F451394

General Info

Members Datasets Scaffolds Average Seq Length
475 232 950 158

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0060587|Ga0466972_0060587_19_594
Length 191
Sequence LCASDAEDARLPGQGGAVMVEGRGLGAVRTLAEDAVYVVKSPLSDPDLKTVAEALQGALVDLLDLSLMAKQIHWNIIGPRFRSIHLQLDEVVDTARQHSDTVAERASALGVPPDGRAGTVARSSGIGSVPQGWVKDTDAVGTLVSALGAVIARMRERVEVTAEADPVSQDIFIAVTADLEKHHWMFQAENG

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
26 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
30 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
43 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
52 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
53 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
54 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
55 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
56 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
57 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
60 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
61 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
62 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
63 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
64 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
65 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
66 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
67 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
70 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
199 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
200 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
203 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
204 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
205 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
206 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
207 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
213 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
214 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
215 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
216 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
221 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
227 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
228 2867369537 Streptomyces sp. Z26 Isolate Unclassified
229 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
230 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
231 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
232 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 2.32
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.47
Nodule 0.21
Rhizoplane 0.84
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0060587 3300044658 Bacteria 1815
2 JGI24735J21928_10054619 3300002067 Bacteria 1151
3 rootH2_10043623 3300003320 Bacteria 4120
4 rootL2_10265815 3300003322 Bacteria 1320
5 rootH1_10033745 3300003323 Bacteria 3491
6 JGI25160J50197_1029549 3300003354 Bacteria 1446
7 Ga0006562J51391_1080552 3300003578 Bacteria 2420
8 Ga0006562J51391_1080556 3300003578 Bacteria 1190
9 Ga0058861_11345383 3300004800 Bacteria 559
10 Ga0058860_11989380 3300004801 Bacteria 1262
11 Ga0068853_100359049 3300005539 Bacteria 1357
12 Ga0068854_100438964 3300005578 Bacteria 1088
13 Ga0075368_10093537 3300006042 Bacteria 1231
14 Ga0075363_100013892 3300006048 Bacteria 3919
15 Ga0075363_100125823 3300006048 Bacteria 1435
16 Ga0075367_10000581 3300006178 Bacteria 13993
17 Ga0075370_10027344 3300006353 Bacteria 3164
18 Ga0105238_10094267 3300009551 Bacteria 2981
19 Ga0105246_10097485 3300011119 Bacteria 2134
20 Ga0157372_10510752 3300013307 Bacteria 1401
21 Ga0182008_10003109 3300014497 Bacteria 10168
22 Ga0182007_10000210 3300015262 Bacteria 39149
23 Ga0182005_1024939 3300015265 Bacteria 1632
24 Ga0183367_1001 3300015688 Bacteria 1225545
25 Ga0183367_1019 3300015688 Bacteria 100516
26 Ga0197907_11443965 3300020069 Bacteria 553
27 Ga0206349_1916094 3300020075 Bacteria 558
28 Ga0206355_1236033 3300020076 Bacteria 893
29 Ga0206351_10042917 3300020077 Bacteria 678
30 Ga0206350_10361717 3300020080 Bacteria 1235
31 Ga0224712_10099613 3300022467 Bacteria 1230
32 Ga0224712_10340307 3300022467 Bacteria 707
33 Ga0209758_1003914 3300025297 Bacteria 12992
34 Ga0207426_1001178 3300025302 Bacteria 23387
35 Ga0207426_1022704 3300025302 Bacteria 2150
36 Ga0207426_1029250 3300025302 Bacteria 1819
37 Ga0207426_1061721 3300025302 Bacteria 1075
38 Ga0207647_10195403 3300025904 Bacteria 1171
39 Ga0207652_10061678 3300025921 Bacteria 3238
40 Ga0207711_11142562 3300025941 Bacteria 720
41 Ga0207661_10238693 3300025944 Bacteria 1612
42 Ga0207640_10624822 3300025981 Bacteria 915
43 Ga0209371_1023559 3300027312 Bacteria 1448
44 Ga0307517_10004476 3300028786 Bacteria 21448
45 Ga0268256_1032081 3300030500 Bacteria 1255
46 Ga0307512_10009194 3300030522 Bacteria 9549
47 Ga0307512_10043630 3300030522 Bacteria 3696
48 Ga0307513_10002713 3300031456 Bacteria 24368
49 Ga0307513_10476607 3300031456 Bacteria 968
50 Ga0307509_10260959 3300031507 Bacteria 1508
51 Ga0307508_10005933 3300031616 Bacteria 11527
52 Ga0307508_10116246 3300031616 Bacteria 2276
53 Ga0307514_10061802 3300031649 Bacteria 2851
54 Ga0307514_10077464 3300031649 Bacteria 2473
55 Ga0307514_10088685 3300031649 Bacteria 2262
56 Ga0307514_10223036 3300031649 Bacteria 1153
57 Ga0307516_10124172 3300031730 Bacteria 2368
58 Ga0307516_10394792 3300031730 Bacteria 1043
59 Ga0307518_10169319 3300031838 Bacteria 1491
60 Ga0307518_10213938 3300031838 Bacteria 1266
61 Ga0307411_10332176 3300032005 Bacteria 1232
62 Ga0307510_10035289 3300033180 Bacteria 5588
63 Ga0395899_0820502 3300037312 Bacteria 573
64 Ga0395900_0064559 3300037418 Bacteria 3762
65 Ga0395900_1054240 3300037418 Bacteria 731
66 Ga0395900_1828955 3300037418 Bacteria 518
67 Ga0395898_0165770 3300037466 Bacteria 2113
68 Ga0439439_0021458 3300041406 Bacteria 1609
69 Ga0439439_0057143 3300041406 Bacteria 1032
70 Ga0439439_0117484 3300041406 Bacteria 740
71 Ga0439466_0214196 3300041411 Bacteria 585
72 Ga0451797_0586783 3300041453 Bacteria 716
73 Ga0451797_1231293 3300041453 Bacteria 590
74 Ga0451833_0418675 3300041491 Bacteria 1270
75 Ga0451853_0074895 3300041512 Bacteria 1148
76 Ga0451853_0076768 3300041512 Bacteria 3380
77 Ga0439433_0012431 3300041999 Bacteria 1866
78 Ga0439433_0086856 3300041999 Bacteria 765
79 Ga0439448_0002017 3300042005 Bacteria 5427
80 Ga0439448_0027354 3300042005 Bacteria 1797
81 Ga0439449_0007320 3300042007 Bacteria 4193
82 Ga0439449_0131231 3300042007 Bacteria 931
83 Ga0439454_017906 3300042011 Bacteria 1016
84 Ga0439455_0000112 3300042012 Bacteria 8240
85 Ga0439455_0000533 3300042012 Bacteria 5339
86 Ga0439457_001999 3300042014 Bacteria 5989
87 Ga0439457_007443 3300042014 Bacteria 2626
88 Ga0439457_098239 3300042014 Bacteria 681
89 Ga0439457_121461 3300042014 Bacteria 617
90 Ga0439462_0056418 3300042015 Bacteria 1060
91 Ga0450894_000023 3300042131 Bacteria 21730
92 Ga0450896_005348 3300042133 Bacteria 1752
93 Ga0450896_009911 3300042133 Bacteria 1332
94 Ga0450899_001436 3300042135 Bacteria 2659
95 Ga0450899_001637 3300042135 Bacteria 2480
96 Ga0450903_000018 3300042138 Bacteria 32017
97 Ga0450903_000028 3300042138 Bacteria 29850
98 Ga0450906_018390 3300042145 Bacteria 1254
99 Ga0450906_049134 3300042145 Bacteria 744
100 Ga0450906_061119 3300042145 Bacteria 670
101 Ga0439458_0004585 3300042157 Bacteria 3161
102 Ga0439458_0005682 3300042157 Bacteria 2795
103 Ga0450908_006742 3300042184 Bacteria 2174
104 Ga0450908_033217 3300042184 Bacteria 894
105 Ga0450909_038151 3300042185 Bacteria 737
106 Ga0466969_0003894 3300044656 Bacteria 7922
107 Ga0466969_0046812 3300044656 Bacteria 2143
108 Ga0466972_0003530 3300044658 Bacteria 7763
109 Ga0466972_0129316 3300044658 Bacteria 1189
110 Ga0466972_0283371 3300044658 Bacteria 774
111 Ga0466972_0315449 3300044658 Bacteria 730
112 Ga0466972_0359179 3300044658 Bacteria 681
113 Ga0466965_0017003 3300044683 Bacteria 3470
114 Ga0466965_0147730 3300044683 Bacteria 1227
115 Ga0466966_0000327 3300044684 Bacteria 30788
116 Ga0466966_0053968 3300044684 Bacteria 2548
117 Ga0466966_0226892 3300044684 Bacteria 1127
118 Ga0466961_0000836 3300044693 Bacteria 19234
119 Ga0466961_0005113 3300044693 Bacteria 8257
120 Ga0466961_0041471 3300044693 Bacteria 2951
121 Ga0466963_0007639 3300044694 Bacteria 6455
122 Ga0466963_0039728 3300044694 Bacteria 3082
123 Ga0466963_0732603 3300044694 Bacteria 697
124 Ga0466964_0001230 3300044706 Bacteria 8690
125 Ga0466971_0000392 3300044719 Bacteria 16939
126 Ga0466971_0004812 3300044719 Bacteria 5846
127 Ga0466971_0060510 3300044719 Bacteria 1712
128 Ga0466971_0126657 3300044719 Bacteria 1184
129 Ga0466970_0000256 3300044765 Bacteria 26142
130 Ga0466970_0122155 3300044765 Bacteria 1427
131 Ga0466957_0000809 3300044842 Bacteria 15950
132 Ga0466957_0669383 3300044842 Bacteria 731
133 Ga0466960_0002070 3300044901 Bacteria 7461
134 Ga0466960_0012345 3300044901 Bacteria 3602
135 Ga0466960_0118378 3300044901 Bacteria 1385
136 Ga0466960_0150156 3300044901 Bacteria 1244
137 Ga0466959_0013094 3300045049 Bacteria 6006
138 Ga0466959_0016967 3300045049 Bacteria 5329
139 Ga0466958_0000126 3300045836 Bacteria 25142
140 Ga0466958_0211520 3300045836 Bacteria 1236
141 Ga0466958_0805049 3300045836 Bacteria 613
142 Ga0466967_0004337 3300045976 Bacteria 9540
143 Ga0466967_0025529 3300045976 Bacteria 4875
144 Ga0466967_0124301 3300045976 Bacteria 2388
145 Ga0466967_0574332 3300045976 Bacteria 1111
146 Ga0466967_1772351 3300045976 Bacteria 615
147 Ga0495627_054734 3300046453 Bacteria 1192
148 Ga0495627_151869 3300046453 Bacteria 646
149 Ga0495592_0012495 3300046454 Bacteria 6452
150 Ga0495603_0006158 3300046455 Bacteria 7170
151 Ga0495603_0011467 3300046455 Bacteria 5365
152 Ga0495603_0025388 3300046455 Bacteria 3583
153 Ga0495629_0032663 3300046459 Bacteria 3684
154 Ga0495629_0194360 3300046459 Bacteria 1403
155 Ga0495629_0265507 3300046459 Bacteria 1179
156 Ga0495638_0042152 3300046460 Bacteria 2884
157 Ga0495651_0052083 3300046462 Bacteria 3154
158 Ga0495651_0123106 3300046462 Bacteria 1902
159 Ga0495580_0321711 3300046472 Bacteria 1051
160 Ga0495582_0246144 3300046473 Bacteria 1025
161 Ga0495605_0076779 3300046474 Bacteria 1568
162 Ga0495605_0164318 3300046474 Bacteria 984
163 Ga0495639_0024417 3300046475 Bacteria 2661
164 Ga0495662_0011138 3300046476 Bacteria 4394
165 Ga0495662_0014903 3300046476 Bacteria 3777
166 Ga0495662_0149198 3300046476 Bacteria 1151
167 Ga0495664_0284176 3300046477 Bacteria 999
168 Ga0495664_0468691 3300046477 Bacteria 753
169 Ga0495584_0057884 3300046491 Bacteria 1950
170 Ga0495585_0032898 3300046492 Bacteria 2937
171 Ga0495585_0046875 3300046492 Bacteria 2409
172 Ga0495585_0241167 3300046492 Bacteria 905
173 Ga0495594_0016378 3300046499 Bacteria 3905
174 Ga0495594_0068323 3300046499 Bacteria 1973
175 Ga0495594_0125815 3300046499 Bacteria 1450
176 Ga0495596_0161016 3300046500 Bacteria 872
177 Ga0495607_0042896 3300046501 Bacteria 2678
178 Ga0495607_0199780 3300046501 Bacteria 990
179 Ga0495583_0017706 3300046506 Bacteria 3775
180 Ga0495583_0098068 3300046506 Bacteria 1253
181 Ga0495606_0066745 3300046507 Bacteria 2280
182 Ga0495606_0606012 3300046507 Bacteria 536
183 Ga0495608_0109919 3300046511 Bacteria 1772
184 Ga0495610_0120767 3300046512 Bacteria 1149
185 Ga0495616_0070938 3300046513 Bacteria 1685
186 Ga0495618_0122457 3300046514 Bacteria 1666
187 Ga0495618_0262816 3300046514 Bacteria 1080
188 Ga0495620_0025352 3300046515 Bacteria 2806
189 Ga0495620_0087102 3300046515 Bacteria 1256
190 Ga0495628_0029239 3300046516 Bacteria 4470
191 Ga0495628_0056152 3300046516 Bacteria 3100
192 Ga0495628_0349672 3300046516 Bacteria 1087
193 Ga0495631_0032940 3300046518 Bacteria 2331
194 Ga0495632_0397204 3300046519 Bacteria 602
195 Ga0495643_0002847 3300046522 Bacteria 13158
196 Ga0495643_0019362 3300046522 Bacteria 3938
197 Ga0495644_0400172 3300046523 Bacteria 543
198 Ga0495648_0201055 3300046524 Bacteria 997
199 Ga0495648_0392466 3300046524 Bacteria 622
200 Ga0495666_0006497 3300046526 Bacteria 5887
201 Ga0495642_0206783 3300046528 Bacteria 856
202 Ga0495652_0130175 3300046529 Bacteria 1993
203 Ga0495654_0250188 3300046530 Bacteria 738
204 Ga0495640_0024380 3300046533 Bacteria 4402
205 Ga0495640_0029959 3300046533 Bacteria 3900
206 Ga0495640_0051144 3300046533 Bacteria 2841
207 Ga0495587_0166922 3300046536 Bacteria 1251
208 Ga0495609_0004538 3300046538 Bacteria 7549
209 Ga0495597_0034840 3300046542 Bacteria 2273
210 Ga0495597_0161700 3300046542 Bacteria 913
211 Ga0495645_0029459 3300046543 Bacteria 3993
212 Ga0495622_0084643 3300046557 Bacteria 1458
213 Ga0495622_0184704 3300046557 Bacteria 934
214 Ga0495633_0007379 3300046558 Bacteria 6332
215 Ga0495633_0044251 3300046558 Bacteria 2110
216 Ga0495667_0519354 3300046559 Bacteria 745
217 Ga0495656_0243612 3300046615 Bacteria 906
218 Ga0495668_0009753 3300046616 Bacteria 5864
219 Ga0495668_0259901 3300046616 Bacteria 950
220 Ga0495634_0012846 3300046642 Bacteria 6061
221 Ga0495634_0124876 3300046642 Bacteria 1645
222 Ga0495611_0041924 3300046648 Bacteria 2042
223 Ga0495611_0176548 3300046648 Bacteria 998
224 Ga0495625_0091732 3300046660 Bacteria 2099
225 Ga0495625_0744907 3300046660 Bacteria 575
226 Ga0495635_0116968 3300046663 Bacteria 1819
227 Ga0495635_0435233 3300046663 Bacteria 868
228 Ga0495661_0169170 3300046665 Bacteria 1167
229 Ga0495588_0055612 3300046674 Bacteria 2042
230 Ga0495588_0149955 3300046674 Bacteria 1232
231 Ga0495588_0439660 3300046674 Bacteria 684
232 Ga0495657_0074225 3300046675 Bacteria 2213
233 Ga0495623_0202161 3300046679 Bacteria 1142
234 Ga0495613_0071219 3300046689 Bacteria 2534
235 Ga0495613_0095100 3300046689 Bacteria 2155
236 Ga0495613_0261110 3300046689 Bacteria 1206
237 Ga0495613_0653508 3300046689 Bacteria 695
238 Ga0495624_0181551 3300046690 Bacteria 1282
239 Ga0495624_0284284 3300046690 Bacteria 998
240 Ga0495624_0400084 3300046690 Bacteria 824
241 Ga0495670_0034446 3300046691 Bacteria 2522
242 Ga0495670_0385893 3300046691 Bacteria 756
243 Ga0495649_0049062 3300046694 Bacteria 2293
244 Ga0495649_0094034 3300046694 Bacteria 1596
245 Ga0495649_0163899 3300046694 Bacteria 1165
246 Ga0495649_0239934 3300046694 Bacteria 933
247 Ga0495589_0146567 3300046794 Bacteria 1128
248 Ga0495589_0165873 3300046794 Bacteria 1051
249 Ga0495589_0223722 3300046794 Bacteria 883
250 Ga0495600_0093687 3300046809 Bacteria 1958
251 Ga0495600_0106830 3300046809 Bacteria 1823
252 Ga0495660_0020572 3300046810 Bacteria 3783
253 Ga0495604_0053191 3300047317 Bacteria 3131
254 Ga0495604_0103961 3300047317 Bacteria 2082
255 Ga0495636_0006090 3300047318 Bacteria 4735
256 Ga0495636_0045558 3300047318 Bacteria 1828
257 Ga0495636_0167302 3300047318 Bacteria 993
258 Ga0495636_0218868 3300047318 Bacteria 874
259 Ga0495636_0283993 3300047318 Bacteria 771
260 Ga0495636_0449742 3300047318 Bacteria 618
261 Ga0495674_0182242 3300047319 Bacteria 1748
262 Ga0495672_0110830 3300047320 Bacteria 1473
263 Ga0495676_0003653 3300047321 Bacteria 13953
264 Ga0495676_0059596 3300047321 Bacteria 2996
265 Ga0495676_0298684 3300047321 Bacteria 1086
266 Ga0495680_0018338 3300047322 Bacteria 5944
267 Ga0495683_0087567 3300047323 Bacteria 1512
268 Ga0495687_005104 3300047443 Bacteria 8510
269 Ga0495687_007279 3300047443 Bacteria 6559
270 Ga0495687_077163 3300047443 Bacteria 1316
271 Ga0495687_084636 3300047443 Bacteria 1232
272 Ga0495687_200733 3300047443 Bacteria 633
273 Ga0495675_0142420 3300047444 Bacteria 1485
274 Ga0495675_0306790 3300047444 Bacteria 941
275 Ga0495675_0335405 3300047444 Bacteria 892
276 Ga0495677_0096209 3300047445 Bacteria 1118
277 Ga0495677_0234645 3300047445 Bacteria 716
278 Ga0495679_056861 3300047446 Bacteria 1158
279 Ga0495685_000747 3300047447 Bacteria 9975
280 Ga0495685_017678 3300047447 Bacteria 2443
281 Ga0495685_058862 3300047447 Bacteria 1296
282 Ga0495685_058871 3300047447 Bacteria 1296
283 Ga0495673_0228601 3300047469 Bacteria 686
284 Ga0495681_0001605 3300047470 Bacteria 16822
285 Ga0495681_0158271 3300047470 Bacteria 945
286 Ga0495684_0358906 3300047471 Bacteria 1033
287 Ga0495686_0245458 3300047472 Bacteria 1008
288 Ga0495614_0274842 3300048089 Bacteria 775
289 Ga0495626_0007359 3300048091 Bacteria 6132
290 Ga0495626_0191827 3300048091 Bacteria 842
291 Ga0496108_0090828 3300048911 Bacteria 2596
292 Ga0496110_1612331 3300048913 Bacteria 559
293 Ga0495678_234330 3300049459 Bacteria 551
294 Ga0501031_0007893 3300049568 Bacteria 6927
295 Ga0501031_0358297 3300049568 Bacteria 944
296 Ga0501031_0408082 3300049568 Bacteria 878
297 Ga0501031_0650446 3300049568 Bacteria 677
298 Ga0501032_0002476 3300049569 Bacteria 14418
299 Ga0501032_0010709 3300049569 Bacteria 6599
300 Ga0501032_0029964 3300049569 Bacteria 3732
301 Ga0501032_0095779 3300049569 Bacteria 1967
302 Ga0501032_0464268 3300049569 Bacteria 810
303 Ga0501033_0011219 3300049570 Bacteria 6862
304 Ga0501033_0049043 3300049570 Bacteria 3135
305 Ga0501033_0058759 3300049570 Bacteria 2840
306 Ga0501033_0079785 3300049570 Bacteria 2401
307 Ga0501033_0204471 3300049570 Bacteria 1409
308 Ga0501034_0001799 3300049571 Bacteria 27362
309 Ga0501034_0005069 3300049571 Bacteria 14469
310 Ga0501034_0017002 3300049571 Bacteria 7456
311 Ga0501034_0029376 3300049571 Bacteria 5587
312 Ga0501034_0035382 3300049571 Bacteria 5063
313 Ga0501034_0083387 3300049571 Bacteria 3198
314 Ga0501034_0432095 3300049571 Bacteria 1236
315 Ga0501034_0746018 3300049571 Bacteria 875
316 Ga0501036_0001032 3300049572 Bacteria 21031
317 Ga0501036_0002121 3300049572 Bacteria 15482
318 Ga0501036_0012118 3300049572 Bacteria 7147
319 Ga0501036_0033952 3300049572 Bacteria 4315
320 Ga0501036_0036927 3300049572 Bacteria 4133
321 Ga0501036_0140758 3300049572 Bacteria 2036
322 Ga0501036_0330114 3300049572 Bacteria 1274
323 Ga0501036_1279298 3300049572 Bacteria 596
324 Ga0501037_0002582 3300049573 Bacteria 13082
325 Ga0501037_0003989 3300049573 Bacteria 10701
326 Ga0501037_0004985 3300049573 Bacteria 9653
327 Ga0501037_0164155 3300049573 Bacteria 1582
328 Ga0501037_0171194 3300049573 Bacteria 1543
329 Ga0501038_0009331 3300049574 Bacteria 8999
330 Ga0501038_0027101 3300049574 Bacteria 5100
331 Ga0501038_0028115 3300049574 Bacteria 4995
332 Ga0501038_0036249 3300049574 Bacteria 4330
333 Ga0501038_0053902 3300049574 Bacteria 3460
334 Ga0501038_0139229 3300049574 Bacteria 1987
335 Ga0501038_0238050 3300049574 Bacteria 1446
336 Ga0501039_0003392 3300049575 Bacteria 11910
337 Ga0501039_0017638 3300049575 Bacteria 5475
338 Ga0501039_0022252 3300049575 Bacteria 4866
339 Ga0501039_0058372 3300049575 Bacteria 2989
340 Ga0501039_0092206 3300049575 Bacteria 2361
341 Ga0501040_0010279 3300049576 Bacteria 6120
342 Ga0501041_0001503 3300049577 Bacteria 12931
343 Ga0501042_0005235 3300049578 Bacteria 8334
344 Ga0501042_0009389 3300049578 Bacteria 6518
345 Ga0501042_0010455 3300049578 Bacteria 6225
346 Ga0501043_0001820 3300049579 Bacteria 18305
347 Ga0501043_0003644 3300049579 Bacteria 12641
348 Ga0501043_0013307 3300049579 Bacteria 6433
349 Ga0501043_0070071 3300049579 Bacteria 2754
350 Ga0501043_0073964 3300049579 Bacteria 2676
351 Ga0501043_0075220 3300049579 Bacteria 2653
352 Ga0501043_0119156 3300049579 Bacteria 2070
353 Ga0501043_0540768 3300049579 Bacteria 866
354 Ga0501043_0819242 3300049579 Bacteria 672
355 Ga0501046_0040645 3300049580 Bacteria 3714
356 Ga0501046_0055434 3300049580 Bacteria 3114
357 Ga0501046_0061950 3300049580 Bacteria 2923
358 Ga0501047_0000074 3300049581 Bacteria 125728
359 Ga0501047_0000612 3300049581 Bacteria 37733
360 Ga0501047_0004363 3300049581 Bacteria 13310
361 Ga0501047_0022246 3300049581 Bacteria 6090
362 Ga0501047_0024184 3300049581 Bacteria 5833
363 Ga0501047_0031912 3300049581 Bacteria 5083
364 Ga0501047_0050978 3300049581 Bacteria 3997
365 Ga0501047_0058244 3300049581 Bacteria 3732
366 Ga0501047_0080350 3300049581 Bacteria 3134
367 Ga0501047_0089577 3300049581 Bacteria 2954
368 Ga0501047_0452694 3300049581 Bacteria 1113
369 Ga0501047_0689098 3300049581 Bacteria 840
370 Ga0501047_0732365 3300049581 Bacteria 805
371 Ga0501048_0006349 3300049582 Bacteria 8990
372 Ga0501048_0006577 3300049582 Bacteria 8834
373 Ga0501048_0031765 3300049582 Bacteria 3818
374 Ga0501048_0278428 3300049582 Bacteria 1189
375 Ga0501067_0150741 3300049583 Bacteria 1295
376 Ga0501068_0005307 3300049584 Bacteria 7040
377 Ga0501068_0628434 3300049584 Bacteria 700
378 Ga0501069_0038925 3300049585 Bacteria 2625
379 Ga0501070_0006363 3300049586 Bacteria 10051
380 Ga0501070_0016804 3300049586 Bacteria 6142
381 Ga0501070_0105928 3300049586 Bacteria 2324
382 Ga0501070_0132275 3300049586 Bacteria 2061
383 Ga0501070_0268715 3300049586 Bacteria 1393
384 Ga0501070_0407824 3300049586 Bacteria 1098
385 Ga0501070_0569858 3300049586 Unclassified 905
386 Ga0501071_0004954 3300049587 Bacteria 8506
387 Ga0501072_0052767 3300049588 Bacteria 3201
388 Ga0501073_0071839 3300049589 Bacteria 2410
389 Ga0501073_0718271 3300049589 Bacteria 689
390 Ga0501073_1102902 3300049589 Bacteria 545
391 Ga0501074_0000518 3300049590 Bacteria 23708
392 Ga0501074_0056977 3300049590 Bacteria 2816
393 Ga0501076_0004399 3300049592 Bacteria 10015
394 Ga0501079_0092824 3300049741 Bacteria 2338
395 Ga0501080_0078507 3300049742 Bacteria 3070
396 Ga0501080_0095600 3300049742 Bacteria 2759
397 Ga0501080_0342414 3300049742 Bacteria 1351
398 Ga0501083_0063004 3300049744 Bacteria 2473
399 Ga0501035_0001339 3300049822 Bacteria 25392
400 Ga0501035_0007127 3300049822 Bacteria 10451
401 Ga0501035_0020225 3300049822 Bacteria 6113
402 Ga0501035_0023808 3300049822 Bacteria 5618
403 Ga0501035_0128940 3300049822 Bacteria 2206
404 Ga0501035_0203781 3300049822 Bacteria 1695
405 Ga0501035_0292640 3300049822 Bacteria 1374
406 Ga0501035_0343770 3300049822 Bacteria 1249
407 Ga0501035_0551412 3300049822 Bacteria 944
408 Ga0501035_0813634 3300049822 Bacteria 746
409 Ga0501044_0001473 3300049823 Bacteria 27597
410 Ga0501044_0013710 3300049823 Bacteria 8761
411 Ga0501044_0026456 3300049823 Bacteria 6139
412 Ga0501044_0046932 3300049823 Bacteria 4469
413 Ga0501044_0059920 3300049823 Bacteria 3899
414 Ga0501044_0067940 3300049823 Bacteria 3631
415 Ga0501044_0238396 3300049823 Bacteria 1763
416 Ga0501044_0286683 3300049823 Bacteria 1579
417 Ga0501044_0363243 3300049823 Bacteria 1365
418 Ga0501044_0472659 3300049823 Bacteria 1157
419 Ga0501044_0717574 3300049823 Bacteria 884
420 Ga0501044_0730659 3300049823 Bacteria 873
421 Ga0501045_0017023 3300049824 Bacteria 5162
422 Ga0501045_0080596 3300049824 Bacteria 2400
423 Ga0501045_0122600 3300049824 Bacteria 1930
424 Ga0501045_0155144 3300049824 Bacteria 1704
425 Ga0501045_0176238 3300049824 Bacteria 1593
426 nmdc:mga03n38_12313_c1 3300050490 Bacteria 3214
427 nmdc:mga03n38_13879_c1 3300050490 Bacteria 3073
428 nmdc:mga03n38_203569_c1 3300050490 Bacteria 1025
429 nmdc:mga03n38_7795_c1 3300050490 Bacteria 3802
430 nmdc:mga06z11_728_c1 3300050494 Bacteria 12021
431 nmdc:mga04h51_9852_c1 3300050495 Bacteria 2606
432 nmdc:mga07m45_20721_c1 3300050496 Bacteria 3573
433 nmdc:mga07m45_64833_c1 3300050496 Bacteria 2073
434 Ga0495655_0046643 3300053083 Bacteria 1130
435 Ga0500578_0007037 3300053086 Bacteria 7450
436 Ga0500578_0350393 3300053086 Bacteria 863
437 Ga0500646_0154293 3300053090 Bacteria 762
438 Ga0500651_0248496 3300053093 Bacteria 1035
439 Ga0500654_080366 3300053099 Bacteria 1523
440 Ga0500660_191004 3300053100 Bacteria 721
441 Ga0500553_116085 3300053101 Bacteria 1114
442 Ga0500556_0263468 3300053104 Bacteria 677
443 Ga0500560_039132 3300053107 Bacteria 1478
444 Ga0500560_128780 3300053107 Bacteria 847
445 Ga0500569_003061 3300053109 Bacteria 3370
446 Ga0500594_0218004 3300053118 Bacteria 630
447 Ga0500628_013422 3300053129 Bacteria 1529
448 Ga0500652_013194 3300053131 Bacteria 2919
449 Ga0500658_0262685 3300053134 Bacteria 793
450 Ga0500561_0071047 3300053137 Bacteria 995
451 Ga0500573_0141384 3300053140 Bacteria 1325
452 Ga0500579_087810 3300053143 Bacteria 1698
453 Ga0500600_0001065 3300053149 Bacteria 13984
454 Ga0500600_0276275 3300053149 Bacteria 735
455 Ga0500603_202258 3300053150 Bacteria 630
456 Ga0500616_0021934 3300053153 Bacteria 3571
457 Ga0500633_0000261 3300053160 Bacteria 7647
458 Ga0500634_0000647 3300053161 Bacteria 11777
459 Ga0500656_018535 3300053732 Bacteria 842
460 Ga0500587_003667 3300053739 Bacteria 2134
461 Ga0501084_0047666 3300054114 Bacteria 3588
462 Ga0501084_0236523 3300054114 Bacteria 1542
463 Ga0501082_0004568 3300060353 Bacteria 12087
464 Ga0466962_0000069 3300061719 Bacteria 42565
465 Ga0466962_0006493 3300061719 Bacteria 5613
466 Ga0466962_0089102 3300061719 Bacteria 1478
467 Ga0466962_0111125 3300061719 Bacteria 1319
468 Ga0530510_0214932 3300061734 Bacteria 1428
469 2862284236 2862281513 Bacteria 9621493
470 2863409018 2863404153 Bacteria 9672205
471 2867373968 2867369537 Bacteria 6501581
472 2990067360 2990059506 Bacteria 9321252
473 2990091458 2990088156 Bacteria 6657676
474 3006426150 3006425503 Bacteria 6491253
475 8008563173 8008558824 Bacteria 10610750
476 Ga0466972_0060587
477 JGI24735J21928_10054619
478 rootH2_10043623
479 rootL2_10265815
480 rootH1_10033745
481 JGI25160J50197_1029549
482 Ga0006562J51391_1080552
483 Ga0006562J51391_1080556
484 Ga0058861_11345383
485 Ga0058860_11989380
486 Ga0068853_100359049
487 Ga0068854_100438964
488 Ga0075368_10093537
489 Ga0075363_100013892
490 Ga0075363_100125823
491 Ga0075367_10000581
492 Ga0075370_10027344
493 Ga0105238_10094267
494 Ga0105246_10097485
495 Ga0157372_10510752
496 Ga0182008_10003109
497 Ga0182007_10000210
498 Ga0182005_1024939
499 Ga0183367_1001
500 Ga0183367_1019
501 Ga0197907_11443965
502 Ga0206349_1916094
503 Ga0206355_1236033
504 Ga0206351_10042917
505 Ga0206350_10361717
506 Ga0224712_10099613
507 Ga0224712_10340307
508 Ga0209758_1003914
509 Ga0207426_1001178
510 Ga0207426_1022704
511 Ga0207426_1029250
512 Ga0207426_1061721
513 Ga0207647_10195403
514 Ga0207652_10061678
515 Ga0207711_11142562
516 Ga0207661_10238693
517 Ga0207640_10624822
518 Ga0209371_1023559
519 Ga0307517_10004476
520 Ga0268256_1032081
521 Ga0307512_10009194
522 Ga0307512_10043630
523 Ga0307513_10002713
524 Ga0307513_10476607
525 Ga0307509_10260959
526 Ga0307508_10005933
527 Ga0307508_10116246
528 Ga0307514_10061802
529 Ga0307514_10077464
530 Ga0307514_10088685
531 Ga0307514_10223036
532 Ga0307516_10124172
533 Ga0307516_10394792
534 Ga0307518_10169319
535 Ga0307518_10213938
536 Ga0307411_10332176
537 Ga0307510_10035289
538 Ga0395899_0820502
539 Ga0395900_0064559
540 Ga0395900_1054240
541 Ga0395900_1828955
542 Ga0395898_0165770
543 Ga0439439_0021458
544 Ga0439439_0057143
545 Ga0439439_0117484
546 Ga0439466_0214196
547 Ga0451797_0586783
548 Ga0451797_1231293
549 Ga0451833_0418675
550 Ga0451853_0074895
551 Ga0451853_0076768
552 Ga0439433_0012431
553 Ga0439433_0086856
554 Ga0439448_0002017
555 Ga0439448_0027354
556 Ga0439449_0007320
557 Ga0439449_0131231
558 Ga0439454_017906
559 Ga0439455_0000112
560 Ga0439455_0000533
561 Ga0439457_001999
562 Ga0439457_007443
563 Ga0439457_098239
564 Ga0439457_121461
565 Ga0439462_0056418
566 Ga0450894_000023
567 Ga0450896_005348
568 Ga0450896_009911
569 Ga0450899_001436
570 Ga0450899_001637
571 Ga0450903_000018
572 Ga0450903_000028
573 Ga0450906_018390
574 Ga0450906_049134
575 Ga0450906_061119
576 Ga0439458_0004585
577 Ga0439458_0005682
578 Ga0450908_006742
579 Ga0450908_033217
580 Ga0450909_038151
581 Ga0466969_0003894
582 Ga0466969_0046812
583 Ga0466972_0003530
584 Ga0466972_0129316
585 Ga0466972_0283371
586 Ga0466972_0315449
587 Ga0466972_0359179
588 Ga0466965_0017003
589 Ga0466965_0147730
590 Ga0466966_0000327
591 Ga0466966_0053968
592 Ga0466966_0226892
593 Ga0466961_0000836
594 Ga0466961_0005113
595 Ga0466961_0041471
596 Ga0466963_0007639
597 Ga0466963_0039728
598 Ga0466963_0732603
599 Ga0466964_0001230
600 Ga0466971_0000392
601 Ga0466971_0004812
602 Ga0466971_0060510
603 Ga0466971_0126657
604 Ga0466970_0000256
605 Ga0466970_0122155
606 Ga0466957_0000809
607 Ga0466957_0669383
608 Ga0466960_0002070
609 Ga0466960_0012345
610 Ga0466960_0118378
611 Ga0466960_0150156
612 Ga0466959_0013094
613 Ga0466959_0016967
614 Ga0466958_0000126
615 Ga0466958_0211520
616 Ga0466958_0805049
617 Ga0466967_0004337
618 Ga0466967_0025529
619 Ga0466967_0124301
620 Ga0466967_0574332
621 Ga0466967_1772351
622 Ga0495627_054734
623 Ga0495627_151869
624 Ga0495592_0012495
625 Ga0495603_0006158
626 Ga0495603_0011467
627 Ga0495603_0025388
628 Ga0495629_0032663
629 Ga0495629_0194360
630 Ga0495629_0265507
631 Ga0495638_0042152
632 Ga0495651_0052083
633 Ga0495651_0123106
634 Ga0495580_0321711
635 Ga0495582_0246144
636 Ga0495605_0076779
637 Ga0495605_0164318
638 Ga0495639_0024417
639 Ga0495662_0011138
640 Ga0495662_0014903
641 Ga0495662_0149198
642 Ga0495664_0284176
643 Ga0495664_0468691
644 Ga0495584_0057884
645 Ga0495585_0032898
646 Ga0495585_0046875
647 Ga0495585_0241167
648 Ga0495594_0016378
649 Ga0495594_0068323
650 Ga0495594_0125815
651 Ga0495596_0161016
652 Ga0495607_0042896
653 Ga0495607_0199780
654 Ga0495583_0017706
655 Ga0495583_0098068
656 Ga0495606_0066745
657 Ga0495606_0606012
658 Ga0495608_0109919
659 Ga0495610_0120767
660 Ga0495616_0070938
661 Ga0495618_0122457
662 Ga0495618_0262816
663 Ga0495620_0025352
664 Ga0495620_0087102
665 Ga0495628_0029239
666 Ga0495628_0056152
667 Ga0495628_0349672
668 Ga0495631_0032940
669 Ga0495632_0397204
670 Ga0495643_0002847
671 Ga0495643_0019362
672 Ga0495644_0400172
673 Ga0495648_0201055
674 Ga0495648_0392466
675 Ga0495666_0006497
676 Ga0495642_0206783
677 Ga0495652_0130175
678 Ga0495654_0250188
679 Ga0495640_0024380
680 Ga0495640_0029959
681 Ga0495640_0051144
682 Ga0495587_0166922
683 Ga0495609_0004538
684 Ga0495597_0034840
685 Ga0495597_0161700
686 Ga0495645_0029459
687 Ga0495622_0084643
688 Ga0495622_0184704
689 Ga0495633_0007379
690 Ga0495633_0044251
691 Ga0495667_0519354
692 Ga0495656_0243612
693 Ga0495668_0009753
694 Ga0495668_0259901
695 Ga0495634_0012846
696 Ga0495634_0124876
697 Ga0495611_0041924
698 Ga0495611_0176548
699 Ga0495625_0091732
700 Ga0495625_0744907
701 Ga0495635_0116968
702 Ga0495635_0435233
703 Ga0495661_0169170
704 Ga0495588_0055612
705 Ga0495588_0149955
706 Ga0495588_0439660
707 Ga0495657_0074225
708 Ga0495623_0202161
709 Ga0495613_0071219
710 Ga0495613_0095100
711 Ga0495613_0261110
712 Ga0495613_0653508
713 Ga0495624_0181551
714 Ga0495624_0284284
715 Ga0495624_0400084
716 Ga0495670_0034446
717 Ga0495670_0385893
718 Ga0495649_0049062
719 Ga0495649_0094034
720 Ga0495649_0163899
721 Ga0495649_0239934
722 Ga0495589_0146567
723 Ga0495589_0165873
724 Ga0495589_0223722
725 Ga0495600_0093687
726 Ga0495600_0106830
727 Ga0495660_0020572
728 Ga0495604_0053191
729 Ga0495604_0103961
730 Ga0495636_0006090
731 Ga0495636_0045558
732 Ga0495636_0167302
733 Ga0495636_0218868
734 Ga0495636_0283993
735 Ga0495636_0449742
736 Ga0495674_0182242
737 Ga0495672_0110830
738 Ga0495676_0003653
739 Ga0495676_0059596
740 Ga0495676_0298684
741 Ga0495680_0018338
742 Ga0495683_0087567
743 Ga0495687_005104
744 Ga0495687_007279
745 Ga0495687_077163
746 Ga0495687_084636
747 Ga0495687_200733
748 Ga0495675_0142420
749 Ga0495675_0306790
750 Ga0495675_0335405
751 Ga0495677_0096209
752 Ga0495677_0234645
753 Ga0495679_056861
754 Ga0495685_000747
755 Ga0495685_017678
756 Ga0495685_058862
757 Ga0495685_058871
758 Ga0495673_0228601
759 Ga0495681_0001605
760 Ga0495681_0158271
761 Ga0495684_0358906
762 Ga0495686_0245458
763 Ga0495614_0274842
764 Ga0495626_0007359
765 Ga0495626_0191827
766 Ga0496108_0090828
767 Ga0496110_1612331
768 Ga0495678_234330
769 Ga0501031_0007893
770 Ga0501031_0358297
771 Ga0501031_0408082
772 Ga0501031_0650446
773 Ga0501032_0002476
774 Ga0501032_0010709
775 Ga0501032_0029964
776 Ga0501032_0095779
777 Ga0501032_0464268
778 Ga0501033_0011219
779 Ga0501033_0049043
780 Ga0501033_0058759
781 Ga0501033_0079785
782 Ga0501033_0204471
783 Ga0501034_0001799
784 Ga0501034_0005069
785 Ga0501034_0017002
786 Ga0501034_0029376
787 Ga0501034_0035382
788 Ga0501034_0083387
789 Ga0501034_0432095
790 Ga0501034_0746018
791 Ga0501036_0001032
792 Ga0501036_0002121
793 Ga0501036_0012118
794 Ga0501036_0033952
795 Ga0501036_0036927
796 Ga0501036_0140758
797 Ga0501036_0330114
798 Ga0501036_1279298
799 Ga0501037_0002582
800 Ga0501037_0003989
801 Ga0501037_0004985
802 Ga0501037_0164155
803 Ga0501037_0171194
804 Ga0501038_0009331
805 Ga0501038_0027101
806 Ga0501038_0028115
807 Ga0501038_0036249
808 Ga0501038_0053902
809 Ga0501038_0139229
810 Ga0501038_0238050
811 Ga0501039_0003392
812 Ga0501039_0017638
813 Ga0501039_0022252
814 Ga0501039_0058372
815 Ga0501039_0092206
816 Ga0501040_0010279
817 Ga0501041_0001503
818 Ga0501042_0005235
819 Ga0501042_0009389
820 Ga0501042_0010455
821 Ga0501043_0001820
822 Ga0501043_0003644
823 Ga0501043_0013307
824 Ga0501043_0070071
825 Ga0501043_0073964
826 Ga0501043_0075220
827 Ga0501043_0119156
828 Ga0501043_0540768
829 Ga0501043_0819242
830 Ga0501046_0040645
831 Ga0501046_0055434
832 Ga0501046_0061950
833 Ga0501047_0000074
834 Ga0501047_0000612
835 Ga0501047_0004363
836 Ga0501047_0022246
837 Ga0501047_0024184
838 Ga0501047_0031912
839 Ga0501047_0050978
840 Ga0501047_0058244
841 Ga0501047_0080350
842 Ga0501047_0089577
843 Ga0501047_0452694
844 Ga0501047_0689098
845 Ga0501047_0732365
846 Ga0501048_0006349
847 Ga0501048_0006577
848 Ga0501048_0031765
849 Ga0501048_0278428
850 Ga0501067_0150741
851 Ga0501068_0005307
852 Ga0501068_0628434
853 Ga0501069_0038925
854 Ga0501070_0006363
855 Ga0501070_0016804
856 Ga0501070_0105928
857 Ga0501070_0132275
858 Ga0501070_0268715
859 Ga0501070_0407824
860 Ga0501070_0569858
861 Ga0501071_0004954
862 Ga0501072_0052767
863 Ga0501073_0071839
864 Ga0501073_0718271
865 Ga0501073_1102902
866 Ga0501074_0000518
867 Ga0501074_0056977
868 Ga0501076_0004399
869 Ga0501079_0092824
870 Ga0501080_0078507
871 Ga0501080_0095600
872 Ga0501080_0342414
873 Ga0501083_0063004
874 Ga0501035_0001339
875 Ga0501035_0007127
876 Ga0501035_0020225
877 Ga0501035_0023808
878 Ga0501035_0128940
879 Ga0501035_0203781
880 Ga0501035_0292640
881 Ga0501035_0343770
882 Ga0501035_0551412
883 Ga0501035_0813634
884 Ga0501044_0001473
885 Ga0501044_0013710
886 Ga0501044_0026456
887 Ga0501044_0046932
888 Ga0501044_0059920
889 Ga0501044_0067940
890 Ga0501044_0238396
891 Ga0501044_0286683
892 Ga0501044_0363243
893 Ga0501044_0472659
894 Ga0501044_0717574
895 Ga0501044_0730659
896 Ga0501045_0017023
897 Ga0501045_0080596
898 Ga0501045_0122600
899 Ga0501045_0155144
900 Ga0501045_0176238
901 nmdc:mga03n38_12313_c1
902 nmdc:mga03n38_13879_c1
903 nmdc:mga03n38_203569_c1
904 nmdc:mga03n38_7795_c1
905 nmdc:mga06z11_728_c1
906 nmdc:mga04h51_9852_c1
907 nmdc:mga07m45_20721_c1
908 nmdc:mga07m45_64833_c1
909 Ga0495655_0046643
910 Ga0500578_0007037
911 Ga0500578_0350393
912 Ga0500646_0154293
913 Ga0500651_0248496
914 Ga0500654_080366
915 Ga0500660_191004
916 Ga0500553_116085
917 Ga0500556_0263468
918 Ga0500560_039132
919 Ga0500560_128780
920 Ga0500569_003061
921 Ga0500594_0218004
922 Ga0500628_013422
923 Ga0500652_013194
924 Ga0500658_0262685
925 Ga0500561_0071047
926 Ga0500573_0141384
927 Ga0500579_087810
928 Ga0500600_0001065
929 Ga0500600_0276275
930 Ga0500603_202258
931 Ga0500616_0021934
932 Ga0500633_0000261
933 Ga0500634_0000647
934 Ga0500656_018535
935 Ga0500587_003667
936 Ga0501084_0047666
937 Ga0501084_0236523
938 Ga0501082_0004568
939 Ga0466962_0000069
940 Ga0466962_0006493
941 Ga0466962_0089102
942 Ga0466962_0111125
943 Ga0530510_0214932
944 2862284236
945 2863409018
946 2867373968
947 2990067360
948 2990091458
949 3006426150
950 8008563173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

52

190

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yw7-assembly1.cif.gz_G crystal structure of c-terminal deletion mutant of mycobacterium smegmatis dps 0.9555 17 153
2yjk-assembly1.cif.gz_B structure of dps from microbacterium arborescens in the high iron form 0.9543 5 154
2c2j-assembly1.cif.gz_A crystal structure of the dps92 from deinococcus radiodurans 0.9533 11 158
4m32-assembly1.cif.gz_D crystal structure of gated-pore mutant d138n of second dna-binding protein under starvation from mycobacterium smegmatis 0.9522 5 155
1vel-assembly1.cif.gz_D mycobacterium smegmatis dps tetragonal form 0.9519 7 154
ID Description Score Start End Superfamily
2c6rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9549 12 158 1.20.1260.10
2yw6A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9535 10 154 1.20.1260.10
2yw7F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.952 10 151 1.20.1260.10
1uvhA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9501 6 154 1.20.1260.10
2yw7A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9484 10 154 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3N2H9P2-F1-model_v4 Starvation-inducible DNA-binding protein 0.9938 8 154 GO:0003677
GO:0008199
GO:0016722
AF-A0A7Y5UDX1-F1-model_v4 deleted 0.9915 5 155
AF-A0A4S2RC44-F1-model_v4 Methyltransferase domain-containing protein 0.9904 1 160 GO:0008168
GO:0008199
GO:0009058
GO:0016722
GO:0032259
AF-A0A5C5RKE9-F1-model_v4 DNA starvation/stationary phase protection protein 0.9895 4 155 GO:0008199
GO:0016722
AF-V8D2I3-F1-model_v4 Ferritin 0.9894 4 154 GO:0008199
GO:0016722

Map