F451339

General Info

Members Datasets Scaffolds Average Seq Length
475 220 950 156

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_11503636|Ga0105246_115036361
Length 171
Sequence LTHPITLVVNGTAHPVEVDAHRSLLHTVREEVGLTGAKEGCDDSECGACMMLLDGRPVNSCSYLAVQADGSAVTTVEGLAPAPGTGPGGAELELSDLKRAFLRHGDVQCGFCTPGMLVSATALLAGNPAPSQEEIRVALSGNLCRCTGYDGIVRAVAEVAAHRAAPMISGQ

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
118 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.37
Rhizosphere 92.63
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_11503636 3300011119 Bacteria 632
2 JGI25407J50210_10015664 3300003373 Bacteria 1959
3 JGI25407J50210_10020501 3300003373 Bacteria 1719
4 Ga0070676_10070928 3300005328 Bacteria 2091
5 Ga0070683_101179367 3300005329 Bacteria 736
6 Ga0070680_100147461 3300005336 Bacteria 1974
7 Ga0070680_100659915 3300005336 Bacteria 899
8 Ga0070682_100064862 3300005337 Bacteria 2319
9 Ga0068868_100319186 3300005338 Bacteria 1323
10 Ga0070660_100185220 3300005339 Bacteria 1685
11 Ga0070689_100017407 3300005340 Bacteria 5278
12 Ga0070689_100148335 3300005340 Bacteria 1890
13 Ga0070661_100218394 3300005344 Bacteria 1461
14 Ga0070669_100140376 3300005353 Bacteria 1862
15 Ga0070669_100229570 3300005353 Bacteria 1471
16 Ga0070675_100020571 3300005354 Bacteria 5265
17 Ga0070671_100080955 3300005355 Bacteria 2715
18 Ga0070688_100143550 3300005365 Bacteria 1624
19 Ga0070688_100319920 3300005365 Bacteria 1127
20 Ga0070659_100081954 3300005366 Bacteria 2577
21 Ga0070711_100058540 3300005439 Bacteria 2672
22 Ga0070705_100081092 3300005440 Bacteria 1992
23 Ga0070705_101465236 3300005440 Bacteria 571
24 Ga0070700_100017101 3300005441 Bacteria 4141
25 Ga0070708_100213633 3300005445 Bacteria 1808
26 Ga0070663_100288734 3300005455 Bacteria 1309
27 Ga0070663_100949666 3300005455 Bacteria 745
28 Ga0070678_100781946 3300005456 Bacteria 865
29 Ga0068867_100944388 3300005459 Bacteria 779
30 Ga0070685_10323121 3300005466 Bacteria 1047
31 Ga0070685_10571766 3300005466 Bacteria 809
32 Ga0070698_100035614 3300005471 Bacteria 5145
33 Ga0070698_100061162 3300005471 Bacteria 3800
34 Ga0070698_100136163 3300005471 Bacteria 2410
35 Ga0070698_100325929 3300005471 Bacteria 1467
36 Ga0070698_101375140 3300005471 Bacteria 656
37 Ga0070699_100264134 3300005518 Bacteria 1540
38 Ga0070699_100408051 3300005518 Bacteria 1229
39 Ga0070679_100325639 3300005530 Bacteria 1485
40 Ga0070697_100059988 3300005536 Bacteria 3100
41 Ga0070672_100149938 3300005543 Bacteria 1928
42 Ga0070672_100776766 3300005543 Bacteria 842
43 Ga0070686_100028994 3300005544 Bacteria 3361
44 Ga0070696_100071687 3300005546 Bacteria 2438
45 Ga0070693_100190328 3300005547 Bacteria 1326
46 Ga0070665_100122314 3300005548 Bacteria 2604
47 Ga0070704_100280810 3300005549 Bacteria 1379
48 Ga0068855_101552646 3300005563 Bacteria 678
49 Ga0070664_100297201 3300005564 Bacteria 1458
50 Ga0070664_101190276 3300005564 Bacteria 719
51 Ga0068857_100109792 3300005577 Bacteria 2478
52 Ga0070702_100386766 3300005615 Bacteria 996
53 Ga0068852_100039572 3300005616 Bacteria 3970
54 Ga0068864_100247230 3300005618 Bacteria 1654
55 Ga0068864_100340093 3300005618 Bacteria 1414
56 Ga0068866_10016427 3300005718 Bacteria 3309
57 Ga0068866_10083079 3300005718 Bacteria 1725
58 Ga0068866_10835534 3300005718 Bacteria 643
59 Ga0068870_10015574 3300005840 Bacteria 3612
60 Ga0068863_100534589 3300005841 Bacteria 1156
61 Ga0068858_100138744 3300005842 Bacteria 2282
62 Ga0068858_100658347 3300005842 Bacteria 1018
63 Ga0068860_100049072 3300005843 Bacteria 4023
64 Ga0068862_100313787 3300005844 Bacteria 1445
65 Ga0081455_10007105 3300005937 Bacteria 11856
66 Ga0081455_10081988 3300005937 Bacteria 2640
67 Ga0081538_10000720 3300005981 Bacteria 36112
68 Ga0081538_10001447 3300005981 Bacteria 24396
69 Ga0081538_10001820 3300005981 Bacteria 21461
70 Ga0081538_10025984 3300005981 Bacteria 4111
71 Ga0081539_10071111 3300005985 Bacteria 1865
72 Ga0081539_10186486 3300005985 Bacteria 969
73 Ga0070712_100056440 3300006175 Bacteria 2755
74 Ga0097621_100140420 3300006237 Bacteria 2064
75 Ga0068871_100880959 3300006358 Bacteria 829
76 Ga0075428_100001261 3300006844 Bacteria 27013
77 Ga0075428_100038011 3300006844 Bacteria 5297
78 Ga0075428_100046746 3300006844 Bacteria 4754
79 Ga0075428_100109203 3300006844 Bacteria 3015
80 Ga0075430_100264445 3300006846 Bacteria 1424
81 Ga0075430_100506378 3300006846 Bacteria 996
82 Ga0075430_100998009 3300006846 Bacteria 690
83 Ga0075431_100064816 3300006847 Bacteria 3773
84 Ga0075431_100094383 3300006847 Bacteria 3087
85 Ga0075431_100145485 3300006847 Bacteria 2442
86 Ga0075433_10324422 3300006852 Bacteria 1362
87 Ga0075434_100390327 3300006871 Bacteria 1413
88 Ga0075429_100015695 3300006880 Bacteria 6562
89 Ga0068865_100017636 3300006881 Bacteria 4595
90 Ga0068865_100146009 3300006881 Bacteria 1789
91 Ga0075436_101363531 3300006914 Bacteria 537
92 Ga0105240_10692922 3300009093 Bacteria 1113
93 Ga0111539_10431082 3300009094 Bacteria 1535
94 Ga0105245_10169760 3300009098 Bacteria 2077
95 Ga0114129_10012294 3300009147 Bacteria 12181
96 Ga0114129_10014846 3300009147 Bacteria 11100
97 Ga0114129_10120593 3300009147 Bacteria 3611
98 Ga0114129_10188560 3300009147 Bacteria 2801
99 Ga0114129_10592121 3300009147 Bacteria 1438
100 Ga0114129_11604049 3300009147 Bacteria 797
101 Ga0105243_10220113 3300009148 Bacteria 1677
102 Ga0105241_10233587 3300009174 Bacteria 1551
103 Ga0105242_10067212 3300009176 Bacteria 2963
104 Ga0105242_10931733 3300009176 Bacteria 871
105 Ga0105248_10160068 3300009177 Bacteria 2540
106 Ga0105237_11082990 3300009545 Bacteria 808
107 Ga0105238_10115045 3300009551 Bacteria 2669
108 Ga0105249_12952159 3300009553 Bacteria 546
109 Ga0105246_10669144 3300011119 Bacteria 906
110 Ga0157369_10426589 3300013105 Bacteria 1375
111 Ga0157374_10798604 3300013296 Bacteria 959
112 Ga0157372_11579637 3300013307 Bacteria 755
113 Ga0157375_10154940 3300013308 Bacteria 2429
114 Ga0157380_10018542 3300014326 Bacteria 5166
115 Ga0157380_10059251 3300014326 Bacteria 3054
116 Ga0157379_10087060 3300014968 Bacteria 2801
117 Ga0157376_10117403 3300014969 Bacteria 2352
118 Ga0207653_10038002 3300025885 Bacteria 1572
119 Ga0207688_10045887 3300025901 Bacteria 2439
120 Ga0207647_10086243 3300025904 Bacteria 1876
121 Ga0207645_10008554 3300025907 Bacteria 7134
122 Ga0207643_10103018 3300025908 Bacteria 1675
123 Ga0207707_10322109 3300025912 Bacteria 1334
124 Ga0207695_10537611 3300025913 Bacteria 1050
125 Ga0207693_10013699 3300025915 Bacteria 6532
126 Ga0207663_10006301 3300025916 Bacteria 6059
127 Ga0207660_10203176 3300025917 Bacteria 1548
128 Ga0207649_10148226 3300025920 Bacteria 1613
129 Ga0207646_10534966 3300025922 Bacteria 1054
130 Ga0207681_10100399 3300025923 Bacteria 2086
131 Ga0207650_10238300 3300025925 Bacteria 1469
132 Ga0207706_10039369 3300025933 Bacteria 4190
133 Ga0207709_10030463 3300025935 Bacteria 3139
134 Ga0207670_10188028 3300025936 Bacteria 1561
135 Ga0207691_10054762 3300025940 Bacteria 3638
136 Ga0207691_10090187 3300025940 Bacteria 2748
137 Ga0207689_10136086 3300025942 Bacteria 2023
138 Ga0207661_10187195 3300025944 Bacteria 1813
139 Ga0207667_10150168 3300025949 Bacteria 2398
140 Ga0207668_11198507 3300025972 Bacteria 682
141 Ga0207658_10379240 3300025986 Bacteria 1238
142 Ga0207677_10152558 3300026023 Bacteria 1784
143 Ga0207703_10654868 3300026035 Bacteria 997
144 Ga0207678_10174551 3300026067 Bacteria 1835
145 Ga0207708_10018844 3300026075 Bacteria 5198
146 Ga0207708_10116227 3300026075 Bacteria 2081
147 Ga0207708_10621440 3300026075 Bacteria 917
148 Ga0207702_11199049 3300026078 Bacteria 753
149 Ga0207641_10220870 3300026088 Bacteria 1757
150 Ga0207641_11921817 3300026088 Bacteria 593
151 Ga0207648_10085544 3300026089 Bacteria 2751
152 Ga0207648_10298613 3300026089 Bacteria 1444
153 Ga0207676_10043597 3300026095 Bacteria 3456
154 Ga0207674_10057720 3300026116 Bacteria 3935
155 Ga0207675_100031233 3300026118 Bacteria 4961
156 Ga0207683_10051675 3300026121 Bacteria 3601
157 Ga0207683_10175352 3300026121 Bacteria 1943
158 Ga0207698_10729864 3300026142 Bacteria 988
159 Ga0207428_10145329 3300027907 Bacteria 1808
160 Ga0268266_10927903 3300028379 Bacteria 842
161 Ga0268264_10069243 3300028381 Bacteria 2984
162 Ga0268264_11791134 3300028381 Bacteria 624
163 Ga0307410_10273285 3300031852 Bacteria 1323
164 Ga0373948_0025234 3300034817 Bacteria 1164
165 Ga0373958_0106925 3300034819 Bacteria 663
166 Ga0373952_0001882 3300035092 Bacteria 3812
167 Ga0373932_0024489 3300035112 Bacteria 1625
168 Ga0373939_0448230 3300035114 Bacteria 543
169 Ga0373961_0036315 3300035241 Bacteria 1403
170 Ga0373962_0099259 3300035242 Bacteria 906
171 Ga0373931_0351758 3300035691 Bacteria 922
172 Ga0395900_0062663 3300037418 Unclassified 3823
173 Ga0395900_0486117 3300037418 Bacteria 1186
174 Ga0395900_0877100 3300037418 Bacteria 822
175 Ga0395898_0311602 3300037466 Bacteria 1501
176 Ga0395898_0891876 3300037466 Bacteria 828
177 Ga0395898_1932537 3300037466 Bacteria 510
178 Ga0395905_0418058 3300037471 Bacteria 1237
179 Ga0395901_0113710 3300038443 Bacteria 2843
180 Ga0395901_0384489 3300038443 Bacteria 1444
181 Ga0395901_1055711 3300038443 Bacteria 785
182 Ga0439454_005324 3300042011 Bacteria 1532
183 Ga0439435_0128525 3300042436 Bacteria 799
184 Ga0466963_0000092 3300044694 Bacteria 31620
185 Ga0466963_0008102 3300044694 Bacteria 6292
186 Ga0466963_0008350 3300044694 Bacteria 6205
187 Ga0466963_0028724 3300044694 Bacteria 3574
188 Ga0466964_0007969 3300044706 Bacteria 3967
189 Ga0466957_0006381 3300044842 Bacteria 6658
190 Ga0466958_0168566 3300045836 Bacteria 1386
191 Ga0466958_0334485 3300045836 Bacteria 974
192 Ga0466967_0009936 3300045976 Bacteria 7103
193 Ga0466967_0057062 3300045976 Bacteria 3445
194 Ga0466967_0106012 3300045976 Bacteria 2575
195 Ga0466967_0611347 3300045976 Bacteria 1076
196 Ga0495603_0106187 3300046455 Bacteria 1638
197 Ga0495584_0073067 3300046491 Bacteria 1724
198 Ga0495584_0120243 3300046491 Bacteria 1330
199 Ga0495585_0018416 3300046492 Bacteria 4028
200 Ga0495585_0179463 3300046492 Bacteria 1089
201 Ga0495594_0677973 3300046499 Bacteria 583
202 Ga0495596_0135007 3300046500 Bacteria 958
203 Ga0495596_0269649 3300046500 Bacteria 661
204 Ga0495607_0239074 3300046501 Unclassified 879
205 Ga0495607_0506234 3300046501 Bacteria 535
206 Ga0495616_0269616 3300046513 Bacteria 726
207 Ga0495644_0006787 3300046523 Bacteria 4434
208 Ga0495644_0188396 3300046523 Bacteria 794
209 Ga0495644_0231787 3300046523 Bacteria 715
210 Ga0495663_0053068 3300046525 Unclassified 1260
211 Ga0495598_0054589 3300046537 Bacteria 1214
212 Ga0495598_0108755 3300046537 Bacteria 927
213 Ga0495609_0052164 3300046538 Bacteria 1820
214 Ga0495609_0122123 3300046538 Bacteria 1119
215 Ga0495656_0031996 3300046615 Bacteria 2137
216 Ga0495668_0211039 3300046616 Bacteria 1063
217 Ga0495611_0012876 3300046648 Bacteria 3555
218 Ga0495659_0320372 3300046664 Bacteria 658
219 Ga0495661_0054418 3300046665 Bacteria 2403
220 Ga0495661_0275607 3300046665 Unclassified 850
221 Ga0495669_0377521 3300046684 Bacteria 686
222 Ga0495589_0092640 3300046794 Bacteria 1467
223 Ga0495589_0124278 3300046794 Bacteria 1241
224 Ga0495600_0100243 3300046809 Bacteria 1888
225 Ga0495604_0139680 3300047317 Bacteria 1732
226 Ga0495681_0198018 3300047470 Bacteria 816
227 Ga0495684_0558960 3300047471 Unclassified 778
228 Ga0495602_0235897 3300048088 Bacteria 1371
229 Ga0495615_0039246 3300048090 Bacteria 1174
230 Ga0496100_0472024 3300048903 Bacteria 964
231 Ga0496101_0008444 3300048904 Bacteria 6728
232 Ga0496101_0080189 3300048904 Bacteria 2411
233 Ga0496102_0009824 3300048905 Bacteria 8227
234 Ga0496102_0499120 3300048905 Bacteria 1139
235 Ga0496102_1499268 3300048905 Bacteria 593
236 Ga0496103_0147918 3300048906 Bacteria 1504
237 Ga0496103_0443470 3300048906 Bacteria 833
238 Ga0496103_0794683 3300048906 Bacteria 597
239 Ga0496104_0013559 3300048907 Bacteria 7346
240 Ga0496104_0219001 3300048907 Bacteria 1816
241 Ga0496105_0029231 3300048908 Bacteria 4510
242 Ga0496105_0935693 3300048908 Bacteria 651
243 Ga0496106_0038365 3300048909 Bacteria 3584
244 Ga0496107_0010717 3300048910 Bacteria 6375
245 Ga0496107_0437937 3300048910 Bacteria 971
246 Ga0496108_0030205 3300048911 Bacteria 4491
247 Ga0496108_0232244 3300048911 Bacteria 1604
248 Ga0496108_1173776 3300048911 Bacteria 650
249 Ga0496109_0012845 3300048912 Bacteria 7238
250 Ga0496109_0024452 3300048912 Bacteria 5370
251 Ga0496109_0090999 3300048912 Bacteria 2821
252 Ga0496109_0399717 3300048912 Bacteria 1298
253 Ga0496110_0055744 3300048913 Bacteria 3478
254 Ga0496110_0354913 3300048913 Bacteria 1336
255 Ga0496110_0370214 3300048913 Bacteria 1305
256 Ga0496111_0030625 3300048914 Bacteria 3827
257 Ga0496111_0041281 3300048914 Bacteria 3310
258 Ga0496112_0830616 3300048915 Bacteria 848
259 Ga0496112_0832001 3300048915 Bacteria 847
260 Ga0496113_0042512 3300048916 Bacteria 3359
261 Ga0496113_0152031 3300048916 Bacteria 1827
262 Ga0496114_0004735 3300048917 Bacteria 10590
263 Ga0496114_0053933 3300048917 Bacteria 3351
264 Ga0496115_0002094 3300048918 Bacteria 14286
265 Ga0501031_0000532 3300049568 Bacteria 22249
266 Ga0501031_0002464 3300049568 Bacteria 11811
267 Ga0501031_0055399 3300049568 Bacteria 2583
268 Ga0501031_0067665 3300049568 Bacteria 2326
269 Ga0501031_0095256 3300049568 Bacteria 1942
270 Ga0501031_0785814 3300049568 Bacteria 610
271 Ga0501032_0000714 3300049569 Bacteria 27059
272 Ga0501032_0003571 3300049569 Bacteria 11856
273 Ga0501032_0038325 3300049569 Bacteria 3265
274 Ga0501032_0502994 3300049569 Bacteria 774
275 Ga0501033_0000987 3300049570 Bacteria 25891
276 Ga0501033_0004707 3300049570 Bacteria 10921
277 Ga0501033_0020846 3300049570 Bacteria 4948
278 Ga0501033_0024124 3300049570 Bacteria 4590
279 Ga0501033_0488601 3300049570 Bacteria 852
280 Ga0501034_0009386 3300049571 Bacteria 10248
281 Ga0501034_0013589 3300049571 Bacteria 8378
282 Ga0501034_0161682 3300049571 Bacteria 2210
283 Ga0501036_0000681 3300049572 Bacteria 25022
284 Ga0501036_0002396 3300049572 Bacteria 14666
285 Ga0501036_0004659 3300049572 Bacteria 11079
286 Ga0501036_0068333 3300049572 Bacteria 3007
287 Ga0501036_0130990 3300049572 Bacteria 2117
288 Ga0501036_0165107 3300049572 Bacteria 1866
289 Ga0501036_0251676 3300049572 Bacteria 1480
290 Ga0501037_0001001 3300049573 Bacteria 20939
291 Ga0501037_0213324 3300049573 Bacteria 1360
292 Ga0501037_0314350 3300049573 Bacteria 1085
293 Ga0501037_0439081 3300049573 Bacteria 891
294 Ga0501038_0000829 3300049574 Bacteria 27517
295 Ga0501038_0001029 3300049574 Bacteria 25172
296 Ga0501038_0009410 3300049574 Bacteria 8966
297 Ga0501038_0025149 3300049574 Bacteria 5308
298 Ga0501038_0145295 3300049574 Bacteria 1937
299 Ga0501038_0280581 3300049574 Bacteria 1311
300 Ga0501038_0641014 3300049574 Bacteria 800
301 Ga0501039_0006681 3300049575 Bacteria 8769
302 Ga0501039_0007217 3300049575 Bacteria 8468
303 Ga0501039_0007599 3300049575 Bacteria 8279
304 Ga0501039_0023512 3300049575 Bacteria 4728
305 Ga0501039_0186854 3300049575 Bacteria 1630
306 Ga0501039_0196815 3300049575 Bacteria 1584
307 Ga0501040_0001264 3300049576 Bacteria 16082
308 Ga0501040_0006032 3300049576 Bacteria 7844
309 Ga0501040_0025495 3300049576 Bacteria 3975
310 Ga0501040_0061108 3300049576 Bacteria 2590
311 Ga0501040_0103003 3300049576 Bacteria 1992
312 Ga0501041_0000640 3300049577 Bacteria 18331
313 Ga0501041_0004464 3300049577 Bacteria 8102
314 Ga0501041_0022112 3300049577 Bacteria 3808
315 Ga0501041_0032585 3300049577 Bacteria 3149
316 Ga0501041_0405618 3300049577 Bacteria 863
317 Ga0501041_0412091 3300049577 Bacteria 856
318 Ga0501042_0000729 3300049578 Bacteria 17806
319 Ga0501042_0001268 3300049578 Bacteria 14704
320 Ga0501042_0090937 3300049578 Bacteria 2190
321 Ga0501042_0109961 3300049578 Bacteria 1984
322 Ga0501042_0262559 3300049578 Bacteria 1246
323 Ga0501042_0923947 3300049578 Bacteria 635
324 Ga0501043_0000750 3300049579 Bacteria 28826
325 Ga0501043_0005086 3300049579 Bacteria 10645
326 Ga0501043_0009164 3300049579 Bacteria 7783
327 Ga0501043_0333916 3300049579 Bacteria 1154
328 Ga0501043_0598722 3300049579 Bacteria 814
329 Ga0501046_0000475 3300049580 Bacteria 40215
330 Ga0501046_0013372 3300049580 Bacteria 6950
331 Ga0501046_0029178 3300049580 Bacteria 4486
332 Ga0501046_0041396 3300049580 Bacteria 3676
333 Ga0501046_0390930 3300049580 Bacteria 1005
334 Ga0501046_0426564 3300049580 Bacteria 955
335 Ga0501047_0001366 3300049581 Bacteria 23962
336 Ga0501047_0028856 3300049581 Bacteria 5352
337 Ga0501047_0073547 3300049581 Bacteria 3291
338 Ga0501047_0759478 3300049581 Bacteria 785
339 Ga0501048_0000881 3300049582 Bacteria 22170
340 Ga0501048_0034343 3300049582 Bacteria 3659
341 Ga0501048_0085857 3300049582 Bacteria 2219
342 Ga0501048_0150957 3300049582 Bacteria 1643
343 Ga0501048_0218255 3300049582 Bacteria 1352
344 Ga0501048_0377900 3300049582 Bacteria 1011
345 Ga0501048_0701775 3300049582 Bacteria 726
346 Ga0501067_0000348 3300049583 Bacteria 25209
347 Ga0501067_0017765 3300049583 Bacteria 3938
348 Ga0501067_0041171 3300049583 Bacteria 2565
349 Ga0501067_0114358 3300049583 Bacteria 1501
350 Ga0501067_0148873 3300049583 Bacteria 1304
351 Ga0501068_0000481 3300049584 Bacteria 20160
352 Ga0501068_0010938 3300049584 Bacteria 5107
353 Ga0501068_0025943 3300049584 Bacteria 3449
354 Ga0501068_0072414 3300049584 Bacteria 2104
355 Ga0501068_0088389 3300049584 Bacteria 1909
356 Ga0501068_0110831 3300049584 Bacteria 1706
357 Ga0501068_0183518 3300049584 Bacteria 1323
358 Ga0501069_0001407 3300049585 Bacteria 11795
359 Ga0501069_0003511 3300049585 Bacteria 8073
360 Ga0501069_0006541 3300049585 Bacteria 6094
361 Ga0501069_0017698 3300049585 Bacteria 3840
362 Ga0501069_0101491 3300049585 Bacteria 1633
363 Ga0501069_0187733 3300049585 Bacteria 1195
364 Ga0501069_0208429 3300049585 Bacteria 1134
365 Ga0501070_0004094 3300049586 Bacteria 12538
366 Ga0501070_0008507 3300049586 Bacteria 8673
367 Ga0501070_0044225 3300049586 Bacteria 3706
368 Ga0501070_0127611 3300049586 Bacteria 2102
369 Ga0501070_0785553 3300049586 Bacteria 748
370 Ga0501070_0961679 3300049586 Bacteria 664
371 Ga0501071_0001196 3300049587 Bacteria 14649
372 Ga0501071_0001507 3300049587 Bacteria 13537
373 Ga0501071_0005459 3300049587 Bacteria 8175
374 Ga0501071_0115683 3300049587 Bacteria 1984
375 Ga0501071_0214897 3300049587 Bacteria 1446
376 Ga0501071_0224160 3300049587 Bacteria 1415
377 Ga0501071_0231969 3300049587 Bacteria 1390
378 Ga0501072_0000365 3300049588 Bacteria 32224
379 Ga0501072_0009778 3300049588 Bacteria 7290
380 Ga0501072_0016423 3300049588 Bacteria 5683
381 Ga0501072_0115466 3300049588 Bacteria 2137
382 Ga0501072_0271703 3300049588 Bacteria 1348
383 Ga0501072_0347603 3300049588 Bacteria 1177
384 Ga0501073_0001715 3300049589 Bacteria 16267
385 Ga0501073_0002069 3300049589 Bacteria 15002
386 Ga0501073_0007954 3300049589 Bacteria 7868
387 Ga0501073_0030631 3300049589 Bacteria 3840
388 Ga0501073_0128264 3300049589 Bacteria 1758
389 Ga0501074_0000505 3300049590 Bacteria 23892
390 Ga0501074_0002703 3300049590 Bacteria 12415
391 Ga0501074_0008799 3300049590 Bacteria 7317
392 Ga0501074_0010939 3300049590 Bacteria 6587
393 Ga0501074_0131591 3300049590 Bacteria 1789
394 Ga0501075_0000445 3300049591 Bacteria 24506
395 Ga0501075_0003829 3300049591 Bacteria 10127
396 Ga0501075_0033549 3300049591 Bacteria 3819
397 Ga0501075_0053107 3300049591 Bacteria 3047
398 Ga0501076_0000349 3300049592 Bacteria 28511
399 Ga0501076_0005926 3300049592 Bacteria 8821
400 Ga0501076_0015274 3300049592 Bacteria 5800
401 Ga0501076_0018757 3300049592 Bacteria 5280
402 Ga0501076_0982569 3300049592 Bacteria 695
403 Ga0501077_0000802 3300049593 Bacteria 19026
404 Ga0501077_0002307 3300049593 Bacteria 11487
405 Ga0501077_0016860 3300049593 Bacteria 4607
406 Ga0501077_0073730 3300049593 Bacteria 2162
407 Ga0501077_0255578 3300049593 Bacteria 1114
408 Ga0501077_0290287 3300049593 Bacteria 1041
409 Ga0501079_0000646 3300049741 Bacteria 23202
410 Ga0501079_0006958 3300049741 Bacteria 8525
411 Ga0501079_0008856 3300049741 Bacteria 7619
412 Ga0501079_0099412 3300049741 Bacteria 2254
413 Ga0501079_0110821 3300049741 Bacteria 2132
414 Ga0501079_0154505 3300049741 Bacteria 1788
415 Ga0501079_0200343 3300049741 Bacteria 1559
416 Ga0501080_0001159 3300049742 Bacteria 21759
417 Ga0501080_0028533 3300049742 Bacteria 5193
418 Ga0501080_0057970 3300049742 Bacteria 3605
419 Ga0501080_1412595 3300049742 Bacteria 593
420 Ga0501081_0000511 3300049743 Bacteria 21798
421 Ga0501081_0028910 3300049743 Bacteria 3743
422 Ga0501081_0033606 3300049743 Bacteria 3485
423 Ga0501081_0100301 3300049743 Bacteria 2046
424 Ga0501081_0208292 3300049743 Bacteria 1419
425 Ga0501081_0492049 3300049743 Bacteria 913
426 Ga0501081_1117496 3300049743 Bacteria 596
427 Ga0501083_0005037 3300049744 Bacteria 9358
428 Ga0501083_0010827 3300049744 Bacteria 6415
429 Ga0501083_0545666 3300049744 Bacteria 754
430 Ga0501035_0000561 3300049822 Bacteria 41148
431 Ga0501035_0008298 3300049822 Bacteria 9676
432 Ga0501035_0119000 3300049822 Bacteria 2310
433 Ga0501044_0017549 3300049823 Bacteria 7678
434 Ga0501044_0698163 3300049823 Bacteria 900
435 Ga0501045_0000699 3300049824 Bacteria 21322
436 Ga0501045_0001408 3300049824 Bacteria 16054
437 Ga0501045_0014408 3300049824 Bacteria 5602
438 Ga0501045_0072727 3300049824 Bacteria 2531
439 Ga0501045_0554195 3300049824 Bacteria 852
440 nmdc:mga05p37_34980_c1 3300050507 Bacteria 6158
441 nmdc:mga05p37_4506_c1 3300050507 Bacteria 16283
442 nmdc:mga05p37_572995_c1 3300050507 Bacteria 1280
443 nmdc:mga05p37_584_c1 3300050507 Bacteria 40188
444 nmdc:mga09592_627655_c1 3300050508 Bacteria 919
445 nmdc:mga09592_6315_c1 3300050508 Bacteria 9658
446 nmdc:mga0qj67_113873_c1 3300050509 Bacteria 2185
447 nmdc:mga06r32_199058_c1 3300050510 Bacteria 1991
448 nmdc:mga06r32_57357_c1 3300050510 Bacteria 3740
449 nmdc:mga06r32_88907_c1 3300050510 Bacteria 3015
450 nmdc:mga08y16_21817_c1 3300050511 Bacteria 6757
451 nmdc:mga08x19_182631_c1 3300050514 Bacteria 1432
452 nmdc:mga0a205_232773_c1 3300050515 Bacteria 1201
453 Ga0495595_0017307 3300053084 Bacteria 3101
454 Ga0501084_0000493 3300054114 Bacteria 30265
455 Ga0501084_0000557 3300054114 Bacteria 28483
456 Ga0501084_0012868 3300054114 Bacteria 6931
457 Ga0501084_0016421 3300054114 Bacteria 6148
458 Ga0501084_0547768 3300054114 Bacteria 977
459 Ga0501084_0811961 3300054114 Bacteria 787
460 Ga0501084_1613930 3300054114 Bacteria 542
461 Ga0501082_0001026 3300060353 Bacteria 24703
462 Ga0501082_0001850 3300060353 Bacteria 18632
463 Ga0501082_0010582 3300060353 Bacteria 7939
464 Ga0501082_0019924 3300060353 Bacteria 5780
465 Ga0501082_0096163 3300060353 Bacteria 2560
466 Ga0501082_0540071 3300060353 Bacteria 1019
467 Ga0466962_0090423 3300061719 Bacteria 1466
468 Ga0530510_0000499 3300061734 Bacteria 24903
469 Ga0530510_0003714 3300061734 Bacteria 10507
470 Ga0530510_0014888 3300061734 Bacteria 5492
471 Ga0530510_0019491 3300061734 Bacteria 4815
472 Ga0530510_0045327 3300061734 Bacteria 3176
473 Ga0530510_0052462 3300061734 Bacteria 2946
474 Ga0530510_0163957 3300061734 Bacteria 1644
475 Ga0530510_0459068 3300061734 Bacteria 963
476 Ga0105246_11503636
477 JGI25407J50210_10015664
478 JGI25407J50210_10020501
479 Ga0070676_10070928
480 Ga0070683_101179367
481 Ga0070680_100147461
482 Ga0070680_100659915
483 Ga0070682_100064862
484 Ga0068868_100319186
485 Ga0070660_100185220
486 Ga0070689_100017407
487 Ga0070689_100148335
488 Ga0070661_100218394
489 Ga0070669_100140376
490 Ga0070669_100229570
491 Ga0070675_100020571
492 Ga0070671_100080955
493 Ga0070688_100143550
494 Ga0070688_100319920
495 Ga0070659_100081954
496 Ga0070711_100058540
497 Ga0070705_100081092
498 Ga0070705_101465236
499 Ga0070700_100017101
500 Ga0070708_100213633
501 Ga0070663_100288734
502 Ga0070663_100949666
503 Ga0070678_100781946
504 Ga0068867_100944388
505 Ga0070685_10323121
506 Ga0070685_10571766
507 Ga0070698_100035614
508 Ga0070698_100061162
509 Ga0070698_100136163
510 Ga0070698_100325929
511 Ga0070698_101375140
512 Ga0070699_100264134
513 Ga0070699_100408051
514 Ga0070679_100325639
515 Ga0070697_100059988
516 Ga0070672_100149938
517 Ga0070672_100776766
518 Ga0070686_100028994
519 Ga0070696_100071687
520 Ga0070693_100190328
521 Ga0070665_100122314
522 Ga0070704_100280810
523 Ga0068855_101552646
524 Ga0070664_100297201
525 Ga0070664_101190276
526 Ga0068857_100109792
527 Ga0070702_100386766
528 Ga0068852_100039572
529 Ga0068864_100247230
530 Ga0068864_100340093
531 Ga0068866_10016427
532 Ga0068866_10083079
533 Ga0068866_10835534
534 Ga0068870_10015574
535 Ga0068863_100534589
536 Ga0068858_100138744
537 Ga0068858_100658347
538 Ga0068860_100049072
539 Ga0068862_100313787
540 Ga0081455_10007105
541 Ga0081455_10081988
542 Ga0081538_10000720
543 Ga0081538_10001447
544 Ga0081538_10001820
545 Ga0081538_10025984
546 Ga0081539_10071111
547 Ga0081539_10186486
548 Ga0070712_100056440
549 Ga0097621_100140420
550 Ga0068871_100880959
551 Ga0075428_100001261
552 Ga0075428_100038011
553 Ga0075428_100046746
554 Ga0075428_100109203
555 Ga0075430_100264445
556 Ga0075430_100506378
557 Ga0075430_100998009
558 Ga0075431_100064816
559 Ga0075431_100094383
560 Ga0075431_100145485
561 Ga0075433_10324422
562 Ga0075434_100390327
563 Ga0075429_100015695
564 Ga0068865_100017636
565 Ga0068865_100146009
566 Ga0075436_101363531
567 Ga0105240_10692922
568 Ga0111539_10431082
569 Ga0105245_10169760
570 Ga0114129_10012294
571 Ga0114129_10014846
572 Ga0114129_10120593
573 Ga0114129_10188560
574 Ga0114129_10592121
575 Ga0114129_11604049
576 Ga0105243_10220113
577 Ga0105241_10233587
578 Ga0105242_10067212
579 Ga0105242_10931733
580 Ga0105248_10160068
581 Ga0105237_11082990
582 Ga0105238_10115045
583 Ga0105249_12952159
584 Ga0105246_10669144
585 Ga0157369_10426589
586 Ga0157374_10798604
587 Ga0157372_11579637
588 Ga0157375_10154940
589 Ga0157380_10018542
590 Ga0157380_10059251
591 Ga0157379_10087060
592 Ga0157376_10117403
593 Ga0207653_10038002
594 Ga0207688_10045887
595 Ga0207647_10086243
596 Ga0207645_10008554
597 Ga0207643_10103018
598 Ga0207707_10322109
599 Ga0207695_10537611
600 Ga0207693_10013699
601 Ga0207663_10006301
602 Ga0207660_10203176
603 Ga0207649_10148226
604 Ga0207646_10534966
605 Ga0207681_10100399
606 Ga0207650_10238300
607 Ga0207706_10039369
608 Ga0207709_10030463
609 Ga0207670_10188028
610 Ga0207691_10054762
611 Ga0207691_10090187
612 Ga0207689_10136086
613 Ga0207661_10187195
614 Ga0207667_10150168
615 Ga0207668_11198507
616 Ga0207658_10379240
617 Ga0207677_10152558
618 Ga0207703_10654868
619 Ga0207678_10174551
620 Ga0207708_10018844
621 Ga0207708_10116227
622 Ga0207708_10621440
623 Ga0207702_11199049
624 Ga0207641_10220870
625 Ga0207641_11921817
626 Ga0207648_10085544
627 Ga0207648_10298613
628 Ga0207676_10043597
629 Ga0207674_10057720
630 Ga0207675_100031233
631 Ga0207683_10051675
632 Ga0207683_10175352
633 Ga0207698_10729864
634 Ga0207428_10145329
635 Ga0268266_10927903
636 Ga0268264_10069243
637 Ga0268264_11791134
638 Ga0307410_10273285
639 Ga0373948_0025234
640 Ga0373958_0106925
641 Ga0373952_0001882
642 Ga0373932_0024489
643 Ga0373939_0448230
644 Ga0373961_0036315
645 Ga0373962_0099259
646 Ga0373931_0351758
647 Ga0395900_0062663
648 Ga0395900_0486117
649 Ga0395900_0877100
650 Ga0395898_0311602
651 Ga0395898_0891876
652 Ga0395898_1932537
653 Ga0395905_0418058
654 Ga0395901_0113710
655 Ga0395901_0384489
656 Ga0395901_1055711
657 Ga0439454_005324
658 Ga0439435_0128525
659 Ga0466963_0000092
660 Ga0466963_0008102
661 Ga0466963_0008350
662 Ga0466963_0028724
663 Ga0466964_0007969
664 Ga0466957_0006381
665 Ga0466958_0168566
666 Ga0466958_0334485
667 Ga0466967_0009936
668 Ga0466967_0057062
669 Ga0466967_0106012
670 Ga0466967_0611347
671 Ga0495603_0106187
672 Ga0495584_0073067
673 Ga0495584_0120243
674 Ga0495585_0018416
675 Ga0495585_0179463
676 Ga0495594_0677973
677 Ga0495596_0135007
678 Ga0495596_0269649
679 Ga0495607_0239074
680 Ga0495607_0506234
681 Ga0495616_0269616
682 Ga0495644_0006787
683 Ga0495644_0188396
684 Ga0495644_0231787
685 Ga0495663_0053068
686 Ga0495598_0054589
687 Ga0495598_0108755
688 Ga0495609_0052164
689 Ga0495609_0122123
690 Ga0495656_0031996
691 Ga0495668_0211039
692 Ga0495611_0012876
693 Ga0495659_0320372
694 Ga0495661_0054418
695 Ga0495661_0275607
696 Ga0495669_0377521
697 Ga0495589_0092640
698 Ga0495589_0124278
699 Ga0495600_0100243
700 Ga0495604_0139680
701 Ga0495681_0198018
702 Ga0495684_0558960
703 Ga0495602_0235897
704 Ga0495615_0039246
705 Ga0496100_0472024
706 Ga0496101_0008444
707 Ga0496101_0080189
708 Ga0496102_0009824
709 Ga0496102_0499120
710 Ga0496102_1499268
711 Ga0496103_0147918
712 Ga0496103_0443470
713 Ga0496103_0794683
714 Ga0496104_0013559
715 Ga0496104_0219001
716 Ga0496105_0029231
717 Ga0496105_0935693
718 Ga0496106_0038365
719 Ga0496107_0010717
720 Ga0496107_0437937
721 Ga0496108_0030205
722 Ga0496108_0232244
723 Ga0496108_1173776
724 Ga0496109_0012845
725 Ga0496109_0024452
726 Ga0496109_0090999
727 Ga0496109_0399717
728 Ga0496110_0055744
729 Ga0496110_0354913
730 Ga0496110_0370214
731 Ga0496111_0030625
732 Ga0496111_0041281
733 Ga0496112_0830616
734 Ga0496112_0832001
735 Ga0496113_0042512
736 Ga0496113_0152031
737 Ga0496114_0004735
738 Ga0496114_0053933
739 Ga0496115_0002094
740 Ga0501031_0000532
741 Ga0501031_0002464
742 Ga0501031_0055399
743 Ga0501031_0067665
744 Ga0501031_0095256
745 Ga0501031_0785814
746 Ga0501032_0000714
747 Ga0501032_0003571
748 Ga0501032_0038325
749 Ga0501032_0502994
750 Ga0501033_0000987
751 Ga0501033_0004707
752 Ga0501033_0020846
753 Ga0501033_0024124
754 Ga0501033_0488601
755 Ga0501034_0009386
756 Ga0501034_0013589
757 Ga0501034_0161682
758 Ga0501036_0000681
759 Ga0501036_0002396
760 Ga0501036_0004659
761 Ga0501036_0068333
762 Ga0501036_0130990
763 Ga0501036_0165107
764 Ga0501036_0251676
765 Ga0501037_0001001
766 Ga0501037_0213324
767 Ga0501037_0314350
768 Ga0501037_0439081
769 Ga0501038_0000829
770 Ga0501038_0001029
771 Ga0501038_0009410
772 Ga0501038_0025149
773 Ga0501038_0145295
774 Ga0501038_0280581
775 Ga0501038_0641014
776 Ga0501039_0006681
777 Ga0501039_0007217
778 Ga0501039_0007599
779 Ga0501039_0023512
780 Ga0501039_0186854
781 Ga0501039_0196815
782 Ga0501040_0001264
783 Ga0501040_0006032
784 Ga0501040_0025495
785 Ga0501040_0061108
786 Ga0501040_0103003
787 Ga0501041_0000640
788 Ga0501041_0004464
789 Ga0501041_0022112
790 Ga0501041_0032585
791 Ga0501041_0405618
792 Ga0501041_0412091
793 Ga0501042_0000729
794 Ga0501042_0001268
795 Ga0501042_0090937
796 Ga0501042_0109961
797 Ga0501042_0262559
798 Ga0501042_0923947
799 Ga0501043_0000750
800 Ga0501043_0005086
801 Ga0501043_0009164
802 Ga0501043_0333916
803 Ga0501043_0598722
804 Ga0501046_0000475
805 Ga0501046_0013372
806 Ga0501046_0029178
807 Ga0501046_0041396
808 Ga0501046_0390930
809 Ga0501046_0426564
810 Ga0501047_0001366
811 Ga0501047_0028856
812 Ga0501047_0073547
813 Ga0501047_0759478
814 Ga0501048_0000881
815 Ga0501048_0034343
816 Ga0501048_0085857
817 Ga0501048_0150957
818 Ga0501048_0218255
819 Ga0501048_0377900
820 Ga0501048_0701775
821 Ga0501067_0000348
822 Ga0501067_0017765
823 Ga0501067_0041171
824 Ga0501067_0114358
825 Ga0501067_0148873
826 Ga0501068_0000481
827 Ga0501068_0010938
828 Ga0501068_0025943
829 Ga0501068_0072414
830 Ga0501068_0088389
831 Ga0501068_0110831
832 Ga0501068_0183518
833 Ga0501069_0001407
834 Ga0501069_0003511
835 Ga0501069_0006541
836 Ga0501069_0017698
837 Ga0501069_0101491
838 Ga0501069_0187733
839 Ga0501069_0208429
840 Ga0501070_0004094
841 Ga0501070_0008507
842 Ga0501070_0044225
843 Ga0501070_0127611
844 Ga0501070_0785553
845 Ga0501070_0961679
846 Ga0501071_0001196
847 Ga0501071_0001507
848 Ga0501071_0005459
849 Ga0501071_0115683
850 Ga0501071_0214897
851 Ga0501071_0224160
852 Ga0501071_0231969
853 Ga0501072_0000365
854 Ga0501072_0009778
855 Ga0501072_0016423
856 Ga0501072_0115466
857 Ga0501072_0271703
858 Ga0501072_0347603
859 Ga0501073_0001715
860 Ga0501073_0002069
861 Ga0501073_0007954
862 Ga0501073_0030631
863 Ga0501073_0128264
864 Ga0501074_0000505
865 Ga0501074_0002703
866 Ga0501074_0008799
867 Ga0501074_0010939
868 Ga0501074_0131591
869 Ga0501075_0000445
870 Ga0501075_0003829
871 Ga0501075_0033549
872 Ga0501075_0053107
873 Ga0501076_0000349
874 Ga0501076_0005926
875 Ga0501076_0015274
876 Ga0501076_0018757
877 Ga0501076_0982569
878 Ga0501077_0000802
879 Ga0501077_0002307
880 Ga0501077_0016860
881 Ga0501077_0073730
882 Ga0501077_0255578
883 Ga0501077_0290287
884 Ga0501079_0000646
885 Ga0501079_0006958
886 Ga0501079_0008856
887 Ga0501079_0099412
888 Ga0501079_0110821
889 Ga0501079_0154505
890 Ga0501079_0200343
891 Ga0501080_0001159
892 Ga0501080_0028533
893 Ga0501080_0057970
894 Ga0501080_1412595
895 Ga0501081_0000511
896 Ga0501081_0028910
897 Ga0501081_0033606
898 Ga0501081_0100301
899 Ga0501081_0208292
900 Ga0501081_0492049
901 Ga0501081_1117496
902 Ga0501083_0005037
903 Ga0501083_0010827
904 Ga0501083_0545666
905 Ga0501035_0000561
906 Ga0501035_0008298
907 Ga0501035_0119000
908 Ga0501044_0017549
909 Ga0501044_0698163
910 Ga0501045_0000699
911 Ga0501045_0001408
912 Ga0501045_0014408
913 Ga0501045_0072727
914 Ga0501045_0554195
915 nmdc:mga05p37_34980_c1
916 nmdc:mga05p37_4506_c1
917 nmdc:mga05p37_572995_c1
918 nmdc:mga05p37_584_c1
919 nmdc:mga09592_627655_c1
920 nmdc:mga09592_6315_c1
921 nmdc:mga0qj67_113873_c1
922 nmdc:mga06r32_199058_c1
923 nmdc:mga06r32_57357_c1
924 nmdc:mga06r32_88907_c1
925 nmdc:mga08y16_21817_c1
926 nmdc:mga08x19_182631_c1
927 nmdc:mga0a205_232773_c1
928 Ga0495595_0017307
929 Ga0501084_0000493
930 Ga0501084_0000557
931 Ga0501084_0012868
932 Ga0501084_0016421
933 Ga0501084_0547768
934 Ga0501084_0811961
935 Ga0501084_1613930
936 Ga0501082_0001026
937 Ga0501082_0001850
938 Ga0501082_0010582
939 Ga0501082_0019924
940 Ga0501082_0096163
941 Ga0501082_0540071
942 Ga0466962_0090423
943 Ga0530510_0000499
944 Ga0530510_0003714
945 Ga0530510_0014888
946 Ga0530510_0019491
947 Ga0530510_0045327
948 Ga0530510_0052462
949 Ga0530510_0163957
950 Ga0530510_0459068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

75

157

0.87

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

7

76

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4orl-assembly1.cif.gz_A crystal structure of a duf4783 family protein (bacova_04304) from bacteroides ovatus atcc 8483 at 1.40 a resolution 0.8775 4 17
3drx-assembly1.cif.gz_A x-ray crystal structure of human kctd5 protein crystallized in high-salt buffer 0.7724 1 17
6m8r-assembly1.cif.gz_F crystal structure of the kctd16 btb domain in complex with gabab2 peptide 0.7325 1 17
1l5p-assembly3.cif.gz_C crystal structure of trichomonas vaginalis ferredoxin 0.7188 4 74
4fad-assembly1.cif.gz_A design and synthesis of a novel pyrrolidinyl pyrido pyrimidinone derivative as a potent inhibitor of pi3ka and mtor 0.715 2 33
ID Description Score Start End Superfamily
af_P17970_268_398_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.973 4 17 3.30.710.10
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9398 83 152 1.10.150.120
af_G5EC00_97_211_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9291 4 17 3.30.710.10
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9067 80 152 1.10.150.120
1n60A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8981 80 152 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A1V1W1B2-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.7319 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A1V1W1B2-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.7201 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A419I9N1-F1-model_v4 (2Fe-2S)-binding protein 0.7183 4 152 GO:0016491
GO:0046872
GO:0051537
AF-I2IDP1-F1-model_v4 deleted 0.7182 1 152
AF-A0A291RR03-F1-model_v4 4-hydroxybenzoyl-CoA reductase subunit gamma 0.7167 2 152 GO:0016491
GO:0046872
GO:0051537

Map