0007745 3300044694 Bacteria 6419
273 Ga0466963_0072239 3300044694 Bacteria 2324
274 Ga0466963_0366308 3300044694 Bacteria 1015
275 Ga0466964_0170253 3300044706 Bacteria 1025
276 Ga0466968_0006983 3300044735 Bacteria 4278
277 Ga0466968_0068084 3300044735 Bacteria 1545
278 Ga0466959_0348562 3300045049 Bacteria 1010
279 Ga0451576_0118386 3300045051 Bacteria 2757
280 Ga0466958_0040680 3300045836 Bacteria 2794
281 Ga0466967_0010167 3300045976 Bacteria 7038
282 Ga0466967_0011121 3300045976 Bacteria 6799
283 Ga0466967_0016740 3300045976 Bacteria 5793
284 Ga0466967_0049422 3300045976 Bacteria 3678
285 Ga0466967_0055522 3300045976 Bacteria 3488
286 Ga0466967_0250199 3300045976 Bacteria 1693
287 Ga0466967_0646014 3300045976 Bacteria 1046
288 Ga0495603_0232180 3300046455 Bacteria 1063
289 Ga0495629_0001096 3300046459 Bacteria 21461
290 Ga0495629_0107398 3300046459 Bacteria 1947
291 Ga0495651_0208806 3300046462 Bacteria 1360
292 Ga0495653_0078133 3300046463 Bacteria 2455
293 Ga0495580_0259242 3300046472 Bacteria 1189
294 Ga0495582_0000863 3300046473 Bacteria 16815
295 Ga0495582_0039846 3300046473 Bacteria 2586
296 Ga0495639_0029388 3300046475 Bacteria 2439
297 Ga0495662_0001570 3300046476 Bacteria 11368
298 Ga0495594_0055528 3300046499 Bacteria 2184
299 Ga0495596_0100662 3300046500 Bacteria 1122
300 Ga0495608_0009709 3300046511 Bacteria 6716
301 Ga0495608_0037697 3300046511 Bacteria 3250
302 Ga0495628_0166658 3300046516 Bacteria 1672
303 Ga0495628_0209850 3300046516 Bacteria 1465
304 Ga0495630_0051809 3300046517 Bacteria 3072
305 Ga0495630_0205688 3300046517 Bacteria 1502
306 Ga0495666_0019547 3300046526 Bacteria 3360
307 Ga0495642_0013359 3300046528 Bacteria 3175
308 Ga0495642_0055833 3300046528 Unclassified 1631
309 Ga0495652_0098691 3300046529 Bacteria 2373
310 Ga0495652_0126915 3300046529 Bacteria 2025
311 Ga0495665_0002733 3300046531 Bacteria 9524
312 Ga0495640_0065405 3300046533 Bacteria 2455
313 Ga0495587_0029101 3300046536 Bacteria 3355
314 Ga0495587_0134934 3300046536 Bacteria 1410
315 Ga0495598_0072853 3300046537 Bacteria 1086
316 Ga0495645_0029542 3300046543 Bacteria 3987
317 Ga0495645_0198691 3300046543 Bacteria 1362
318 Ga0495667_0010992 3300046559 Bacteria 6118
319 Ga0495667_0014944 3300046559 Bacteria 5245
320 Ga0495667_0028299 3300046559 Bacteria 3773
321 Ga0495667_0072203 3300046559 Bacteria 2250
322 Ga0495656_0044995 3300046615 Bacteria 1861
323 Ga0495634_0011016 3300046642 Bacteria 6599
324 Ga0495634_0037435 3300046642 Bacteria 3314
325 Ga0495635_0032333 3300046663 Bacteria 3630
326 Ga0495657_0037848 3300046675 Bacteria 3322
327 Ga0495599_0033866 3300046678 Bacteria 3211
328 Ga0495623_0013259 3300046679 Bacteria 5345
329 Ga0495623_0147003 3300046679 Unclassified 1397
330 Ga0495647_0001449 3300046681 Bacteria 7349
331 Ga0495658_0004763 3300046683 Bacteria 6658
332 Ga0495658_0023356 3300046683 Bacteria 3282
333 Ga0495613_0007408 3300046689 Bacteria 8178
334 Ga0495624_0015947 3300046690 Bacteria 5058
335 Ga0495624_0154124 3300046690 Bacteria 1405
336 Ga0495671_0177139 3300046692 Bacteria 1036
337 Ga0495671_0205116 3300046692 Unclassified 956
338 Ga0495589_0026568 3300046794 Bacteria 2932
339 Ga0495589_0094760 3300046794 Bacteria 1448
340 Ga0495600_0009122 3300046809 Bacteria 6117
341 Ga0495600_0016494 3300046809 Bacteria 4688
342 Ga0495581_0002992 3300047315 Bacteria 9684
343 Ga0495581_0042618 3300047315 Bacteria 2626
344 Ga0495604_0007432 3300047317 Bacteria 8681
345 Ga0495604_0183384 3300047317 Bacteria 1463
346 Ga0495674_0014827 3300047319 Bacteria 7292
347 Ga0495674_0083256 3300047319 Bacteria 2743
348 Ga0495674_0157996 3300047319 Bacteria 1898
349 Ga0495676_0003328 3300047321 Bacteria 14536
350 Ga0495676_0044215 3300047321 Bacteria 3637
351 Ga0495680_0020121 3300047322 Bacteria 5623
352 Ga0495680_0025349 3300047322 Bacteria 4909
353 Ga0495680_0026147 3300047322 Bacteria 4817
354 Ga0495675_0028610 3300047444 Bacteria 3553
355 Ga0495675_0133135 3300047444 Bacteria 1545
356 Ga0495677_0022843 3300047445 Unclassified 2270
357 Ga0495684_0000898 3300047471 Bacteria 24090
358 Ga0495684_0063104 3300047471 Bacteria 2817
359 Ga0495684_0229223 3300047471 Bacteria 1359
360 Ga0495602_0102220 3300048088 Bacteria 2349
361 Ga0495602_0230973 3300048088 Bacteria 1390
362 Ga0495614_0025599 3300048089 Bacteria 2544
363 Ga0496100_0003614 3300048903 Bacteria 8074
364 Ga0496100_0017376 3300048903 Bacteria 4245
365 Ga0496100_0516145 3300048903 Unclassified 922
366 Ga0496101_0028009 3300048904 Bacteria 3931
367 Ga0496101_0030878 3300048904 Bacteria 3762
368 Ga0496101_0080407 3300048904 Bacteria 2408
369 Ga0496102_0011412 3300048905 Bacteria 7658
370 Ga0496102_0112294 3300048905 Bacteria 2541
371 Ga0496102_0127441 3300048905 Unclassified 2380
372 Ga0496103_0002423 3300048906 Bacteria 11733
373 Ga0496103_0073354 3300048906 Unclassified 2144
374 Ga0496104_0000283 3300048907 Bacteria 44806
375 Ga0496104_0003705 3300048907 Bacteria 13190
376 Ga0496104_0449083 3300048907 Bacteria 1201
377 Ga0496104_0494105 3300048907 Unclassified 1135
378 Ga0496105_0000464 3300048908 Bacteria 26670
379 Ga0496105_0051963 3300048908 Bacteria 3384
380 Ga0496105_0113912 3300048908 Bacteria 2231
381 Ga0496105_0251751 3300048908 Bacteria 1431
382 Ga0496106_0758109 3300048909 Unclassified 771
383 Ga0496107_0205150 3300048910 Bacteria 1465
384 Ga0496107_0390378 3300048910 Bacteria 1035
385 Ga0496108_0004985 3300048911 Bacteria 10731
386 Ga0496108_0072670 3300048911 Bacteria 2904
387 Ga0496108_0137595 3300048911 Bacteria 2103
388 Ga0496108_0193055 3300048911 Bacteria 1765
389 Ga0496108_0296112 3300048911 Bacteria 1409
390 Ga0496109_0000801 3300048912 Bacteria 26213
391 Ga0496109_0003735 3300048912 Bacteria 12724
392 Ga0496109_0012416 3300048912 Bacteria 7354
393 Ga0496109_0061203 3300048912 Bacteria 3441
394 Ga0496109_0353676 3300048912 Bacteria 1388
395 Ga0496109_0406242 3300048912 Bacteria 1287
396 Ga0496109_0451968 3300048912 Bacteria 1213
397 Ga0496109_0566161 3300048912 Bacteria 1071
398 Ga0496110_0000198 3300048913 Bacteria 38202
399 Ga0496110_0044777 3300048913 Bacteria 3865
400 Ga0496110_0078918 3300048913 Bacteria 2931
401 Ga0496110_0151120 3300048913 Bacteria 2103
402 Ga0496110_0239563 3300048913 Bacteria 1651
403 Ga0496111_0000948 3300048914 Bacteria 15862
404 Ga0496111_0001958 3300048914 Bacteria 12225
405 Ga0496111_0003476 3300048914 Bacteria 9749
406 Ga0496111_0049673 3300048914 Bacteria 3025
407 Ga0496111_0205569 3300048914 Bacteria 1463
408 Ga0496112_0029841 3300048915 Bacteria 5275
409 Ga0496112_0103090 3300048915 Bacteria 2823
410 Ga0496112_0257576 3300048915 Bacteria 1695
411 Ga0496113_0006862 3300048916 Bacteria 7263
412 Ga0496113_0030867 3300048916 Bacteria 3884
413 Ga0496113_0173948 3300048916 Unclassified 1706
414 Ga0496113_0277044 3300048916 Bacteria 1341
415 Ga0496114_0001179 3300048917 Bacteria 19806
416 Ga0496114_0008595 3300048917 Bacteria 8093
417 Ga0496114_0082476 3300048917 Bacteria 2718
418 Ga0496114_0133829 3300048917 Bacteria 2143
419 Ga0496114_0166508 3300048917 Unclassified 1919
420 Ga0496115_0016444 3300048918 Bacteria 5634
421 Ga0496115_0040738 3300048918 Bacteria 3694
422 Ga0496115_0045821 3300048918 Bacteria 3492
423 Ga0501031_0073836 3300049568 Bacteria 2221
424 Ga0501036_0272033 3300049572 Bacteria 1418
425 Ga0501039_0023114 3300049575 Bacteria 4769
426 Ga0501040_0107466 3300049576 Bacteria 1950
427 Ga0501042_0050409 3300049578 Bacteria 2969
428 Ga0501048_0075072 3300049582 Bacteria 2385
429 Ga0501068_0024063 3300049584 Bacteria 3574
430 Ga0501069_0086514 3300049585 Bacteria 1769
431 Ga0501071_0291787 3300049587 Bacteria 1235
432 Ga0501072_0005417 3300049588 Bacteria 9713
433 Ga0501072_0155359 3300049588 Bacteria 1824
434 Ga0501075_0032958 3300049591 Bacteria 3853
435 Ga0501076_0033960 3300049592 Bacteria 3984
436 Ga0501076_0202399 3300049592 Bacteria 1621
437 Ga0501077_0142065 3300049593 Bacteria 1523
438 Ga0501077_0261751 3300049593 Bacteria 1100
439 Ga0501080_0668176 3300049742 Bacteria 918
440 Ga0501081_0083340 3300049743 Bacteria 2241
441 Ga0501081_0186380 3300049743 Bacteria 1502
442 Ga0501035_0132715 3300049822 Bacteria 2170
443 Ga0501035_0503292 3300049822 Bacteria 997
444 Ga0501045_0003206 3300049824 Bacteria 11185
445 nmdc:mga00v17_412309_c1 3300050491 Bacteria 877
446 nmdc:mga0yw44_78404_c1 3300050492 Bacteria 2066
447 nmdc:mga05p37_165312_c1 3300050507 Bacteria 2701
448 nmdc:mga05p37_169956_c1 3300050507 Bacteria 2659
449 nmdc:mga05p37_242282_c1 3300050507 Bacteria 2167
450 nmdc:mga05p37_274447_c1 3300050507 Bacteria 2013
451 nmdc:mga05p37_41889_c2 3300050507 Bacteria 5226
452 nmdc:mga05p37_53692_c1 3300050507 Bacteria 4956
453 nmdc:mga05p37_60851_c1 3300050507 Bacteria 4649
454 nmdc:mga09592_269132_c1 3300050508 Bacteria 1478
455 nmdc:mga09592_301100_c1 3300050508 Bacteria 1390
456 nmdc:mga08y16_15110_c1 3300050511 Bacteria 8115
457 nmdc:mga08y16_625342_c1 3300050511 Bacteria 1083
458 nmdc:mga0n895_149988_c1 3300050512 Bacteria 2361
459 nmdc:mga0n895_24325_c1 3300050512 Bacteria 5707
460 nmdc:mga0n895_78939_c1 3300050512 Bacteria 3277
461 nmdc:mga0rr50_3021_c1 3300050513 Bacteria 9619
462 nmdc:mga08x19_185282_c1 3300050514 Bacteria 1422
463 nmdc:mga0a205_199165_c1 3300050515 Bacteria 1893
464 nmdc:mga0a205_63232_c1 3300050515 Bacteria 3576
465 Ga0495595_0013168 3300053084 Bacteria 3490
466 Ga0495595_0030998 3300053084 Bacteria 2401
467 Ga0495619_0017850 3300053085 Bacteria 4497
468 Ga0495619_0025556 3300053085 Bacteria 3793
469 Ga0495619_0054018 3300053085 Bacteria 2658
470 Ga0495619_0373425 3300053085 Bacteria 985
471 Ga0501084_0044756 3300054114 Bacteria 3706
472 Ga0501084_0128236 3300054114 Bacteria 2135
473 Ga0530510_0040237 3300061734 Bacteria 3374
474 Ga0530510_0051422 3300061734 Bacteria 2977
475 Ga0530510_0186418 3300061734 Bacteria 1539
476 Ga0530510_0555043 3300061734 Bacteria 872
477 Ga0070683_100601108
478 JGI25406J46586_10054202
479 Ga0070683_100004736
480 Ga0070683_100037600
481 Ga0070670_100033792
482 Ga0070670_100092643
483 Ga0070680_100021495
484 Ga0070682_100049009
485 Ga0068868_100219322
486 Ga0070660_100076218
487 Ga0070689_100058347
488 Ga0070691_10031861
489 Ga0070661_100066523
490 Ga0070668_100453597
491 Ga0070675_100266215
492 Ga0070674_100089517
493 Ga0070674_100110620
494 Ga0070673_100492365
495 Ga0070688_100056391
496 Ga0070688_100069539
497 Ga0070659_100251151
498 Ga0070709_10028561
499 Ga0070709_10138336
500 Ga0070700_100017066
501 Ga0070700_100116265
502 Ga0070700_100361255
503 Ga0070694_100411660
504 Ga0070708_100077200
505 Ga0070663_100246664
506 Ga0070678_100005939
507 Ga0070678_100238244
508 Ga0070662_100436408
509 Ga0070681_10038394
510 Ga0068867_100179356
511 Ga0070685_10264223
512 Ga0070706_100016108
513 Ga0070707_100001166
514 Ga0070707_100494663
515 Ga0070698_100084775
516 Ga0070699_100170433
517 Ga0070679_100004051
518 Ga0070684_100000243
519 Ga0070684_100063656
520 Ga0070684_100080511
521 Ga0070684_100452968
522 Ga0070672_100008026
523 Ga0070672_100061722
524 Ga0070686_100015400
525 Ga0070686_100037319
526 Ga0070696_100253584
527 Ga0070693_100166928
528 Ga0070665_100097044
529 Ga0070704_100133386
530 Ga0068855_100643166
531 Ga0070664_100793859
532 Ga0068857_100016885
533 Ga0068857_100323410
534 Ga0068856_100011791
535 Ga0068856_100057685
536 Ga0068852_100199978
537 Ga0068859_100447077
538 Ga0068864_100055503
539 Ga0068866_10023186
540 Ga0068870_10050115
541 Ga0068870_10091044
542 Ga0068863_100614277
543 Ga0068860_100032918
544 Ga0068862_100382855
545 Ga0081455_10222774
546 Ga0081455_10227918
547 Ga0081538_10005954
548 Ga0081539_10001152
549 Ga0081539_10004006
550 Ga0075365_10038308
551 Ga0070712_100202982
552 Ga0097621_100045283
553 Ga0097621_100345025
554 Ga0068871_100228423
555 Ga0075428_100055707
556 Ga0075433_10007633
557 Ga0075433_10099384
558 Ga0075434_100025839
559 Ga0075434_100029380
560 Ga0075434_100178763
561 Ga0068865_100147445
562 Ga0068865_100148638
563 Ga0075436_100074287
564 Ga0097620_100447057
565 Ga0075435_100000520
566 Ga0111539_10018541
567 Ga0111539_10116509
568 Ga0111539_10738265
569 Ga0111539_10812031
570 Ga0105245_10009810
571 Ga0105245_10072713
572 Ga0105245_10177943
573 Ga0105245_10212545
574 Ga0105245_11419660
575 Ga0105247_10150407
576 Ga0114129_10000888
577 Ga0114129_10105777
578 Ga0114129_10427534
579 Ga0114129_10726984
580 Ga0105243_10007164
581 Ga0105243_10033760
582 Ga0105243_10441692
583 Ga0105243_10742775
584 Ga0105241_10084371
585 Ga0105242_10515637
586 Ga0105242_10859723
587 Ga0105248_10319129
588 Ga0105249_10055793
589 Ga0105239_10288890
590 Ga0105246_10029552
591 Ga0105246_10321582
592 Ga0157369_10162293
593 Ga0157374_10175141
594 Ga0157374_10223281
595 Ga0157378_10132394
596 Ga0157378_10194604
597 Ga0163162_10004234
598 Ga0157372_10615512
599 Ga0157372_10707728
600 Ga0157375_10097760
601 Ga0157375_10125099
602 Ga0157375_10271882
603 Ga0163163_10095181
604 Ga0163163_10142705
605 Ga0163163_10799598
606 Ga0157380_10582384
607 Ga0157380_10664749
608 Ga0157377_10027865
609 Ga0157377_10072171
610 Ga0157377_10387231
611 Ga0157379_10108335
612 Ga0157376_10150726
613 Ga0207688_10006131
614 Ga0207699_10043773
615 Ga0207643_10043746
616 Ga0207643_10112513
617 Ga0207684_10271948
618 Ga0207684_10288805
619 Ga0207707_10006530
620 Ga0207693_10002032
621 Ga0207693_10006785
622 Ga0207693_10129430
623 Ga0207660_10024169
624 Ga0207657_10262826
625 Ga0207649_10149923
626 Ga0207649_10167785
627 Ga0207649_10338077
628 Ga0207652_10000845
629 Ga0207646_10002516
630 Ga0207650_10024799
631 Ga0207659_10025594
632 Ga0207687_10005539
633 Ga0207687_10368006
634 Ga0207687_10484844
635 Ga0207644_10047471
636 Ga0207644_10431424
637 Ga0207690_10046081
638 Ga0207690_10086147
639 Ga0207706_10148882
640 Ga0207686_10034115
641 Ga0207709_10098767
642 Ga0207709_10659126
643 Ga0207670_10049163
644 Ga0207669_10233350
645 Ga0207704_10275504
646 Ga0207665_10530096
647 Ga0207691_10027172
648 Ga0207691_10038872
649 Ga0207691_10097119
650 Ga0207691_10278324
651 Ga0207711_10816317
652 Ga0207661_10017673
653 Ga0207661_10153551
654 Ga0207661_10186720
655 Ga0207679_10023271
656 Ga0207679_10091826
657 Ga0207651_10292137
658 Ga0207668_10190507
659 Ga0207658_10004184
660 Ga0207677_10291522
661 Ga0207639_10015521
662 Ga0207678_10156273
663 Ga0207708_10005344
664 Ga0207708_10015432
665 Ga0207708_10172571
666 Ga0207702_10004111
667 Ga0207702_10039417
668 Ga0207702_10386575
669 Ga0207648_10001647
670 Ga0207648_10012226
671 Ga0207676_10403339
672 Ga0207674_10011005
673 Ga0207674_10151120
674 Ga0207675_100106356
675 Ga0207675_100547667
676 Ga0207683_10000696
677 Ga0207683_10021748
678 Ga0207683_10113171
679 Ga0207683_10209712
680 Ga0207683_10215119
681 Ga0268266_10119728
682 Ga0268265_10542311
683 Ga0268264_10051864
684 Ga0265338_10012196
685 Ga0307408_100145042
686 Ga0307410_10203889
687 Ga0307410_10392225
688 Ga0307406_10086210
689 Ga0307406_10095234
690 Ga0307407_10334151
691 Ga0307409_100054334
692 Ga0307409_100104449
693 Ga0307409_100117921
694 Ga0307409_100143764
695 Ga0307416_100044173
696 Ga0307416_100079567
697 Ga0307416_100470831
698 Ga0307416_101051438
699 Ga0307414_10145294
700 Ga0307415_100077960
701 Ga0373945_0127129
702 Ga0373956_0133502
703 Ga0373957_0027488
704 Ga0373931_0160736
705 Ga0373935_0127205
706 Ga0373947_0004388
707 Ga0373937_0043551
708 Ga0395899_0006614
709 Ga0395899_0033676
710 Ga0395899_0239472
711 Ga0395900_0004583
712 Ga0395900_0015159
713 Ga0395900_0018079
714 Ga0395900_0027473
715 Ga0395900_0031215
716 Ga0395900_0337097
717 Ga0395898_0007165
718 Ga0395898_0009447
719 Ga0395898_0020670
720 Ga0395898_0052751
721 Ga0395898_0062246
722 Ga0395898_0179791
723 Ga0395905_0008996
724 Ga0395905_0014434
725 Ga0395905_0071459
726 Ga0395905_0087751
727 Ga0395905_0135000
728 Ga0395905_0144954
729 Ga0395905_0530734
730 Ga0395901_0004101
731 Ga0395901_0024671
732 Ga0395901_0030627
733 Ga0395901_0046503
734 Ga0395901_0059231
735 Ga0395901_0149057
736 Ga0395901_0642303
737 Ga0395901_0702914
738 Ga0436365_1097847
739 Ga0436362_0305949
740 Ga0439438_007821
741 Ga0439461_0004893
742 Ga0439465_0051543
743 Ga0450907_019334
744 Ga0439434_0022405
745 Ga0439434_0092422
746 Ga0466969_0084879
747 Ga0466963_0001836
748 Ga0466963_0007745
749 Ga0466963_0072239
750 Ga0466963_0366308
751 Ga0466964_0170253
752 Ga0466968_0006983
753 Ga0466968_0068084
754 Ga0466959_0348562
755 Ga0451576_0118386
756 Ga0466958_0040680
757 Ga0466967_0010167
758 Ga0466967_0011121
759 Ga0466967_0016740
760 Ga0466967_0049422
761 Ga0466967_0055522
762 Ga0466967_0250199
763 Ga0466967_0646014
764 Ga0495603_0232180
765 Ga0495629_0001096
766 Ga0495629_0107398
767 Ga0495651_0208806
768 Ga0495653_0078133
769 Ga0495580_0259242
770 Ga0495582_0000863
771 Ga0495582_0039846
772 Ga0495639_0029388
773 Ga0495662_0001570
774 Ga0495594_0055528
775 Ga0495596_0100662
776 Ga0495608_0009709
777 Ga0495608_0037697
778 Ga0495628_0166658
779 Ga0495628_0209850
780 Ga0495630_0051809
781 Ga0495630_0205688
782 Ga0495666_0019547
783 Ga0495642_0013359
784 Ga0495642_0055833
785 Ga0495652_0098691
786 Ga0495652_0126915
787 Ga0495665_0002733
788 Ga0495640_0065405
789 Ga0495587_0029101
790 Ga0495587_0134934
791 Ga0495598_0072853
792 Ga0495645_0029542
793 Ga0495645_0198691
794 Ga0495667_0010992
795 Ga0495667_0014944
796 Ga0495667_0028299
797 Ga0495667_0072203
798 Ga0495656_0044995
799 Ga0495634_0011016
800 Ga0495634_0037435
801 Ga0495635_0032333
802 Ga0495657_0037848
803 Ga0495599_0033866
804 Ga0495623_0013259
805 Ga0495623_0147003
806 Ga0495647_0001449
807 Ga0495658_0004763
808 Ga0495658_0023356
809 Ga0495613_0007408
810 Ga0495624_0015947
811 Ga0495624_0154124
812 Ga0495671_0177139
813 Ga0495671_0205116
814 Ga0495589_0026568
815 Ga0495589_0094760
816 Ga0495600_0009122
817 Ga0495600_0016494
818 Ga0495581_0002992
819 Ga0495581_0042618
820 Ga0495604_0007432
821 Ga0495604_0183384
822 Ga0495674_0014827
823 Ga0495674_0083256
824 Ga0495674_0157996
825 Ga0495676_0003328
826 Ga0495676_0044215
827 Ga0495680_0020121
828 Ga0495680_0025349
829 Ga0495680_0026147
830 Ga0495675_0028610
831 Ga0495675_0133135
832 Ga0495677_0022843
833 Ga0495684_0000898
834 Ga0495684_0063104
835 Ga0495684_0229223
836 Ga0495602_0102220
837 Ga0495602_0230973
838 Ga0495614_0025599
839 Ga0496100_0003614
840 Ga0496100_0017376
841 Ga0496100_0516145
842 Ga0496101_0028009
843 Ga0496101_0030878
844 Ga0496101_0080407
845 Ga0496102_0011412
846 Ga0496102_0112294
847 Ga0496102_0127441
848 Ga0496103_0002423
849 Ga0496103_0073354
850 Ga0496104_0000283
851 Ga0496104_0003705
852 Ga0496104_0449083
853 Ga0496104_0494105
854 Ga0496105_0000464
855 Ga0496105_0051963
856 Ga0496105_0113912
857 Ga0496105_0251751
858 Ga0496106_0758109
859 Ga0496107_0205150
860 Ga0496107_0390378
861 Ga0496108_0004985
862 Ga0496108_0072670
863 Ga0496108_0137595
864 Ga0496108_0193055
865 Ga0496108_0296112
866 Ga0496109_0000801
867 Ga0496109_0003735
868 Ga0496109_0012416
869 Ga0496109_0061203
870 Ga0496109_0353676
871 Ga0496109_0406242
872 Ga0496109_0451968
873 Ga0496109_0566161
874 Ga0496110_0000198
875 Ga0496110_0044777
876 Ga0496110_0078918
877 Ga0496110_0151120
878 Ga0496110_0239563
879 Ga0496111_0000948
880 Ga0496111_0001958
881 Ga0496111_0003476
882 Ga0496111_0049673
883 Ga0496111_0205569
884 Ga0496112_0029841
885 Ga0496112_0103090
886 Ga0496112_0257576
887 Ga0496113_0006862
888 Ga0496113_0030867
889 Ga0496113_0173948
890 Ga0496113_0277044
891 Ga0496114_0001179
892 Ga0496114_0008595
893 Ga0496114_0082476
894 Ga0496114_0133829
895 Ga0496114_0166508
896 Ga0496115_0016444
897 Ga0496115_0040738
898 Ga0496115_0045821
899 Ga0501031_0073836
900 Ga0501036_0272033
901 Ga0501039_0023114
902 Ga0501040_0107466
903 Ga0501042_0050409
904 Ga0501048_0075072
905 Ga0501068_0024063
906 Ga0501069_0086514
907 Ga0501071_0291787
908 Ga0501072_0005417
909 Ga0501072_0155359
910 Ga0501075_0032958
911 Ga0501076_0033960
912 Ga0501076_0202399
913 Ga0501077_0142065
914 Ga0501077_0261751
915 Ga0501080_0668176
916 Ga0501081_0083340
917 Ga0501081_0186380
918 Ga0501035_0132715
919 Ga0501035_0503292
920 Ga0501045_0003206
921 nmdc:mga00v17_412309_c1
922 nmdc:mga0yw44_78404_c1
923 nmdc:mga05p37_165312_c1
924 nmdc:mga05p37_169956_c1
925 nmdc:mga05p37_242282_c1
926 nmdc:mga05p37_274447_c1
927 nmdc:mga05p37_41889_c2
928 nmdc:mga05p37_53692_c1
929 nmdc:mga05p37_60851_c1
930 nmdc:mga09592_269132_c1
931 nmdc:mga09592_301100_c1
932 nmdc:mga08y16_15110_c1
933 nmdc:mga08y16_625342_c1
934 nmdc:mga0n895_149988_c1
935 nmdc:mga0n895_24325_c1
936 nmdc:mga0n895_78939_c1
937 nmdc:mga0rr50_3021_c1
938 nmdc:mga08x19_185282_c1
939 nmdc:mga0a205_199165_c1
940 nmdc:mga0a205_63232_c1
941 Ga0495595_0013168
942 Ga0495595_0030998
943 Ga0495619_0017850
944 Ga0495619_0025556
945 Ga0495619_0054018
946 Ga0495619_0373425
947 Ga0501084_0044756
948 Ga0501084_0128236
949 Ga0530510_0040237
950 Ga0530510_0051422
951 Ga0530510_0186418
952 Ga0530510_0555043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10576

EndIII_4Fe-2S

Iron-sulfur binding domain of endonuclease III

170

186

0.98

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

30

144

0.96

PF00633

HHH

Helix-hairpin-helix motif

97

117

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kg3-assembly1.cif.gz_A crystal structure of the core fragment of muty from e.coli at 1.55a resolution 0.9592 5 194
8dvp-assembly1.cif.gz_A glycosylase muty variant n146s in complex with dna containing d(8-oxo-g) paired with substrate purine 0.9591 6 194
8dvy-assembly1.cif.gz_A dna glycosylase muty variant n146s in complex with dna containing d(8-oxo-g) paired with an enzyme-generated abasic site product (ap) and crystalized with calcium acetate 0.9586 5 193
1kg6-assembly1.cif.gz_A crystal structure of the k142r mutant of e.coli muty (core fragment) 0.9584 5 194
4ypr-assembly2.cif.gz_B crystal structure of d144n muty bound to its anti-substrate 0.9577 5 194
ID Description Score Start End Superfamily
af_A0A1D6IX31_1_95_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9519 37 123 1.10.1670.10
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9494 18 123 1.10.340.30
af_P9WQ09_31_141_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9369 18 121 1.10.340.30
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9342 18 123 1.10.340.30
3n5nX01 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9142 123 194 1.10.1670.10
ID Description Score Start End GO Terms
AF-A0A7C6IL43-F1-model_v4 deleted 0.9763 5 194
AF-A0A7W5XWX7-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9726 5 194 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A6F9EEM5-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9717 5 194 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A424NC89-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9714 5 194 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A0A2EWQ1-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9707 5 193 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539

Map