F451435

General Info

Members Datasets Scaffolds Average Seq Length
475 223 950 165

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_1566074_c1|nmdc:mga05p37_1566074_c1_14_613
Length 199
Sequence MKEIDEWLEQYRKIWETRYSQLDDLLAAIKKQERKNKMQMDFIVDKQTKTVSITKEFAFELSLVWDAYTQAELLDQWWAPKPMTSRTKAMDFEVGGRRFYAMVSPDGDERWAVQKYTSITPKTNFKLFNAFADKDENLELPGSDWDLNFSEQDGKTKVSISIYNESLERLERMIEGGMREGTEMQLQNLEELLEKLTQG

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
194 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
201 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
202 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
211 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
218 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 2738541278 Niastella sp. CF465 Isolate Unclassified
221 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
222 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
223 2919683626 Flavobacterium piscis 4129 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.21
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 0
Rhizoplane 1.47
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_1566074_c1 3300050507 Unclassified 652
2 Ga0065714_10164974 3300005288 Bacteria 1032
3 Ga0065704_10368270 3300005289 Bacteria 788
4 Ga0065712_10020713 3300005290 Bacteria 1582
5 Ga0065712_10101133 3300005290 Bacteria 2007
6 Ga0065715_10028874 3300005293 Bacteria 1735
7 Ga0065715_10094969 3300005293 Bacteria 4199
8 Ga0065715_10172284 3300005293 Bacteria 1538
9 Ga0065707_10017099 3300005295 Bacteria 1681
10 Ga0065707_10713891 3300005295 Bacteria 634
11 Ga0070676_10039013 3300005328 Bacteria 2745
12 Ga0070683_101031450 3300005329 Unclassified 790
13 Ga0070690_100104879 3300005330 Unclassified 1878
14 Ga0070690_100312763 3300005330 Bacteria 1129
15 Ga0070670_100230999 3300005331 Bacteria 1610
16 Ga0070677_10305428 3300005333 Bacteria 810
17 Ga0068869_101118317 3300005334 Bacteria 690
18 Ga0070666_10012837 3300005335 Bacteria 5296
19 Ga0070666_10156125 3300005335 Bacteria 1593
20 Ga0070666_10185332 3300005335 Bacteria 1461
21 Ga0070666_10573766 3300005335 Bacteria 822
22 Ga0068868_100064681 3300005338 Bacteria 2904
23 Ga0068868_100149815 3300005338 Bacteria 1920
24 Ga0068868_101293815 3300005338 Unclassified 677
25 Ga0070660_100230722 3300005339 Bacteria 1506
26 Ga0070689_100753032 3300005340 Bacteria 854
27 Ga0070687_100115906 3300005343 Bacteria 1524
28 Ga0070687_100182662 3300005343 Bacteria 1257
29 Ga0070687_100292237 3300005343 Bacteria 1030
30 Ga0070661_100178446 3300005344 Bacteria 1615
31 Ga0070661_100275983 3300005344 Bacteria 1303
32 Ga0070668_100312395 3300005347 Unclassified 1321
33 Ga0070669_100029435 3300005353 Bacteria 3958
34 Ga0070671_100038014 3300005355 Bacteria 3994
35 Ga0070671_100086917 3300005355 Bacteria 2616
36 Ga0070671_100098946 3300005355 Bacteria 2446
37 Ga0070671_100104412 3300005355 Unclassified 2378
38 Ga0070671_100116921 3300005355 Bacteria 2242
39 Ga0070671_101506491 3300005355 Unclassified 595
40 Ga0070674_100112043 3300005356 Bacteria 2005
41 Ga0070673_100100534 3300005364 Bacteria 2381
42 Ga0070673_100312403 3300005364 Bacteria 1387
43 Ga0070673_101064329 3300005364 Bacteria 755
44 Ga0070688_100234160 3300005365 Bacteria 1300
45 Ga0070659_100223701 3300005366 Bacteria 1554
46 Ga0070659_100887177 3300005366 Bacteria 779
47 Ga0070667_100154392 3300005367 Bacteria 2018
48 Ga0070667_100207150 3300005367 Unclassified 1742
49 Ga0070667_100299553 3300005367 Bacteria 1447
50 Ga0070667_100375388 3300005367 Bacteria 1291
51 Ga0070701_10019528 3300005438 Bacteria 3202
52 Ga0070701_10106131 3300005438 Bacteria 1563
53 Ga0070701_10194353 3300005438 Bacteria 1196
54 Ga0070701_10383319 3300005438 Bacteria 886
55 Ga0070705_100295197 3300005440 Bacteria 1159
56 Ga0070700_100007169 3300005441 Bacteria 6004
57 Ga0070700_100047956 3300005441 Bacteria 2646
58 Ga0070700_101035964 3300005441 Bacteria 677
59 Ga0070694_100785981 3300005444 Bacteria 779
60 Ga0070678_100075223 3300005456 Bacteria 2540
61 Ga0070678_100436965 3300005456 Bacteria 1144
62 Ga0070662_100490309 3300005457 Bacteria 1024
63 Ga0070662_100831851 3300005457 Bacteria 786
64 Ga0068867_100015064 3300005459 Bacteria 5483
65 Ga0068867_100083780 3300005459 Bacteria 2407
66 Ga0068867_100335782 3300005459 Bacteria 1256
67 Ga0068867_100661222 3300005459 Unclassified 918
68 Ga0070706_100280676 3300005467 Bacteria 1554
69 Ga0070707_100084748 3300005468 Bacteria 3062
70 Ga0070698_100007810 3300005471 Bacteria 11577
71 Ga0070699_101098439 3300005518 Unclassified 730
72 Ga0068853_100115595 3300005539 Bacteria 2388
73 Ga0068853_100677526 3300005539 Bacteria 982
74 Ga0070672_100032457 3300005543 Bacteria 3940
75 Ga0070672_100218129 3300005543 Bacteria 1599
76 Ga0070686_100311006 3300005544 Unclassified 1172
77 Ga0070695_100688231 3300005545 Bacteria 810
78 Ga0070695_100786257 3300005545 Bacteria 761
79 Ga0070665_101747171 3300005548 Bacteria 629
80 Ga0070704_100204102 3300005549 Bacteria 1597
81 Ga0070704_101395109 3300005549 Bacteria 643
82 Ga0068855_100000071 3300005563 Bacteria 122638
83 Ga0068855_100033157 3300005563 Bacteria 6165
84 Ga0068855_101021272 3300005563 Bacteria 868
85 Ga0070664_100015837 3300005564 Bacteria 6172
86 Ga0070664_100184566 3300005564 Bacteria 1856
87 Ga0070664_100692984 3300005564 Bacteria 949
88 Ga0070664_101150764 3300005564 Bacteria 731
89 Ga0068857_100507361 3300005577 Bacteria 1132
90 Ga0068854_100160032 3300005578 Bacteria 1743
91 Ga0068854_100343443 3300005578 Bacteria 1220
92 Ga0068856_100005796 3300005614 Bacteria 12175
93 Ga0068856_101266141 3300005614 Bacteria 753
94 Ga0070702_100882276 3300005615 Bacteria 699
95 Ga0068852_100171397 3300005616 Bacteria 2035
96 Ga0068852_100189135 3300005616 Bacteria 1941
97 Ga0068852_100661511 3300005616 Bacteria 1053
98 Ga0068859_100085471 3300005617 Bacteria 3200
99 Ga0068859_100117902 3300005617 Bacteria 2720
100 Ga0068859_100118149 3300005617 Bacteria 2717
101 Ga0068859_100128817 3300005617 Bacteria 2601
102 Ga0068859_100167319 3300005617 Bacteria 2278
103 Ga0068859_100340743 3300005617 Bacteria 1593
104 Ga0068859_100489003 3300005617 Bacteria 1326
105 Ga0068859_100714314 3300005617 Unclassified 1092
106 Ga0068859_100732305 3300005617 Bacteria 1078
107 Ga0068864_100017554 3300005618 Bacteria 5966
108 Ga0068864_100022851 3300005618 Bacteria 5246
109 Ga0068864_100079795 3300005618 Bacteria 2866
110 Ga0068864_100096861 3300005618 Bacteria 2611
111 Ga0068864_100126163 3300005618 Unclassified 2294
112 Ga0068866_10404128 3300005718 Unclassified 882
113 Ga0068866_11004319 3300005718 Bacteria 593
114 Ga0068861_100035784 3300005719 Bacteria 3681
115 Ga0068861_100378753 3300005719 Bacteria 1249
116 Ga0068861_100820257 3300005719 Bacteria 875
117 Ga0068861_100982118 3300005719 Bacteria 805
118 Ga0068851_10148673 3300005834 Bacteria 1279
119 Ga0068851_10441582 3300005834 Bacteria 772
120 Ga0068870_10141182 3300005840 Bacteria 1409
121 Ga0068863_100015623 3300005841 Bacteria 7292
122 Ga0068863_100091099 3300005841 Bacteria 2891
123 Ga0068863_100351908 3300005841 Unclassified 1435
124 Ga0068858_100091135 3300005842 Unclassified 2837
125 Ga0068858_100214392 3300005842 Bacteria 1822
126 Ga0068858_100342305 3300005842 Bacteria 1431
127 Ga0068858_100830850 3300005842 Bacteria 902
128 Ga0068858_100873176 3300005842 Unclassified 879
129 Ga0068858_101647618 3300005842 Unclassified 633
130 Ga0068860_100164406 3300005843 Bacteria 2141
131 Ga0068860_100444157 3300005843 Bacteria 1289
132 Ga0068860_100769013 3300005843 Unclassified 975
133 Ga0068860_100923076 3300005843 Bacteria 889
134 Ga0068862_100254194 3300005844 Bacteria 1602
135 Ga0068862_100791986 3300005844 Bacteria 925
136 Ga0068862_101152926 3300005844 Bacteria 772
137 Ga0081455_10180948 3300005937 Bacteria 1596
138 Ga0070715_10081641 3300006163 Bacteria 1469
139 Ga0075366_10167024 3300006195 Bacteria 1335
140 Ga0097621_100000603 3300006237 Bacteria 25339
141 Ga0097621_100060888 3300006237 Bacteria 3095
142 Ga0097621_100074464 3300006237 Bacteria 2812
143 Ga0097621_100218585 3300006237 Bacteria 1660
144 Ga0068871_100001339 3300006358 Bacteria 16493
145 Ga0068871_100024849 3300006358 Bacteria 4652
146 Ga0068871_100053651 3300006358 Bacteria 3268
147 Ga0068871_100384047 3300006358 Unclassified 1248
148 Ga0068865_100016853 3300006881 Bacteria 4686
149 Ga0068865_100150910 3300006881 Bacteria 1763
150 Ga0097620_100085472 3300006931 Bacteria 3200
151 Ga0097620_100117901 3300006931 Bacteria 2720
152 Ga0097620_100118146 3300006931 Bacteria 2717
153 Ga0097620_100128814 3300006931 Bacteria 2601
154 Ga0097620_100167334 3300006931 Bacteria 2278
155 Ga0097620_100340745 3300006931 Bacteria 1593
156 Ga0097620_100488983 3300006931 Bacteria 1326
157 Ga0097620_100714313 3300006931 Unclassified 1092
158 Ga0097620_100732262 3300006931 Bacteria 1078
159 Ga0075435_100160128 3300007076 Bacteria 1895
160 Ga0105250_10203534 3300009092 Bacteria 835
161 Ga0105240_10000606 3300009093 Bacteria 66467
162 Ga0105240_10332933 3300009093 Unclassified 1727
163 Ga0105240_10577309 3300009093 Bacteria 1241
164 Ga0105240_11054547 3300009093 Bacteria 867
165 Ga0111539_10315984 3300009094 Bacteria 1818
166 Ga0111539_10849549 3300009094 Bacteria 1062
167 Ga0111539_12339303 3300009094 Unclassified 620
168 Ga0105245_10427919 3300009098 Bacteria 1328
169 Ga0105245_11182078 3300009098 Bacteria 812
170 Ga0105247_10001251 3300009101 Bacteria 18829
171 Ga0105247_10368400 3300009101 Bacteria 1015
172 Ga0105247_10551667 3300009101 Unclassified 847
173 Ga0105243_10000824 3300009148 Bacteria 29535
174 Ga0105243_10097459 3300009148 Bacteria 2434
175 Ga0105241_10055395 3300009174 Bacteria 3038
176 Ga0105241_10489082 3300009174 Bacteria 1095
177 Ga0105241_10700611 3300009174 Bacteria 924
178 Ga0105242_10001014 3300009176 Bacteria 22062
179 Ga0105242_10066451 3300009176 Bacteria 2978
180 Ga0105242_10143481 3300009176 Bacteria 2075
181 Ga0105242_10419440 3300009176 Bacteria 1254
182 Ga0105242_10725011 3300009176 Bacteria 976
183 Ga0105242_10803208 3300009176 Unclassified 931
184 Ga0105248_10158918 3300009177 Bacteria 2550
185 Ga0105248_10586702 3300009177 Bacteria 1258
186 Ga0105248_10816440 3300009177 Bacteria 1052
187 Ga0105248_11247843 3300009177 Bacteria 840
188 Ga0105237_10000284 3300009545 Bacteria 69955
189 Ga0105237_10117067 3300009545 Bacteria 2658
190 Ga0105237_10363967 3300009545 Bacteria 1450
191 Ga0105237_10938467 3300009545 Bacteria 872
192 Ga0105249_10039592 3300009553 Bacteria 4280
193 Ga0105249_10112814 3300009553 Bacteria 2571
194 Ga0105249_10205248 3300009553 Bacteria 1931
195 Ga0105249_10764349 3300009553 Bacteria 1029
196 Ga0105239_10118237 3300010375 Bacteria 2941
197 Ga0105239_12246530 3300010375 Unclassified 635
198 Ga0105246_10448534 3300011119 Bacteria 1083
199 Ga0105246_10746938 3300011119 Bacteria 862
200 Ga0157323_1010257 3300012495 Bacteria 733
201 Ga0157371_10030074 3300013102 Bacteria 3920
202 Ga0157371_10204546 3300013102 Bacteria 1416
203 Ga0157371_10803932 3300013102 Bacteria 709
204 Ga0157370_10010643 3300013104 Bacteria 9682
205 Ga0157370_10063164 3300013104 Bacteria 3510
206 Ga0157370_10711605 3300013104 Bacteria 916
207 Ga0157369_10097053 3300013105 Bacteria 3144
208 Ga0157374_10064903 3300013296 Bacteria 3428
209 Ga0157374_10101577 3300013296 Bacteria 2757
210 Ga0157374_10361113 3300013296 Bacteria 1444
211 Ga0157374_11098417 3300013296 Unclassified 816
212 Ga0157378_10010236 3300013297 Bacteria 8186
213 Ga0157378_10013577 3300013297 Bacteria 7123
214 Ga0157378_10152986 3300013297 Bacteria 2150
215 Ga0157378_10192612 3300013297 Bacteria 1924
216 Ga0157378_10670275 3300013297 Bacteria 1054
217 Ga0157378_11107561 3300013297 Bacteria 829
218 Ga0163162_10001047 3300013306 Bacteria 25683
219 Ga0163162_10001153 3300013306 Bacteria 24668
220 Ga0163162_10618017 3300013306 Bacteria 1209
221 Ga0163162_10797110 3300013306 Bacteria 1062
222 Ga0163162_10970696 3300013306 Bacteria 960
223 Ga0157372_10035741 3300013307 Bacteria 5471
224 Ga0157372_10870077 3300013307 Bacteria 1046
225 Ga0157375_10001470 3300013308 Bacteria 20276
226 Ga0157375_10019913 3300013308 Bacteria 6118
227 Ga0157375_10110263 3300013308 Bacteria 2849
228 Ga0157375_10128624 3300013308 Bacteria 2651
229 Ga0157375_10282476 3300013308 Bacteria 1823
230 Ga0157375_11143509 3300013308 Bacteria 912
231 Ga0157375_11244895 3300013308 Unclassified 874
232 Ga0157375_11464477 3300013308 Bacteria 805
233 Ga0163163_10178311 3300014325 Bacteria 2172
234 Ga0163163_10228844 3300014325 Bacteria 1908
235 Ga0163163_10243888 3300014325 Bacteria 1847
236 Ga0163163_10277654 3300014325 Unclassified 1727
237 Ga0163163_11791181 3300014325 Bacteria 674
238 Ga0157380_10067892 3300014326 Bacteria 2872
239 Ga0157380_10082516 3300014326 Bacteria 2631
240 Ga0157380_10640876 3300014326 Bacteria 1058
241 Ga0157377_10107275 3300014745 Bacteria 1674
242 Ga0157377_10154640 3300014745 Bacteria 1421
243 Ga0157377_10341271 3300014745 Bacteria 1002
244 Ga0157379_10014266 3300014968 Bacteria 6968
245 Ga0157379_10191725 3300014968 Bacteria 1847
246 Ga0157379_10543697 3300014968 Bacteria 1080
247 Ga0157376_10000499 3300014969 Bacteria 25358
248 Ga0157376_10144133 3300014969 Bacteria 2141
249 Ga0157376_10213924 3300014969 Bacteria 1781
250 Ga0157376_11200169 3300014969 Bacteria 787
251 Ga0157376_11700387 3300014969 Unclassified 666
252 Ga0163161_10000627 3300017792 Bacteria 28166
253 Ga0163161_10019245 3300017792 Bacteria 4787
254 Ga0163161_10067029 3300017792 Bacteria 2621
255 Ga0163161_10227843 3300017792 Bacteria 1445
256 Ga0163161_10694229 3300017792 Bacteria 847
257 Ga0163161_10777973 3300017792 Bacteria 803
258 Ga0163161_11523923 3300017792 Bacteria 587
259 Ga0207666_1023504 3300025271 Bacteria 917
260 Ga0207697_10218464 3300025315 Bacteria 841
261 Ga0207656_10224960 3300025321 Bacteria 913
262 Ga0207653_10058011 3300025885 Bacteria 1301
263 Ga0207682_10195130 3300025893 Bacteria 929
264 Ga0207642_10019317 3300025899 Bacteria 2637
265 Ga0207642_10462291 3300025899 Unclassified 771
266 Ga0207710_10000281 3300025900 Bacteria 41434
267 Ga0207688_10283855 3300025901 Unclassified 1009
268 Ga0207680_10059781 3300025903 Bacteria 2317
269 Ga0207647_10502846 3300025904 Bacteria 676
270 Ga0207685_10662144 3300025905 Bacteria 565
271 Ga0207645_10759166 3300025907 Bacteria 659
272 Ga0207643_10277703 3300025908 Bacteria 1038
273 Ga0207643_10292302 3300025908 Bacteria 1012
274 Ga0207705_10005209 3300025909 Bacteria 9749
275 Ga0207705_10502455 3300025909 Bacteria 942
276 Ga0207654_10306460 3300025911 Bacteria 1082
277 Ga0207695_10000685 3300025913 Bacteria 66448
278 Ga0207695_10417010 3300025913 Bacteria 1227
279 Ga0207671_10016476 3300025914 Bacteria 5741
280 Ga0207671_10084733 3300025914 Bacteria 2380
281 Ga0207671_11039555 3300025914 Bacteria 645
282 Ga0207662_10027454 3300025918 Bacteria 3284
283 Ga0207662_10035006 3300025918 Bacteria 2932
284 Ga0207657_10217117 3300025919 Bacteria 1533
285 Ga0207657_10236153 3300025919 Bacteria 1461
286 Ga0207681_10492119 3300025923 Bacteria 1003
287 Ga0207659_10202476 3300025926 Unclassified 1586
288 Ga0207659_10224529 3300025926 Bacteria 1512
289 Ga0207687_10324099 3300025927 Bacteria 1248
290 Ga0207687_10788519 3300025927 Unclassified 810
291 Ga0207687_10873971 3300025927 Bacteria 769
292 Ga0207644_10016691 3300025931 Bacteria 4943
293 Ga0207644_10027330 3300025931 Bacteria 3941
294 Ga0207644_10029178 3300025931 Bacteria 3825
295 Ga0207690_10288689 3300025932 Bacteria 1280
296 Ga0207706_11339134 3300025933 Bacteria 590
297 Ga0207686_10000018 3300025934 Bacteria 189717
298 Ga0207686_10050821 3300025934 Bacteria 2580
299 Ga0207686_10076339 3300025934 Bacteria 2172
300 Ga0207686_10521713 3300025934 Unclassified 925
301 Ga0207709_10000056 3300025935 Bacteria 221962
302 Ga0207709_10059759 3300025935 Bacteria 2374
303 Ga0207709_10171935 3300025935 Bacteria 1521
304 Ga0207709_10205784 3300025935 Bacteria 1409
305 Ga0207670_10695640 3300025936 Bacteria 841
306 Ga0207670_10781323 3300025936 Bacteria 795
307 Ga0207669_10324213 3300025937 Bacteria 1180
308 Ga0207669_10333480 3300025937 Unclassified 1165
309 Ga0207704_10230288 3300025938 Bacteria 1377
310 Ga0207704_10359608 3300025938 Bacteria 1136
311 Ga0207691_10007611 3300025940 Bacteria 10425
312 Ga0207691_10930671 3300025940 Bacteria 727
313 Ga0207711_10023809 3300025941 Bacteria 5126
314 Ga0207711_10101179 3300025941 Bacteria 2550
315 Ga0207689_10042355 3300025942 Bacteria 3767
316 Ga0207689_10084901 3300025942 Bacteria 2602
317 Ga0207689_10247944 3300025942 Unclassified 1473
318 Ga0207679_10015360 3300025945 Bacteria 5058
319 Ga0207679_10140137 3300025945 Bacteria 1954
320 Ga0207667_10000014 3300025949 Bacteria 421261
321 Ga0207667_10010568 3300025949 Bacteria 10783
322 Ga0207667_10087498 3300025949 Bacteria 3222
323 Ga0207667_10394831 3300025949 Bacteria 1408
324 Ga0207651_10313768 3300025960 Bacteria 1308
325 Ga0207651_10594657 3300025960 Bacteria 966
326 Ga0207651_11664069 3300025960 Unclassified 575
327 Ga0207712_10170480 3300025961 Bacteria 1701
328 Ga0207712_10390459 3300025961 Bacteria 1167
329 Ga0207712_10554292 3300025961 Bacteria 989
330 Ga0207712_10729340 3300025961 Bacteria 867
331 Ga0207712_10801955 3300025961 Bacteria 828
332 Ga0207712_11326704 3300025961 Bacteria 643
333 Ga0207668_10175366 3300025972 Bacteria 1686
334 Ga0207640_11424886 3300025981 Bacteria 621
335 Ga0207658_10137113 3300025986 Bacteria 1975
336 Ga0207658_10421898 3300025986 Unclassified 1176
337 Ga0207658_10475863 3300025986 Bacteria 1109
338 Ga0207703_10085755 3300026035 Unclassified 2636
339 Ga0207703_10313061 3300026035 Bacteria 1435
340 Ga0207703_10484819 3300026035 Bacteria 1159
341 Ga0207703_10570617 3300026035 Unclassified 1068
342 Ga0207703_10596877 3300026035 Bacteria 1044
343 Ga0207639_10005514 3300026041 Bacteria 8553
344 Ga0207639_10094615 3300026041 Bacteria 2399
345 Ga0207708_10005083 3300026075 Bacteria 9704
346 Ga0207708_10017604 3300026075 Bacteria 5380
347 Ga0207702_10000402 3300026078 Bacteria 49308
348 Ga0207641_10017117 3300026088 Bacteria 5931
349 Ga0207641_10233935 3300026088 Bacteria 1709
350 Ga0207641_10703682 3300026088 Unclassified 995
351 Ga0207648_10071059 3300026089 Bacteria 3034
352 Ga0207648_10119769 3300026089 Bacteria 2314
353 Ga0207648_10246797 3300026089 Bacteria 1591
354 Ga0207648_10402494 3300026089 Bacteria 1240
355 Ga0207676_10035708 3300026095 Bacteria 3775
356 Ga0207676_10207706 3300026095 Bacteria 1735
357 Ga0207676_10352943 3300026095 Bacteria 1360
358 Ga0207676_10552278 3300026095 Bacteria 1100
359 Ga0207674_10174879 3300026116 Bacteria 2099
360 Ga0207674_10603563 3300026116 Bacteria 1060
361 Ga0207674_11218152 3300026116 Bacteria 722
362 Ga0207675_100008372 3300026118 Bacteria 9747
363 Ga0207675_100340825 3300026118 Bacteria 1467
364 Ga0207675_101662016 3300026118 Bacteria 659
365 Ga0207683_10022162 3300026121 Bacteria 5451
366 Ga0207683_10037470 3300026121 Bacteria 4222
367 Ga0207683_10240671 3300026121 Bacteria 1651
368 Ga0207698_10133513 3300026142 Unclassified 2125
369 Ga0207698_10253853 3300026142 Bacteria 1611
370 Ga0207698_10300551 3300026142 Bacteria 1494
371 Ga0207698_10727864 3300026142 Bacteria 989
372 Ga0207698_10728534 3300026142 Bacteria 989
373 Ga0209998_10120399 3300027717 Bacteria 661
374 Ga0207428_10546160 3300027907 Unclassified 838
375 Ga0268266_11588800 3300028379 Bacteria 629
376 Ga0268265_10075692 3300028380 Bacteria 2638
377 Ga0268265_10286163 3300028380 Bacteria 1477
378 Ga0268265_10604904 3300028380 Unclassified 1048
379 Ga0268265_11484050 3300028380 Bacteria 681
380 Ga0268264_10232778 3300028381 Unclassified 1702
381 Ga0268264_10321926 3300028381 Bacteria 1462
382 Ga0268264_10519760 3300028381 Unclassified 1163
383 Ga0268264_10630414 3300028381 Unclassified 1059
384 Ga0265338_10247924 3300028800 Bacteria 1315
385 Ga0307512_10119680 3300030522 Bacteria 1698
386 Ga0307513_10108227 3300031456 Bacteria 2781
387 Ga0307509_10196434 3300031507 Bacteria 1860
388 Ga0307408_100541740 3300031548 Bacteria 1026
389 Ga0307413_10000959 3300031824 Bacteria 10337
390 Ga0307413_10009362 3300031824 Bacteria 4685
391 Ga0307413_10347128 3300031824 Bacteria 1144
392 Ga0307410_10003028 3300031852 Bacteria 8303
393 Ga0307407_10056924 3300031903 Bacteria 2266
394 Ga0307412_10191030 3300031911 Bacteria 1548
395 Ga0307412_10342283 3300031911 Bacteria 1197
396 Ga0307409_100001622 3300031995 Bacteria 11240
397 Ga0307409_100683020 3300031995 Bacteria 1024
398 Ga0307416_100091333 3300032002 Bacteria 2615
399 Ga0307416_100102999 3300032002 Bacteria 2491
400 Ga0307416_100401350 3300032002 Bacteria 1408
401 Ga0307414_10031458 3300032004 Bacteria 3481
402 Ga0307414_10202811 3300032004 Bacteria 1615
403 Ga0307414_10468553 3300032004 Bacteria 1108
404 Ga0307414_10479242 3300032004 Bacteria 1097
405 Ga0307411_10000006 3300032005 Bacteria 382357
406 Ga0307411_10059869 3300032005 Bacteria 2526
407 Ga0307411_11211886 3300032005 Unclassified 685
408 Ga0307415_100153014 3300032126 Unclassified 1778
409 Ga0307415_102337214 3300032126 Unclassified 525
410 Ga0373932_0123151 3300035112 Bacteria 867
411 Ga0373939_0267701 3300035114 Bacteria 671
412 Ga0373961_0098534 3300035241 Bacteria 944
413 Ga0373931_0303483 3300035691 Bacteria 987
414 Ga0395899_0006559 3300037312 Bacteria 9023
415 Ga0395900_0217466 3300037418 Bacteria 1927
416 Ga0395898_0011579 3300037466 Bacteria 9158
417 Ga0436364_0434021 3300037853 Unclassified 706
418 Ga0395901_0017211 3300038443 Bacteria 7375
419 Ga0451793_0702618 3300041452 Bacteria 842
420 Ga0451853_2256311 3300041512 Bacteria 909
421 Ga0453683_0744383 3300044673 Unclassified 644
422 Ga0495638_0122160 3300046460 Bacteria 1538
423 Ga0495610_0129489 3300046512 Bacteria 1097
424 Ga0495630_0983986 3300046517 Bacteria 641
425 Ga0495632_0154850 3300046519 Bacteria 1058
426 Ga0495645_0280136 3300046543 Bacteria 1097
427 Ga0495661_0001005 3300046665 Bacteria 25358
428 Ga0495636_0124637 3300047318 Bacteria 1142
429 Ga0495684_0125051 3300047471 Bacteria 1935
430 Ga0496100_0064140 3300048903 Bacteria 2430
431 Ga0496100_1024113 3300048903 Unclassified 650
432 Ga0496101_0049862 3300048904 Bacteria 3012
433 Ga0496106_1067893 3300048909 Bacteria 633
434 Ga0496109_0904390 3300048912 Bacteria 821
435 Ga0496114_0067507 3300048917 Bacteria 3000
436 Ga0501308_013925 3300049128 Bacteria 935
437 Ga0501296_007639 3300049519 Bacteria 1243
438 Ga0501298_028493 3300049521 Bacteria 1084
439 Ga0501072_0180517 3300049588 Bacteria 1684
440 Ga0501217_075623 3300049661 Bacteria 924
441 Ga0501249_004212 3300049679 Bacteria 2917
442 Ga0501257_018127 3300049686 Bacteria 1640
443 Ga0501259_030965 3300049688 Bacteria 1010
444 Ga0501261_024319 3300049690 Bacteria 886
445 Ga0501241_137120 3300049758 Bacteria 555
446 Ga0501266_000008 3300049763 Bacteria 241629
447 nmdc:mga0k408_296502_c1 3300050493 Bacteria 965
448 nmdc:mga05p37_363842_c1 3300050507 Bacteria 1700
449 nmdc:mga05p37_591915_c1 3300050507 Bacteria 1254
450 nmdc:mga08y16_316523_c1 3300050511 Bacteria 1607
451 nmdc:mga08y16_56566_c1 3300050511 Bacteria 4098
452 nmdc:mga0n895_967923_c1 3300050512 Bacteria 834
453 nmdc:mga0rr50_183391_c1 3300050513 Bacteria 1712
454 nmdc:mga0rr50_566285_c1 3300050513 Bacteria 968
455 nmdc:mga0rr50_651498_c1 3300050513 Bacteria 899
456 Ga0500646_0028903 3300053090 Bacteria 1515
457 Ga0500583_0000007 3300053092 Bacteria 162080
458 Ga0500583_0008082 3300053092 Bacteria 3749
459 Ga0500651_0291183 3300053093 Bacteria 939
460 Ga0500562_009333 3300053108 Bacteria 2480
461 Ga0500594_0019060 3300053118 Bacteria 1697
462 Ga0500652_050755 3300053131 Bacteria 1693
463 Ga0500559_0016004 3300053136 Bacteria 3167
464 Ga0500568_0000231 3300053139 Bacteria 47879
465 Ga0500568_0169163 3300053139 Bacteria 805
466 Ga0500589_099953 3300053147 Bacteria 1261
467 Ga0500616_0002076 3300053153 Bacteria 17545
468 Ga0500622_0000010 3300053156 Bacteria 398804
469 Ga0500622_0007108 3300053156 Bacteria 6398
470 Ga0500587_011865 3300053739 Bacteria 1099
471 Ga0501084_0855955 3300054114 Bacteria 765
472 2738728066 2738541278 Bacteria 9755573
473 2740001765 2739367857 Bacteria 5433684
474 2740006581 2739367858 Bacteria 5432813
475 2919688138 2919683626 Bacteria 5534354
476 nmdc:mga05p37_1566074_c1
477 Ga0065714_10164974
478 Ga0065704_10368270
479 Ga0065712_10020713
480 Ga0065712_10101133
481 Ga0065715_10028874
482 Ga0065715_10094969
483 Ga0065715_10172284
484 Ga0065707_10017099
485 Ga0065707_10713891
486 Ga0070676_10039013
487 Ga0070683_101031450
488 Ga0070690_100104879
489 Ga0070690_100312763
490 Ga0070670_100230999
491 Ga0070677_10305428
492 Ga0068869_101118317
493 Ga0070666_10012837
494 Ga0070666_10156125
495 Ga0070666_10185332
496 Ga0070666_10573766
497 Ga0068868_100064681
498 Ga0068868_100149815
499 Ga0068868_101293815
500 Ga0070660_100230722
501 Ga0070689_100753032
502 Ga0070687_100115906
503 Ga0070687_100182662
504 Ga0070687_100292237
505 Ga0070661_100178446
506 Ga0070661_100275983
507 Ga0070668_100312395
508 Ga0070669_100029435
509 Ga0070671_100038014
510 Ga0070671_100086917
511 Ga0070671_100098946
512 Ga0070671_100104412
513 Ga0070671_100116921
514 Ga0070671_101506491
515 Ga0070674_100112043
516 Ga0070673_100100534
517 Ga0070673_100312403
518 Ga0070673_101064329
519 Ga0070688_100234160
520 Ga0070659_100223701
521 Ga0070659_100887177
522 Ga0070667_100154392
523 Ga0070667_100207150
524 Ga0070667_100299553
525 Ga0070667_100375388
526 Ga0070701_10019528
527 Ga0070701_10106131
528 Ga0070701_10194353
529 Ga0070701_10383319
530 Ga0070705_100295197
531 Ga0070700_100007169
532 Ga0070700_100047956
533 Ga0070700_101035964
534 Ga0070694_100785981
535 Ga0070678_100075223
536 Ga0070678_100436965
537 Ga0070662_100490309
538 Ga0070662_100831851
539 Ga0068867_100015064
540 Ga0068867_100083780
541 Ga0068867_100335782
542 Ga0068867_100661222
543 Ga0070706_100280676
544 Ga0070707_100084748
545 Ga0070698_100007810
546 Ga0070699_101098439
547 Ga0068853_100115595
548 Ga0068853_100677526
549 Ga0070672_100032457
550 Ga0070672_100218129
551 Ga0070686_100311006
552 Ga0070695_100688231
553 Ga0070695_100786257
554 Ga0070665_101747171
555 Ga0070704_100204102
556 Ga0070704_101395109
557 Ga0068855_100000071
558 Ga0068855_100033157
559 Ga0068855_101021272
560 Ga0070664_100015837
561 Ga0070664_100184566
562 Ga0070664_100692984
563 Ga0070664_101150764
564 Ga0068857_100507361
565 Ga0068854_100160032
566 Ga0068854_100343443
567 Ga0068856_100005796
568 Ga0068856_101266141
569 Ga0070702_100882276
570 Ga0068852_100171397
571 Ga0068852_100189135
572 Ga0068852_100661511
573 Ga0068859_100085471
574 Ga0068859_100117902
575 Ga0068859_100118149
576 Ga0068859_100128817
577 Ga0068859_100167319
578 Ga0068859_100340743
579 Ga0068859_100489003
580 Ga0068859_100714314
581 Ga0068859_100732305
582 Ga0068864_100017554
583 Ga0068864_100022851
584 Ga0068864_100079795
585 Ga0068864_100096861
586 Ga0068864_100126163
587 Ga0068866_10404128
588 Ga0068866_11004319
589 Ga0068861_100035784
590 Ga0068861_100378753
591 Ga0068861_100820257
592 Ga0068861_100982118
593 Ga0068851_10148673
594 Ga0068851_10441582
595 Ga0068870_10141182
596 Ga0068863_100015623
597 Ga0068863_100091099
598 Ga0068863_100351908
599 Ga0068858_100091135
600 Ga0068858_100214392
601 Ga0068858_100342305
602 Ga0068858_100830850
603 Ga0068858_100873176
604 Ga0068858_101647618
605 Ga0068860_100164406
606 Ga0068860_100444157
607 Ga0068860_100769013
608 Ga0068860_100923076
609 Ga0068862_100254194
610 Ga0068862_100791986
611 Ga0068862_101152926
612 Ga0081455_10180948
613 Ga0070715_10081641
614 Ga0075366_10167024
615 Ga0097621_100000603
616 Ga0097621_100060888
617 Ga0097621_100074464
618 Ga0097621_100218585
619 Ga0068871_100001339
620 Ga0068871_100024849
621 Ga0068871_100053651
622 Ga0068871_100384047
623 Ga0068865_100016853
624 Ga0068865_100150910
625 Ga0097620_100085472
626 Ga0097620_100117901
627 Ga0097620_100118146
628 Ga0097620_100128814
629 Ga0097620_100167334
630 Ga0097620_100340745
631 Ga0097620_100488983
632 Ga0097620_100714313
633 Ga0097620_100732262
634 Ga0075435_100160128
635 Ga0105250_10203534
636 Ga0105240_10000606
637 Ga0105240_10332933
638 Ga0105240_10577309
639 Ga0105240_11054547
640 Ga0111539_10315984
641 Ga0111539_10849549
642 Ga0111539_12339303
643 Ga0105245_10427919
644 Ga0105245_11182078
645 Ga0105247_10001251
646 Ga0105247_10368400
647 Ga0105247_10551667
648 Ga0105243_10000824
649 Ga0105243_10097459
650 Ga0105241_10055395
651 Ga0105241_10489082
652 Ga0105241_10700611
653 Ga0105242_10001014
654 Ga0105242_10066451
655 Ga0105242_10143481
656 Ga0105242_10419440
657 Ga0105242_10725011
658 Ga0105242_10803208
659 Ga0105248_10158918
660 Ga0105248_10586702
661 Ga0105248_10816440
662 Ga0105248_11247843
663 Ga0105237_10000284
664 Ga0105237_10117067
665 Ga0105237_10363967
666 Ga0105237_10938467
667 Ga0105249_10039592
668 Ga0105249_10112814
669 Ga0105249_10205248
670 Ga0105249_10764349
671 Ga0105239_10118237
672 Ga0105239_12246530
673 Ga0105246_10448534
674 Ga0105246_10746938
675 Ga0157323_1010257
676 Ga0157371_10030074
677 Ga0157371_10204546
678 Ga0157371_10803932
679 Ga0157370_10010643
680 Ga0157370_10063164
681 Ga0157370_10711605
682 Ga0157369_10097053
683 Ga0157374_10064903
684 Ga0157374_10101577
685 Ga0157374_10361113
686 Ga0157374_11098417
687 Ga0157378_10010236
688 Ga0157378_10013577
689 Ga0157378_10152986
690 Ga0157378_10192612
691 Ga0157378_10670275
692 Ga0157378_11107561
693 Ga0163162_10001047
694 Ga0163162_10001153
695 Ga0163162_10618017
696 Ga0163162_10797110
697 Ga0163162_10970696
698 Ga0157372_10035741
699 Ga0157372_10870077
700 Ga0157375_10001470
701 Ga0157375_10019913
702 Ga0157375_10110263
703 Ga0157375_10128624
704 Ga0157375_10282476
705 Ga0157375_11143509
706 Ga0157375_11244895
707 Ga0157375_11464477
708 Ga0163163_10178311
709 Ga0163163_10228844
710 Ga0163163_10243888
711 Ga0163163_10277654
712 Ga0163163_11791181
713 Ga0157380_10067892
714 Ga0157380_10082516
715 Ga0157380_10640876
716 Ga0157377_10107275
717 Ga0157377_10154640
718 Ga0157377_10341271
719 Ga0157379_10014266
720 Ga0157379_10191725
721 Ga0157379_10543697
722 Ga0157376_10000499
723 Ga0157376_10144133
724 Ga0157376_10213924
725 Ga0157376_11200169
726 Ga0157376_11700387
727 Ga0163161_10000627
728 Ga0163161_10019245
729 Ga0163161_10067029
730 Ga0163161_10227843
731 Ga0163161_10694229
732 Ga0163161_10777973
733 Ga0163161_11523923
734 Ga0207666_1023504
735 Ga0207697_10218464
736 Ga0207656_10224960
737 Ga0207653_10058011
738 Ga0207682_10195130
739 Ga0207642_10019317
740 Ga0207642_10462291
741 Ga0207710_10000281
742 Ga0207688_10283855
743 Ga0207680_10059781
744 Ga0207647_10502846
745 Ga0207685_10662144
746 Ga0207645_10759166
747 Ga0207643_10277703
748 Ga0207643_10292302
749 Ga0207705_10005209
750 Ga0207705_10502455
751 Ga0207654_10306460
752 Ga0207695_10000685
753 Ga0207695_10417010
754 Ga0207671_10016476
755 Ga0207671_10084733
756 Ga0207671_11039555
757 Ga0207662_10027454
758 Ga0207662_10035006
759 Ga0207657_10217117
760 Ga0207657_10236153
761 Ga0207681_10492119
762 Ga0207659_10202476
763 Ga0207659_10224529
764 Ga0207687_10324099
765 Ga0207687_10788519
766 Ga0207687_10873971
767 Ga0207644_10016691
768 Ga0207644_10027330
769 Ga0207644_10029178
770 Ga0207690_10288689
771 Ga0207706_11339134
772 Ga0207686_10000018
773 Ga0207686_10050821
774 Ga0207686_10076339
775 Ga0207686_10521713
776 Ga0207709_10000056
777 Ga0207709_10059759
778 Ga0207709_10171935
779 Ga0207709_10205784
780 Ga0207670_10695640
781 Ga0207670_10781323
782 Ga0207669_10324213
783 Ga0207669_10333480
784 Ga0207704_10230288
785 Ga0207704_10359608
786 Ga0207691_10007611
787 Ga0207691_10930671
788 Ga0207711_10023809
789 Ga0207711_10101179
790 Ga0207689_10042355
791 Ga0207689_10084901
792 Ga0207689_10247944
793 Ga0207679_10015360
794 Ga0207679_10140137
795 Ga0207667_10000014
796 Ga0207667_10010568
797 Ga0207667_10087498
798 Ga0207667_10394831
799 Ga0207651_10313768
800 Ga0207651_10594657
801 Ga0207651_11664069
802 Ga0207712_10170480
803 Ga0207712_10390459
804 Ga0207712_10554292
805 Ga0207712_10729340
806 Ga0207712_10801955
807 Ga0207712_11326704
808 Ga0207668_10175366
809 Ga0207640_11424886
810 Ga0207658_10137113
811 Ga0207658_10421898
812 Ga0207658_10475863
813 Ga0207703_10085755
814 Ga0207703_10313061
815 Ga0207703_10484819
816 Ga0207703_10570617
817 Ga0207703_10596877
818 Ga0207639_10005514
819 Ga0207639_10094615
820 Ga0207708_10005083
821 Ga0207708_10017604
822 Ga0207702_10000402
823 Ga0207641_10017117
824 Ga0207641_10233935
825 Ga0207641_10703682
826 Ga0207648_10071059
827 Ga0207648_10119769
828 Ga0207648_10246797
829 Ga0207648_10402494
830 Ga0207676_10035708
831 Ga0207676_10207706
832 Ga0207676_10352943
833 Ga0207676_10552278
834 Ga0207674_10174879
835 Ga0207674_10603563
836 Ga0207674_11218152
837 Ga0207675_100008372
838 Ga0207675_100340825
839 Ga0207675_101662016
840 Ga0207683_10022162
841 Ga0207683_10037470
842 Ga0207683_10240671
843 Ga0207698_10133513
844 Ga0207698_10253853
845 Ga0207698_10300551
846 Ga0207698_10727864
847 Ga0207698_10728534
848 Ga0209998_10120399
849 Ga0207428_10546160
850 Ga0268266_11588800
851 Ga0268265_10075692
852 Ga0268265_10286163
853 Ga0268265_10604904
854 Ga0268265_11484050
855 Ga0268264_10232778
856 Ga0268264_10321926
857 Ga0268264_10519760
858 Ga0268264_10630414
859 Ga0265338_10247924
860 Ga0307512_10119680
861 Ga0307513_10108227
862 Ga0307509_10196434
863 Ga0307408_100541740
864 Ga0307413_10000959
865 Ga0307413_10009362
866 Ga0307413_10347128
867 Ga0307410_10003028
868 Ga0307407_10056924
869 Ga0307412_10191030
870 Ga0307412_10342283
871 Ga0307409_100001622
872 Ga0307409_100683020
873 Ga0307416_100091333
874 Ga0307416_100102999
875 Ga0307416_100401350
876 Ga0307414_10031458
877 Ga0307414_10202811
878 Ga0307414_10468553
879 Ga0307414_10479242
880 Ga0307411_10000006
881 Ga0307411_10059869
882 Ga0307411_11211886
883 Ga0307415_100153014
884 Ga0307415_102337214
885 Ga0373932_0123151
886 Ga0373939_0267701
887 Ga0373961_0098534
888 Ga0373931_0303483
889 Ga0395899_0006559
890 Ga0395900_0217466
891 Ga0395898_0011579
892 Ga0436364_0434021
893 Ga0395901_0017211
894 Ga0451793_0702618
895 Ga0451853_2256311
896 Ga0453683_0744383
897 Ga0495638_0122160
898 Ga0495610_0129489
899 Ga0495630_0983986
900 Ga0495632_0154850
901 Ga0495645_0280136
902 Ga0495661_0001005
903 Ga0495636_0124637
904 Ga0495684_0125051
905 Ga0496100_0064140
906 Ga0496100_1024113
907 Ga0496101_0049862
908 Ga0496106_1067893
909 Ga0496109_0904390
910 Ga0496114_0067507
911 Ga0501308_013925
912 Ga0501296_007639
913 Ga0501298_028493
914 Ga0501072_0180517
915 Ga0501217_075623
916 Ga0501249_004212
917 Ga0501257_018127
918 Ga0501259_030965
919 Ga0501261_024319
920 Ga0501241_137120
921 Ga0501266_000008
922 nmdc:mga0k408_296502_c1
923 nmdc:mga05p37_363842_c1
924 nmdc:mga05p37_591915_c1
925 nmdc:mga08y16_316523_c1
926 nmdc:mga08y16_56566_c1
927 nmdc:mga0n895_967923_c1
928 nmdc:mga0rr50_183391_c1
929 nmdc:mga0rr50_566285_c1
930 nmdc:mga0rr50_651498_c1
931 Ga0500646_0028903
932 Ga0500583_0000007
933 Ga0500583_0008082
934 Ga0500651_0291183
935 Ga0500562_009333
936 Ga0500594_0019060
937 Ga0500652_050755
938 Ga0500559_0016004
939 Ga0500568_0000231
940 Ga0500568_0169163
941 Ga0500589_099953
942 Ga0500616_0002076
943 Ga0500622_0000010
944 Ga0500622_0007108
945 Ga0500587_011865
946 Ga0501084_0855955
947 2738728066
948 2740001765
949 2740006581
950 2919688138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

58

194

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9492 8 162
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.931 6 165
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9267 17 161
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9228 5 163
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.9153 5 160
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9492 8 162 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9251 17 161 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9251 6 164 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9235 8 160 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9228 5 163 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0C1G306-F1-model_v4 deleted 1.001 1 166
AF-A0A5C7FDR1-F1-model_v4 SRPBCC domain-containing protein 1.001 3 163
AF-A0A4V2MLS7-F1-model_v4 SRPBCC domain-containing protein 0.9979 1 111
AF-A0A1Z5SK56-F1-model_v4 ATPase 0.9965 3 160
AF-A0A0C1G306-F1-model_v4 deleted 0.9945 1 166

Map