F451312

General Info

Members Datasets Scaffolds Average Seq Length
475 253 446 144

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100251099|Ga0070672_1002510991
Length 171
Sequence MTDFYARIEKLNSTITIKIETIMIIETLKTLFKKDLEKLRTEIELYPHEDRIWHFEKNIANSGGNLCLHLIGNLNAYIGVGLAKTNYIRQRDLEFSLKNIPQRELIQKIEETMIVVDKGLSSLSIDDLKKDFPIIIWDKKPTETAYTLLYLANHFNYHLGQINYHRRLLDQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
7 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
8 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
9 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
10 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
11 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
12 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
13 2738543023 Pedobacter sp. OK628 Isolate Unclassified
14 2739367651 Pedobacter sp. OK291 Isolate Unclassified
15 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
16 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
17 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
18 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
19 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
20 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
21 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
22 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
23 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
24 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
25 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
26 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
27 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
28 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
129 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
201 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
202 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
203 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
232 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
236 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
240 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
241 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
246 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
252 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
253 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0.21
Isolates 6.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.53
Nodule 0.42
Rhizoplane 1.05
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_519107 2162886007 Bacteria 15803
2 JGI24740J21852_10027510 3300001979 Bacteria 1892
3 JGI24739J22299_10006244 3300001989 Bacteria 4497
4 JGI24737J22298_10003931 3300001990 Bacteria 5207
5 JGI24735J21928_10000249 3300002067 Bacteria 18834
6 JGI25162J39368_1000055 3300002737 Bacteria 147236
7 JGI25152J39213_1000372 3300002773 Bacteria 27531
8 JGI25150J39212_1000027 3300002774 Bacteria 106080
9 JGI25151J46595_10000120 3300003187 Bacteria 106401
10 JGI25153J46596_10000090 3300003215 Bacteria 106197
11 rootH1_10005357 3300003316 Bacteria 3060
12 rootH1_10005358 3300003316 Bacteria 3218
13 rootH2_10110554 3300003320 Bacteria 2946
14 rootH2_10134191 3300003320 Bacteria 4573
15 rootL2_10022419 3300003322 Bacteria 1142
16 rootL2_10036122 3300003322 Bacteria 10542
17 rootL2_10092981 3300003322 Bacteria 4964
18 rootL2_10101083 3300003322 Bacteria 2331
19 rootL2_10108057 3300003322 Unclassified 1001
20 rootL2_10379420 3300003322 Unclassified 1208
21 rootH1_10213823 3300003323 Bacteria 2638
22 Ga0055535_1008877 3300003761 Bacteria 1774
23 Ga0055536_1000071 3300003781 Bacteria 93563
24 Ga0065704_10000223 3300005289 Bacteria 110188
25 Ga0065712_10019198 3300005290 Bacteria 1280
26 Ga0065712_10161271 3300005290 Bacteria 1301
27 Ga0065715_10097212 3300005293 Bacteria 3744
28 Ga0065715_10116463 3300005293 Bacteria 2380
29 Ga0065715_10133457 3300005293 Bacteria 1971
30 Ga0065715_10198331 3300005293 Bacteria 1375
31 Ga0065715_10251693 3300005293 Bacteria 1156
32 Ga0065715_10349011 3300005293 Bacteria 954
33 Ga0065707_10117759 3300005295 Bacteria 2204
34 Ga0070658_10143360 3300005327 Bacteria 1996
35 Ga0070676_10315046 3300005328 Bacteria 1065
36 Ga0070676_10867306 3300005328 Bacteria 670
37 Ga0070690_100239853 3300005330 Bacteria 1278
38 Ga0070670_100015977 3300005331 Bacteria 6441
39 Ga0070670_100105188 3300005331 Bacteria 2431
40 Ga0070670_100163016 3300005331 Bacteria 1932
41 Ga0070670_100593233 3300005331 Bacteria 991
42 Ga0070670_100630246 3300005331 Unclassified 961
43 Ga0070670_100708960 3300005331 Bacteria 905
44 Ga0070670_100807484 3300005331 Bacteria 847
45 Ga0070677_10229916 3300005333 Bacteria 910
46 Ga0068869_100030386 3300005334 Bacteria 3792
47 Ga0068869_100120735 3300005334 Unclassified 2004
48 Ga0068869_100306027 3300005334 Bacteria 1285
49 Ga0070682_100058545 3300005337 Bacteria 2430
50 Ga0070682_100075556 3300005337 Bacteria 2167
51 Ga0068868_100013963 3300005338 Bacteria 5908
52 Ga0068868_100493991 3300005338 Bacteria 1071
53 Ga0070689_100050420 3300005340 Bacteria 3216
54 Ga0070689_100962048 3300005340 Bacteria 758
55 Ga0070691_10672169 3300005341 Bacteria 619
56 Ga0070687_100103273 3300005343 Bacteria 1600
57 Ga0070668_100328513 3300005347 Unclassified 1289
58 Ga0070668_100562081 3300005347 Bacteria 994
59 Ga0070669_100035851 3300005353 Bacteria 3594
60 Ga0070669_100284943 3300005353 Bacteria 1325
61 Ga0070669_100637810 3300005353 Unclassified 895
62 Ga0070675_100472263 3300005354 Bacteria 1127
63 Ga0070675_101092999 3300005354 Unclassified 733
64 Ga0070671_100974987 3300005355 Unclassified 742
65 Ga0070674_100039067 3300005356 Bacteria 3204
66 Ga0070674_100187063 3300005356 Bacteria 1590
67 Ga0070674_100549902 3300005356 Bacteria 968
68 Ga0070673_100006253 3300005364 Bacteria 7723
69 Ga0070673_100019255 3300005364 Bacteria 4899
70 Ga0070688_100010924 3300005365 Bacteria 5028
71 Ga0070688_100072411 3300005365 Bacteria 2208
72 Ga0070688_101039169 3300005365 Bacteria 652
73 Ga0070667_100005388 3300005367 Bacteria 10686
74 Ga0070667_100091514 3300005367 Bacteria 2616
75 Ga0070700_101330840 3300005441 Bacteria 605
76 Ga0070663_100542082 3300005455 Bacteria 971
77 Ga0070678_100057855 3300005456 Unclassified 2843
78 Ga0070678_100835886 3300005456 Bacteria 838
79 Ga0068867_100044951 3300005459 Bacteria 3237
80 Ga0068867_101385403 3300005459 Bacteria 652
81 Ga0070685_10009406 3300005466 Bacteria 5049
82 Ga0070685_10083650 3300005466 Unclassified 1917
83 Ga0070685_10257116 3300005466 Unclassified 1159
84 Ga0070685_10581372 3300005466 Unclassified 803
85 Ga0070707_101238514 3300005468 Bacteria 712
86 Ga0070698_100008947 3300005471 Bacteria 10774
87 Ga0070698_100024747 3300005471 Bacteria 6260
88 Ga0070672_100251099 3300005543 Bacteria 1490
89 Ga0070672_100353398 3300005543 Bacteria 1253
90 Ga0070672_100773068 3300005543 Bacteria 844
91 Ga0070672_101705991 3300005543 Unclassified 566
92 Ga0070665_101164677 3300005548 Bacteria 782
93 Ga0070665_101547578 3300005548 Bacteria 671
94 Ga0070664_100905223 3300005564 Bacteria 827
95 Ga0068857_100045158 3300005577 Bacteria 3908
96 Ga0068857_101046150 3300005577 Unclassified 787
97 Ga0068857_101261862 3300005577 Bacteria 716
98 Ga0068857_102065558 3300005577 Bacteria 559
99 Ga0068854_100062601 3300005578 Bacteria 2698
100 Ga0068854_101254598 3300005578 Bacteria 666
101 Ga0068854_101551441 3300005578 Bacteria 602
102 Ga0070702_100483143 3300005615 Bacteria 906
103 Ga0068852_100245567 3300005616 Bacteria 1713
104 Ga0068852_100299827 3300005616 Bacteria 1555
105 Ga0068859_100001403 3300005617 Bacteria 24458
106 Ga0068859_100386870 3300005617 Bacteria 1494
107 Ga0068859_100871504 3300005617 Bacteria 986
108 Ga0068859_101229854 3300005617 Bacteria 825
109 Ga0068859_101368860 3300005617 Bacteria 780
110 Ga0068864_100008785 3300005618 Bacteria 8329
111 Ga0068864_100618394 3300005618 Bacteria 1052
112 Ga0068866_10256171 3300005718 Bacteria 1073
113 Ga0068861_100428917 3300005719 Bacteria 1180
114 Ga0068861_100429281 3300005719 Unclassified 1179
115 Ga0068861_100434836 3300005719 Bacteria 1172
116 Ga0068851_10014056 3300005834 Bacteria 3795
117 Ga0068870_10227970 3300005840 Bacteria 1144
118 Ga0068870_10389330 3300005840 Bacteria 904
119 Ga0068863_100005596 3300005841 Bacteria 12347
120 Ga0068863_100054675 3300005841 Bacteria 3782
121 Ga0068863_100140043 3300005841 Bacteria 2312
122 Ga0068863_100243081 3300005841 Bacteria 1737
123 Ga0068863_100878233 3300005841 Unclassified 896
124 Ga0068863_101184121 3300005841 Bacteria 770
125 Ga0068863_101868283 3300005841 Unclassified 610
126 Ga0068858_100487976 3300005842 Bacteria 1189
127 Ga0068860_100010234 3300005843 Bacteria 9282
128 Ga0068860_100029211 3300005843 Bacteria 5303
129 Ga0068860_100616192 3300005843 Unclassified 1092
130 Ga0068860_101757578 3300005843 Bacteria 642
131 Ga0068862_100359383 3300005844 Unclassified 1353
132 Ga0068862_100486890 3300005844 Bacteria 1168
133 Ga0068862_100561814 3300005844 Unclassified 1091
134 Ga0075366_10041858 3300006195 Unclassified 2712
135 Ga0075366_10345344 3300006195 Unclassified 913
136 Ga0097621_100037413 3300006237 Bacteria 3888
137 Ga0097621_100085642 3300006237 Bacteria 2629
138 Ga0097621_100148670 3300006237 Bacteria 2008
139 Ga0075370_10029467 3300006353 Bacteria 3058
140 Ga0068871_100003646 3300006358 Bacteria 10580
141 Ga0068871_100044561 3300006358 Bacteria 3568
142 Ga0068871_100319738 3300006358 Unclassified 1366
143 Ga0068871_100545073 3300006358 Unclassified 1050
144 Ga0068871_100628456 3300006358 Bacteria 978
145 Ga0075428_100489097 3300006844 Bacteria 1317
146 Ga0075428_100725444 3300006844 Bacteria 1058
147 Ga0075431_102076795 3300006847 Unclassified 523
148 Ga0075434_101303299 3300006871 Bacteria 737
149 Ga0068865_100143434 3300006881 Bacteria 1803
150 Ga0068865_100276354 3300006881 Unclassified 1336
151 Ga0068865_100459750 3300006881 Bacteria 1054
152 Ga0097620_100001403 3300006931 Bacteria 24458
153 Ga0097620_100386859 3300006931 Bacteria 1494
154 Ga0097620_100871731 3300006931 Bacteria 986
155 Ga0097620_101229781 3300006931 Bacteria 825
156 Ga0097620_101368862 3300006931 Bacteria 780
157 Ga0079104_1000023 3300006946 Bacteria 219954
158 Ga0105251_10130387 3300009011 Bacteria 1139
159 Ga0105251_10435710 3300009011 Bacteria 606
160 Ga0105240_10198156 3300009093 Bacteria 2355
161 Ga0111539_10033453 3300009094 Bacteria 6240
162 Ga0111539_10087915 3300009094 Bacteria 3651
163 Ga0111539_11220173 3300009094 Bacteria 873
164 Ga0111539_11893948 3300009094 Unclassified 691
165 Ga0105247_10334939 3300009101 Bacteria 1060
166 Ga0105243_11143282 3300009148 Bacteria 789
167 Ga0105243_11604449 3300009148 Unclassified 677
168 Ga0105241_10306111 3300009174 Bacteria 1365
169 Ga0105241_11338585 3300009174 Bacteria 683
170 Ga0105242_10005938 3300009176 Bacteria 9420
171 Ga0105242_10142255 3300009176 Bacteria 2083
172 Ga0105242_10348638 3300009176 Bacteria 1367
173 Ga0105242_12632106 3300009176 Unclassified 552
174 Ga0105248_11262332 3300009177 Bacteria 835
175 Ga0105237_10002152 3300009545 Bacteria 24808
176 Ga0105237_10089212 3300009545 Bacteria 3073
177 Ga0105237_10175075 3300009545 Bacteria 2146
178 Ga0105237_10394702 3300009545 Bacteria 1388
179 Ga0105249_10066956 3300009553 Bacteria 3308
180 Ga0105249_10226109 3300009553 Bacteria 1844
181 Ga0105249_10463376 3300009553 Unclassified 1308
182 Ga0105249_11321314 3300009553 Bacteria 793
183 Ga0105249_11807052 3300009553 Bacteria 684
184 Ga0105239_10000136 3300010375 Bacteria 102943
185 Ga0105239_10004526 3300010375 Bacteria 16576
186 Ga0105239_10004597 3300010375 Bacteria 16440
187 Ga0105239_10012648 3300010375 Bacteria 9391
188 Ga0157373_10000011 3300013100 Bacteria 195785
189 Ga0157373_10000253 3300013100 Bacteria 43594
190 Ga0157371_10003781 3300013102 Bacteria 13550
191 Ga0157371_10006324 3300013102 Bacteria 9806
192 Ga0157371_10029421 3300013102 Bacteria 3973
193 Ga0157371_10418948 3300013102 Unclassified 982
194 Ga0157370_10002819 3300013104 Bacteria 20765
195 Ga0157370_10005584 3300013104 Bacteria 14088
196 Ga0157370_10015197 3300013104 Bacteria 7840
197 Ga0157370_10085846 3300013104 Bacteria 2957
198 Ga0157370_10104946 3300013104 Bacteria 2645
199 Ga0157369_10000668 3300013105 Bacteria 44187
200 Ga0157369_10084824 3300013105 Bacteria 3385
201 Ga0157369_10252614 3300013105 Bacteria 1840
202 Ga0157374_10169848 3300013296 Bacteria 2127
203 Ga0157374_10467496 3300013296 Bacteria 1263
204 Ga0157378_10012621 3300013297 Bacteria 7395
205 Ga0157378_10016988 3300013297 Bacteria 6380
206 Ga0157378_10029584 3300013297 Bacteria 4837
207 Ga0157378_10319567 3300013297 Bacteria 1508
208 Ga0157378_12404279 3300013297 Bacteria 579
209 Ga0163162_10000184 3300013306 Bacteria 57899
210 Ga0163162_10137703 3300013306 Bacteria 2553
211 Ga0163162_10457293 3300013306 Bacteria 1408
212 Ga0163162_10503607 3300013306 Bacteria 1341
213 Ga0163162_10585003 3300013306 Unclassified 1243
214 Ga0157372_10000245 3300013307 Bacteria 60046
215 Ga0157372_10027032 3300013307 Bacteria 6246
216 Ga0157372_10167279 3300013307 Bacteria 2543
217 Ga0157375_10103756 3300013308 Bacteria 2931
218 Ga0157375_10153543 3300013308 Bacteria 2439
219 Ga0157375_10157342 3300013308 Bacteria 2412
220 Ga0157375_10428148 3300013308 Unclassified 1489
221 Ga0157375_10446017 3300013308 Bacteria 1460
222 Ga0157375_10941007 3300013308 Unclassified 1006
223 Ga0157375_11508176 3300013308 Bacteria 794
224 Ga0163163_10093145 3300014325 Bacteria 3029
225 Ga0163163_11239518 3300014325 Bacteria 808
226 Ga0163163_13011449 3300014325 Unclassified 525
227 Ga0157380_10165628 3300014326 Bacteria 1926
228 Ga0157380_10386238 3300014326 Bacteria 1323
229 Ga0157380_11104087 3300014326 Bacteria 832
230 Ga0157380_11409001 3300014326 Unclassified 747
231 Ga0157380_11766414 3300014326 Bacteria 677
232 Ga0157380_11873018 3300014326 Unclassified 660
233 Ga0182008_10000221 3300014497 Bacteria 44804
234 Ga0157377_10082654 3300014745 Bacteria 1880
235 Ga0157379_10117271 3300014968 Bacteria 2395
236 Ga0157379_10152398 3300014968 Bacteria 2085
237 Ga0157376_10017122 3300014969 Bacteria 5521
238 Ga0157376_10473600 3300014969 Unclassified 1226
239 Ga0157376_11114300 3300014969 Bacteria 815
240 Ga0182006_1000126 3300015261 Bacteria 81813
241 Ga0182006_1000294 3300015261 Bacteria 43965
242 Ga0182006_1001161 3300015261 Bacteria 16599
243 Ga0182006_1028690 3300015261 Bacteria 2261
244 Ga0182006_1074919 3300015261 Bacteria 1246
245 Ga0182006_1084789 3300015261 Unclassified 1149
246 Ga0182006_1087118 3300015261 Bacteria 1129
247 Ga0183373_1007 3300015682 Bacteria 282776
248 Ga0183368_1027 3300015687 Bacteria 976
249 Ga0163161_10000354 3300017792 Bacteria 38694
250 Ga0163161_10049694 3300017792 Bacteria 3032
251 Ga0163161_10235533 3300017792 Bacteria 1422
252 Ga0163161_10271527 3300017792 Bacteria 1327
253 Ga0163161_10352680 3300017792 Unclassified 1170
254 Ga0163161_10544974 3300017792 Unclassified 950
255 Ga0163161_10749881 3300017792 Bacteria 817
256 Ga0209437_100130 3300025233 Bacteria 183731
257 Ga0209258_100625 3300025242 Bacteria 28039
258 Ga0207425_1000004 3300025245 Bacteria 1092421
259 Ga0209646_1004224 3300025246 Bacteria 2648
260 Ga0209148_1000631 3300025254 Bacteria 31019
261 Ga0209129_1000048 3300025258 Bacteria 270192
262 Ga0209129_1003376 3300025258 Bacteria 7015
263 Ga0209025_1000009 3300025294 Bacteria 1092561
264 Ga0209758_1000010 3300025297 Bacteria 1092782
265 Ga0207656_10082389 3300025321 Bacteria 1448
266 Ga0207645_10626058 3300025907 Bacteria 731
267 Ga0207643_10027820 3300025908 Bacteria 3137
268 Ga0207705_10545352 3300025909 Unclassified 901
269 Ga0207695_10242932 3300025913 Bacteria 1701
270 Ga0207695_10319410 3300025913 Bacteria 1442
271 Ga0207671_10005743 3300025914 Bacteria 11313
272 Ga0207671_10041932 3300025914 Bacteria 3387
273 Ga0207671_10075317 3300025914 Bacteria 2524
274 Ga0207671_10239337 3300025914 Bacteria 1425
275 Ga0207662_10892394 3300025918 Unclassified 629
276 Ga0207681_10190700 3300025923 Bacteria 1568
277 Ga0207650_10092415 3300025925 Bacteria 2314
278 Ga0207650_10093256 3300025925 Bacteria 2305
279 Ga0207650_10263240 3300025925 Bacteria 1399
280 Ga0207650_10482608 3300025925 Bacteria 1034
281 Ga0207650_10496030 3300025925 Unclassified 1020
282 Ga0207659_10102096 3300025926 Bacteria 2164
283 Ga0207659_10193576 3300025926 Bacteria 1619
284 Ga0207659_10355849 3300025926 Bacteria 1216
285 Ga0207644_10229109 3300025931 Bacteria 1476
286 Ga0207686_10002663 3300025934 Bacteria 9686
287 Ga0207686_10334825 3300025934 Unclassified 1135
288 Ga0207709_11073263 3300025935 Unclassified 660
289 Ga0207670_10252111 3300025936 Bacteria 1365
290 Ga0207670_11315467 3300025936 Bacteria 613
291 Ga0207669_10366058 3300025937 Bacteria 1119
292 Ga0207669_11109961 3300025937 Unclassified 668
293 Ga0207704_10229869 3300025938 Unclassified 1378
294 Ga0207691_10014368 3300025940 Bacteria 7548
295 Ga0207691_10123397 3300025940 Bacteria 2293
296 Ga0207691_10994768 3300025940 Bacteria 700
297 Ga0207691_11316023 3300025940 Unclassified 596
298 Ga0207689_10007198 3300025942 Bacteria 9772
299 Ga0207689_10028512 3300025942 Bacteria 4671
300 Ga0207689_10274105 3300025942 Unclassified 1397
301 Ga0207679_10772012 3300025945 Bacteria 875
302 Ga0207667_10125026 3300025949 Bacteria 2649
303 Ga0207667_10271469 3300025949 Bacteria 1734
304 Ga0207651_10298276 3300025960 Bacteria 1339
305 Ga0207712_10014943 3300025961 Bacteria 5001
306 Ga0207712_10456171 3300025961 Bacteria 1085
307 Ga0207712_11482137 3300025961 Bacteria 608
308 Ga0207668_10242441 3300025972 Bacteria 1459
309 Ga0207668_10281616 3300025972 Unclassified 1364
310 Ga0207640_10022124 3300025981 Bacteria 3800
311 Ga0207640_10100845 3300025981 Unclassified 2024
312 Ga0207658_10025735 3300025986 Bacteria 4121
313 Ga0207658_10228924 3300025986 Bacteria 1568
314 Ga0207677_10005595 3300026023 Bacteria 6827
315 Ga0207677_10079629 3300026023 Bacteria 2344
316 Ga0207703_10501586 3300026035 Bacteria 1139
317 Ga0207639_10809371 3300026041 Bacteria 873
318 Ga0207708_12037368 3300026075 Bacteria 502
319 Ga0207641_10018346 3300026088 Bacteria 5736
320 Ga0207641_10026195 3300026088 Bacteria 4812
321 Ga0207641_10188003 3300026088 Bacteria 1896
322 Ga0207641_10219062 3300026088 Bacteria 1764
323 Ga0207641_10284877 3300026088 Bacteria 1555
324 Ga0207641_11376715 3300026088 Bacteria 706
325 Ga0207648_10001875 3300026089 Bacteria 22995
326 Ga0207648_10360310 3300026089 Bacteria 1312
327 Ga0207648_10998846 3300026089 Bacteria 784
328 Ga0207676_10012940 3300026095 Bacteria 5993
329 Ga0207676_10081210 3300026095 Bacteria 2634
330 Ga0207674_10053973 3300026116 Bacteria 4094
331 Ga0207674_11074258 3300026116 Unclassified 774
332 Ga0207674_12121551 3300026116 Bacteria 526
333 Ga0207675_100002556 3300026118 Bacteria 18017
334 Ga0207675_100043172 3300026118 Unclassified 4211
335 Ga0207675_100118570 3300026118 Bacteria 2503
336 Ga0207675_100322508 3300026118 Bacteria 1508
337 Ga0207675_100472705 3300026118 Bacteria 1245
338 Ga0207675_100911475 3300026118 Unclassified 895
339 Ga0207683_10560733 3300026121 Bacteria 1056
340 Ga0207683_10836399 3300026121 Unclassified 855
341 Ga0207698_10387456 3300026142 Bacteria 1332
342 Ga0207698_10451596 3300026142 Bacteria 1241
343 Ga0207698_10918985 3300026142 Unclassified 883
344 Ga0207698_11087763 3300026142 Unclassified 812
345 Ga0209281_1000037 3300027111 Bacteria 368555
346 Ga0268265_10495904 3300028380 Unclassified 1150
347 Ga0268264_10024669 3300028381 Bacteria 4911
348 Ga0268264_10390507 3300028381 Bacteria 1335
349 Ga0268264_10646371 3300028381 Bacteria 1046
350 Ga0307515_10000091 3300028794 Bacteria 214014
351 Ga0307515_10001923 3300028794 Bacteria 46075
352 Ga0307513_10316676 3300031456 Bacteria 1320
353 Ga0307513_10625251 3300031456 Bacteria 785
354 Ga0307509_10493807 3300031507 Bacteria 910
355 Ga0307408_100571777 3300031548 Bacteria 1000
356 Ga0307408_101266462 3300031548 Bacteria 690
357 Ga0307516_10549137 3300031730 Bacteria 809
358 Ga0307405_10256386 3300031731 Bacteria 1304
359 Ga0307407_10000001 3300031903 Bacteria 570048
360 Ga0307407_10055771 3300031903 Bacteria 2285
361 Ga0307412_10000237 3300031911 Bacteria 36026
362 Ga0307409_100011555 3300031995 Bacteria 5576
363 Ga0307409_100522544 3300031995 Bacteria 1160
364 Ga0307409_100607605 3300031995 Bacteria 1081
365 Ga0307416_100000008 3300032002 Bacteria 401343
366 Ga0307414_10000283 3300032004 Bacteria 29803
367 Ga0307414_10000656 3300032004 Bacteria 17688
368 Ga0307414_10001968 3300032004 Bacteria 10636
369 Ga0307414_10131431 3300032004 Bacteria 1944
370 Ga0307414_10131933 3300032004 Bacteria 1941
371 Ga0307411_10263481 3300032005 Bacteria 1362
372 Ga0307415_101671612 3300032126 Bacteria 613
373 Ga0307510_10085836 3300033180 Bacteria 3022
374 Ga0373944_0383615 3300035089 Bacteria 539
375 Ga0373955_0241465 3300035172 Bacteria 1082
376 Ga0316574_0359034 3300035398 Unclassified 921
377 Ga0395905_0044817 3300037471 Bacteria 4150
378 Ga0395905_0236819 3300037471 Unclassified 1706
379 Ga0451791_1121280 3300041451 Unclassified 970
380 Ga0451793_0419737 3300041452 Unclassified 541
381 Ga0451807_1261185 3300041486 Bacteria 818
382 Ga0451833_1314917 3300041491 Unclassified 1655
383 Ga0451837_0268285 3300041494 Bacteria 1138
384 Ga0451849_0387086 3300041505 Bacteria 2350
385 Ga0439442_016863 3300042002 Unclassified 1507
386 Ga0439445_0072555 3300042004 Unclassified 954
387 Ga0439432_039672 3300042006 Bacteria 1496
388 Ga0439457_021624 3300042014 Unclassified 1427
389 Ga0450894_032014 3300042131 Unclassified 736
390 Ga0439446_0084551 3300042156 Bacteria 986
391 Ga0439434_0045564 3300042435 Unclassified 1353
392 Ga0439434_0073698 3300042435 Unclassified 1077
393 Ga0439434_0226474 3300042435 Bacteria 635
394 Ga0453683_0079598 3300044673 Bacteria 2052
395 Ga0453683_0350365 3300044673 Unclassified 948
396 Ga0453684_0029795 3300044712 Bacteria 7733
397 Ga0495638_0098391 3300046460 Bacteria 1753
398 Ga0495639_0469036 3300046475 Unclassified 641
399 Ga0495610_0019778 3300046512 Bacteria 3755
400 Ga0495643_0159414 3300046522 Bacteria 1111
401 Ga0495652_0189256 3300046529 Bacteria 1572
402 Ga0495598_0011770 3300046537 Bacteria 2129
403 Ga0495621_0114713 3300046539 Bacteria 1036
404 Ga0495633_0186752 3300046558 Bacteria 953
405 Ga0495611_0101970 3300046648 Bacteria 1333
406 Ga0495625_0047405 3300046660 Bacteria 3098
407 Ga0495625_0286931 3300046660 Unclassified 1057
408 Ga0495625_0368493 3300046660 Bacteria 904
409 Ga0495671_0594567 3300046692 Bacteria 526
410 Ga0496114_0701658 3300048917 Bacteria 887
411 Ga0496115_0867721 3300048918 Bacteria 698
412 Ga0496116_0000064 3300048919 Bacteria 268096
413 Ga0496118_0027303 3300048921 Bacteria 4836
414 Ga0496121_0048258 3300048924 Bacteria 3624
415 Ga0496124_0054365 3300048927 Bacteria 3389
416 Ga0496125_0000036 3300048928 Bacteria 335814
417 Ga0496126_0006959 3300048929 Bacteria 12514
418 Ga0496126_0247723 3300048929 Unclassified 1486
419 Ga0501308_059303 3300049128 Bacteria 575
420 Ga0501300_001853 3300049523 Bacteria 3149
421 Ga0501206_023933 3300049653 Bacteria 882
422 Ga0501217_001006 3300049661 Bacteria 5098
423 Ga0501235_019636 3300049669 Bacteria 1500
424 Ga0501235_042480 3300049669 Bacteria 1042
425 Ga0501238_004140 3300049671 Bacteria 1803
426 Ga0501242_004230 3300049674 Bacteria 1588
427 Ga0501249_000011 3300049679 Bacteria 168084
428 Ga0501257_013642 3300049686 Bacteria 1864
429 Ga0501259_002739 3300049688 Unclassified 2834
430 Ga0501225_0055273 3300049705 Bacteria 1110
431 Ga0501280_013449 3300049776 Bacteria 1157
432 nmdc:mga0k408_24467_c1 3300050493 Unclassified 3413
433 nmdc:mga0k408_314708_c1 3300050493 Bacteria 934
434 nmdc:mga0k408_35844_c1 3300050493 Unclassified 2845
435 nmdc:mga0k408_671_c1 3300050493 Bacteria 13349
436 nmdc:mga07m45_28871_c1 3300050496 Bacteria 3063
437 nmdc:mga08y16_412964_c1 3300050511 Bacteria 1380
438 nmdc:mga08y16_932976_c1 3300050511 Bacteria 852
439 Ga0500641_0002824 3300053096 Bacteria 6156
440 Ga0500594_0122578 3300053118 Bacteria 817
441 Ga0500607_034459 3300053121 Bacteria 2772
442 Ga0500577_0013888 3300053142 Bacteria 2474
443 Ga0500589_020173 3300053147 Bacteria 3043
444 Ga0500622_0002663 3300053156 Bacteria 12672
445 Ga0500622_0008277 3300053156 Bacteria 5833
446 Ga0500661_006668 3300055283 Bacteria 2150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_1121280 Ga0451791_1121280_432_800 122
2 3300005331 Ga0070670_100630246 Ga0070670_1006302462 125
3 3300005354 Ga0070675_100472263 Ga0070675_1004722631 125
4 3300005617 Ga0068859_101368860 Ga0068859_1013688602 125
5 3300006931 Ga0097620_101368862 Ga0097620_1013688622 125
6 3300014325 Ga0163163_13011449 Ga0163163_130114491 125
7 3300025925 Ga0207650_10496030 Ga0207650_104960302 125
8 3300025926 Ga0207659_10355849 Ga0207659_103558491 125
9 3300025937 Ga0207669_11109961 Ga0207669_111099612 125
10 3300031730 Ga0307516_10549137 Ga0307516_105491371 125
11 3300005330 Ga0070690_100239853 Ga0070690_1002398532 127
12 3300005341 Ga0070691_10672169 Ga0070691_106721692 127
13 3300005615 Ga0070702_100483143 Ga0070702_1004831432 127
14 3300026075 Ga0207708_12037368 Ga0207708_120373681 127
15 3300048918 Ga0496115_0867721 Ga0496115_0867721_263_673 128
16 3300026118 Ga0207675_100472705 Ga0207675_1004727051 129
17 3300049128 Ga0501308_059303 Ga0501308_059303_18_449 135
18 3300009094 Ga0111539_10033453 Ga0111539_100334531 136
19 3300050511 nmdc:mga08y16_412964_c1 nmdc:mga08y16_412964_c1_578_1024 136
20 3300009174 Ga0105241_11338585 Ga0105241_113385851 137
21 3300013308 Ga0157375_10446017 Ga0157375_104460172 137
22 3300005331 Ga0070670_100105188 Ga0070670_1001051883 138
23 3300005331 Ga0070670_100163016 Ga0070670_1001630162 138
24 3300005334 Ga0068869_100306027 Ga0068869_1003060272 138
25 3300005338 Ga0068868_100013963 Ga0068868_1000139633 138
26 3300005364 Ga0070673_100006253 Ga0070673_1000062532 138
27 3300005365 Ga0070688_100072411 Ga0070688_1000724112 138
28 3300005466 Ga0070685_10009406 Ga0070685_100094063 138
29 3300005543 Ga0070672_100773068 Ga0070672_1007730681 138
30 3300005718 Ga0068866_10256171 Ga0068866_102561712 138
31 3300005841 Ga0068863_100005596 Ga0068863_10000559611 138
32 3300005843 Ga0068860_101757578 Ga0068860_1017575781 138
33 3300005844 Ga0068862_100359383 Ga0068862_1003593832 138
34 3300006358 Ga0068871_100319738 Ga0068871_1003197383 138
35 3300009553 Ga0105249_11807052 Ga0105249_118070522 138
36 3300013104 Ga0157370_10085846 Ga0157370_100858463 138
37 3300013296 Ga0157374_10169848 Ga0157374_101698481 138
38 3300013296 Ga0157374_10467496 Ga0157374_104674962 138
39 3300013297 Ga0157378_10029584 Ga0157378_100295843 138
40 3300014325 Ga0163163_10093145 Ga0163163_100931453 138
41 3300014968 Ga0157379_10117271 Ga0157379_101172713 138
42 3300015261 Ga0182006_1084789 Ga0182006_10847891 138
43 3300025907 Ga0207645_10626058 Ga0207645_106260581 138
44 3300025925 Ga0207650_10093256 Ga0207650_100932563 138
45 3300025925 Ga0207650_10263240 Ga0207650_102632402 138
46 3300025940 Ga0207691_10994768 Ga0207691_109947682 138
47 3300025942 Ga0207689_10028512 Ga0207689_100285123 138
48 3300025961 Ga0207712_10456171 Ga0207712_104561711 138
49 3300025972 Ga0207668_10242441 Ga0207668_102424412 138
50 3300026023 Ga0207677_10005595 Ga0207677_100055952 138
51 3300026088 Ga0207641_10284877 Ga0207641_102848772 138
52 3300026118 Ga0207675_100043172 Ga0207675_1000431723 138
53 3300028380 Ga0268265_10495904 Ga0268265_104959042 138
54 3300028381 Ga0268264_10646371 Ga0268264_106463712 138
55 3300003322 rootL2_10036122 rootL2_100361224 139
56 3300003323 rootH1_10213823 rootH1_102138234 139
57 3300005293 Ga0065715_10251693 Ga0065715_102516932 139
58 3300005331 Ga0070670_100593233 Ga0070670_1005932331 139
59 3300005338 Ga0068868_100493991 Ga0068868_1004939912 139
60 3300005347 Ga0070668_100562081 Ga0070668_1005620812 139
61 3300005367 Ga0070667_100091514 Ga0070667_1000915142 139
62 3300005441 Ga0070700_101330840 Ga0070700_1013308401 139
63 3300005466 Ga0070685_10083650 Ga0070685_100836502 139
64 3300005466 Ga0070685_10257116 Ga0070685_102571162 139
65 3300005471 Ga0070698_100008947 Ga0070698_1000089477 139
66 3300005616 Ga0068852_100245567 Ga0068852_1002455672 139
67 3300005618 Ga0068864_100618394 Ga0068864_1006183942 139
68 3300005841 Ga0068863_100243081 Ga0068863_1002430811 139
69 3300005841 Ga0068863_100878233 Ga0068863_1008782332 139
70 3300005842 Ga0068858_100487976 Ga0068858_1004879762 139
71 3300005843 Ga0068860_100616192 Ga0068860_1006161922 139
72 3300006237 Ga0097621_100085642 Ga0097621_1000856422 139
73 3300006358 Ga0068871_100044561 Ga0068871_1000445612 139
74 3300006358 Ga0068871_100628456 Ga0068871_1006284562 139
75 3300006844 Ga0075428_100489097 Ga0075428_1004890972 139
76 3300006871 Ga0075434_101303299 Ga0075434_1013032992 139
77 3300009011 Ga0105251_10435710 Ga0105251_104357102 139
78 3300009094 Ga0111539_10087915 Ga0111539_100879152 139
79 3300009094 Ga0111539_11220173 Ga0111539_112201732 139
80 3300009094 Ga0111539_11893948 Ga0111539_118939482 139
81 3300009101 Ga0105247_10334939 Ga0105247_103349392 139
82 3300009148 Ga0105243_11143282 Ga0105243_111432822 139
83 3300009176 Ga0105242_10005938 Ga0105242_100059385 139
84 3300009176 Ga0105242_10142255 Ga0105242_101422552 139
85 3300009177 Ga0105248_11262332 Ga0105248_112623322 139
86 3300009545 Ga0105237_10394702 Ga0105237_103947022 139
87 3300009553 Ga0105249_10066956 Ga0105249_100669563 139
88 3300009553 Ga0105249_10226109 Ga0105249_102261092 139
89 3300013297 Ga0157378_10319567 Ga0157378_103195672 139
90 3300013297 Ga0157378_12404279 Ga0157378_124042791 139
91 3300013306 Ga0163162_10137703 Ga0163162_101377032 139
92 3300013306 Ga0163162_10585003 Ga0163162_105850032 139
93 3300013308 Ga0157375_10103756 Ga0157375_101037562 139
94 3300013308 Ga0157375_10157342 Ga0157375_101573422 139
95 3300013308 Ga0157375_11508176 Ga0157375_115081762 139
96 3300014325 Ga0163163_11239518 Ga0163163_112395182 139
97 3300014326 Ga0157380_10165628 Ga0157380_101656282 139
98 3300014968 Ga0157379_10152398 Ga0157379_101523982 139
99 3300014969 Ga0157376_10017122 Ga0157376_100171223 139
100 3300014969 Ga0157376_10473600 Ga0157376_104736002 139
101 3300014969 Ga0157376_11114300 Ga0157376_111143002 139
102 3300017792 Ga0163161_10235533 Ga0163161_102355332 139
103 3300017792 Ga0163161_10271527 Ga0163161_102715272 139
104 3300017792 Ga0163161_10544974 Ga0163161_105449742 139
105 3300025914 Ga0207671_10239337 Ga0207671_102393373 139
106 3300025934 Ga0207686_10002663 Ga0207686_100026636 139
107 3300025961 Ga0207712_10014943 Ga0207712_100149432 139
108 3300025961 Ga0207712_11482137 Ga0207712_114821371 139
109 3300025981 Ga0207640_10100845 Ga0207640_101008452 139
110 3300025986 Ga0207658_10228924 Ga0207658_102289242 139
111 3300026023 Ga0207677_10079629 Ga0207677_100796294 139
112 3300026035 Ga0207703_10501586 Ga0207703_105015862 139
113 3300026088 Ga0207641_10018346 Ga0207641_100183463 139
114 3300026088 Ga0207641_10188003 Ga0207641_101880032 139
115 3300026095 Ga0207676_10081210 Ga0207676_100812103 139
116 3300026118 Ga0207675_100118570 Ga0207675_1001185702 139
117 3300026142 Ga0207698_10387456 Ga0207698_103874562 139
118 3300026142 Ga0207698_10918985 Ga0207698_109189852 139
119 3300028381 Ga0268264_10390507 Ga0268264_103905072 139
120 3300028794 Ga0307515_10000091 Ga0307515_10000091177 139
121 3300031456 Ga0307513_10316676 Ga0307513_103166762 139
122 3300035089 Ga0373944_0383615 Ga0373944_0383615_19_465 139
123 3300035172 Ga0373955_0241465 Ga0373955_0241465_398_844 139
124 3300046522 Ga0495643_0159414 Ga0495643_0159414_107_553 139
125 3300046537 Ga0495598_0011770 Ga0495598_0011770_1104_1550 139
126 3300046539 Ga0495621_0114713 Ga0495621_0114713_482_928 139
127 3300050511 nmdc:mga08y16_932976_c1 nmdc:mga08y16_932976_c1_229_675 139
128 3300002737 JGI25162J39368_1000055 JGI25162J39368_100005510 140
129 3300003320 rootH2_10134191 rootH2_101341911 140
130 3300003322 rootL2_10092981 rootL2_100929816 140
131 3300005290 Ga0065712_10161271 Ga0065712_101612712 140
132 3300005293 Ga0065715_10116463 Ga0065715_101164634 140
133 3300005337 Ga0070682_100075556 Ga0070682_1000755563 140
134 3300005365 Ga0070688_101039169 Ga0070688_1010391691 140
135 3300005578 Ga0068854_101254598 Ga0068854_1012545982 140
136 3300005617 Ga0068859_100386870 Ga0068859_1003868702 140
137 3300005719 Ga0068861_100429281 Ga0068861_1004292812 140
138 3300005840 Ga0068870_10227970 Ga0068870_102279702 140
139 3300005844 Ga0068862_100486890 Ga0068862_1004868902 140
140 3300006931 Ga0097620_100386859 Ga0097620_1003868592 140
141 3300009093 Ga0105240_10198156 Ga0105240_101981562 140
142 3300010375 Ga0105239_10004526 Ga0105239_100045262 140
143 3300010375 Ga0105239_10004597 Ga0105239_100045972 140
144 3300013102 Ga0157371_10006324 Ga0157371_100063244 140
145 3300013104 Ga0157370_10015197 Ga0157370_100151976 140
146 3300013105 Ga0157369_10000668 Ga0157369_1000066816 140
147 3300014326 Ga0157380_10386238 Ga0157380_103862382 140
148 3300014745 Ga0157377_10082654 Ga0157377_100826542 140
149 3300015261 Ga0182006_1087118 Ga0182006_10871181 140
150 3300017792 Ga0163161_10049694 Ga0163161_100496945 140
151 3300025233 Ga0209437_100130 Ga0209437_10013045 140
152 3300025258 Ga0209129_1003376 Ga0209129_10033766 140
153 3300025908 Ga0207643_10027820 Ga0207643_100278203 140
154 3300025913 Ga0207695_10319410 Ga0207695_103194103 140
155 3300025926 Ga0207659_10193576 Ga0207659_101935762 140
156 3300025931 Ga0207644_10229109 Ga0207644_102291092 140
157 3300025936 Ga0207670_10252111 Ga0207670_102521112 140
158 3300025940 Ga0207691_10014368 Ga0207691_100143682 140
159 3300025949 Ga0207667_10271469 Ga0207667_102714692 140
160 3300025960 Ga0207651_10298276 Ga0207651_102982762 140
161 3300026118 Ga0207675_100911475 Ga0207675_1009114752 140
162 3300028794 Ga0307515_10001923 Ga0307515_100019237 140
163 3300041491 Ga0451833_1314917 Ga0451833_1314917_775_1221 140
164 3300046529 Ga0495652_0189256 Ga0495652_0189256_425_871 140
165 3300046692 Ga0495671_0594567 Ga0495671_0594567_41_487 140
166 3300048919 Ga0496116_0000064 Ga0496116_0000064_83105_83548 140
167 3300048921 Ga0496118_0027303 Ga0496118_0027303_2198_2641 140
168 3300048927 Ga0496124_0054365 Ga0496124_0054365_921_1364 140
169 3300048928 Ga0496125_0000036 Ga0496125_0000036_308713_309156 140
170 3300048929 Ga0496126_0006959 Ga0496126_0006959_12059_12502 140
171 3300005293 Ga0065715_10198331 Ga0065715_101983311 141
172 3300005327 Ga0070658_10143360 Ga0070658_101433603 141
173 3300005578 Ga0068854_100062601 Ga0068854_1000626011 141
174 3300005841 Ga0068863_100054675 Ga0068863_1000546752 141
175 3300006195 Ga0075366_10041858 Ga0075366_100418582 141
176 3300009545 Ga0105237_10089212 Ga0105237_100892122 141
177 3300014326 Ga0157380_11766414 Ga0157380_117664142 141
178 3300025909 Ga0207705_10545352 Ga0207705_105453522 141
179 3300025914 Ga0207671_10041932 Ga0207671_100419322 141
180 3300025981 Ga0207640_10022124 Ga0207640_100221243 141
181 3300026088 Ga0207641_10026195 Ga0207641_100261953 141
182 3300026116 Ga0207674_12121551 Ga0207674_121215511 141
183 3300032004 Ga0307414_10131431 Ga0307414_101314312 141
184 3300046475 Ga0495639_0469036 Ga0495639_0469036_142_588 141
185 3300048917 Ga0496114_0701658 Ga0496114_0701658_62_511 141
186 3300050493 nmdc:mga0k408_24467_c1 nmdc:mga0k408_24467_c1_895_1341 141
187 3300005290 Ga0065712_10019198 Ga0065712_100191982 142
188 3300005328 Ga0070676_10315046 Ga0070676_103150462 142
189 3300005340 Ga0070689_100050420 Ga0070689_1000504202 142
190 3300005459 Ga0068867_101385403 Ga0068867_1013854031 142
191 3300014326 Ga0157380_11104087 Ga0157380_111040872 142
192 3300015682 Ga0183373_1007 Ga0183373_1007114 142
193 3300015687 Ga0183368_1027 Ga0183368_10272 142
194 3300026041 Ga0207639_10809371 Ga0207639_108093712 142
195 3300026089 Ga0207648_10998846 Ga0207648_109988462 142
196 3300026121 Ga0207683_10560733 Ga0207683_105607332 142
197 3300048929 Ga0496126_0247723 Ga0496126_0247723_100_549 142
198 iso_pu_bacteria 2643221667 2644370428 142
199 iso_pu_bacteria 2977268062 2977269184 142
200 3300026121 Ga0207683_10836399 Ga0207683_108363992 143
201 3300049653 Ga0501206_023933 Ga0501206_023933_34_489 143
202 3300049669 Ga0501235_019636 Ga0501235_019636_336_791 143
203 3300049674 Ga0501242_004230 Ga0501242_004230_203_658 143
204 3300049686 Ga0501257_013642 Ga0501257_013642_220_675 143
205 3300049688 Ga0501259_002739 Ga0501259_002739_2082_2537 143
206 3300049705 Ga0501225_0055273 Ga0501225_0055273_97_552 143
207 iso_pu_bacteria 2513020052 2513232691 143
208 iso_pu_bacteria 2904555929 2904556081 143
209 iso_pu_bacteria 2511231000 2511231873 144
210 iso_pu_bacteria 2582581281 2585157070 144
211 iso_pu_bacteria 2582581282 2585161210 144
212 iso_pu_bacteria 2588253712 2588447095 144
213 iso_pu_bacteria 2643221600 2644010474 144
214 iso_pu_bacteria 2643221716 2644644130 144
215 iso_pu_bacteria 2738541279 2738734091 144
216 iso_pu_bacteria 2738541285 2738766629 144
217 iso_pu_bacteria 2738543007 2739215672 144
218 iso_pu_bacteria 2739367651 2739587214 144
219 iso_pu_bacteria 2739367866 2740032979 144
220 iso_pu_bacteria 2802428842 2802653169 144
221 iso_pu_bacteria 2842722452 2842726687 144
222 iso_pu_bacteria 2849281842 2849286274 144
223 iso_pu_bacteria 2881359912 2881363586 144
224 iso_pu_bacteria 2902048731 2902052561 144
225 iso_pu_bacteria 2919191525 2919193541 144
226 iso_pu_bacteria 2919692658 2919693299 144
227 iso_pu_bacteria 2929150217 2929152469 144
228 iso_pu_bacteria 2929239360 2929242281 144
229 iso_pu_bacteria 2932082852 2932084663 144
230 iso_pu_bacteria 8054307821 8054311815 144
231 iso_pu_bacteria 8055419101 8055420850 144
232 3300037471 Ga0395905_0044817 Ga0395905_0044817_2217_2660 145
233 iso_pu_bacteria 2738543023 2739301474 145
234 iso_pu_bacteria 2775506987 2776613711 145
235 3300005331 Ga0070670_100807484 Ga0070670_1008074842 146
236 3300005466 Ga0070685_10581372 Ga0070685_105813721 146
237 3300009176 Ga0105242_10348638 Ga0105242_103486382 146
238 3300013100 Ga0157373_10000011 Ga0157373_10000011115 146
239 3300013104 Ga0157370_10002819 Ga0157370_100028196 146
240 3300013104 Ga0157370_10005584 Ga0157370_1000558413 146
241 3300003320 rootH2_10110554 rootH2_101105542 147
242 3300003322 rootL2_10101083 rootL2_101010833 147
243 3300005293 Ga0065715_10133457 Ga0065715_101334572 147
244 3300005331 Ga0070670_100015977 Ga0070670_1000159776 147
245 3300005331 Ga0070670_100708960 Ga0070670_1007089602 147
246 3300005333 Ga0070677_10229916 Ga0070677_102299162 147
247 3300005334 Ga0068869_100120735 Ga0068869_1001207352 147
248 3300005337 Ga0070682_100058545 Ga0070682_1000585453 147
249 3300005340 Ga0070689_100962048 Ga0070689_1009620482 147
250 3300005347 Ga0070668_100328513 Ga0070668_1003285133 147
251 3300005353 Ga0070669_100637810 Ga0070669_1006378102 147
252 3300005356 Ga0070674_100039067 Ga0070674_1000390672 147
253 3300005364 Ga0070673_100019255 Ga0070673_1000192553 147
254 3300005456 Ga0070678_100835886 Ga0070678_1008358862 147
255 3300005459 Ga0068867_100044951 Ga0068867_1000449511 147
256 3300005543 Ga0070672_100353398 Ga0070672_1003533982 147
257 3300005548 Ga0070665_101164677 Ga0070665_1011646772 147
258 3300005841 Ga0068863_101184121 Ga0068863_1011841212 147
259 3300005843 Ga0068860_100029211 Ga0068860_1000292112 147
260 3300005844 Ga0068862_100561814 Ga0068862_1005618141 147
261 3300006195 Ga0075366_10345344 Ga0075366_103453442 147
262 3300006844 Ga0075428_100725444 Ga0075428_1007254442 147
263 3300006847 Ga0075431_102076795 Ga0075431_1020767952 147
264 3300006881 Ga0068865_100143434 Ga0068865_1001434342 147
265 3300006881 Ga0068865_100276354 Ga0068865_1002763542 147
266 3300009148 Ga0105243_11604449 Ga0105243_116044491 147
267 3300009176 Ga0105242_12632106 Ga0105242_126321061 147
268 3300009553 Ga0105249_10463376 Ga0105249_104633762 147
269 3300009553 Ga0105249_11321314 Ga0105249_113213142 147
270 3300013308 Ga0157375_10941007 Ga0157375_109410072 147
271 3300025925 Ga0207650_10092415 Ga0207650_100924152 147
272 3300025925 Ga0207650_10482608 Ga0207650_104826082 147
273 3300025926 Ga0207659_10102096 Ga0207659_101020963 147
274 3300025934 Ga0207686_10334825 Ga0207686_103348253 147
275 3300025935 Ga0207709_11073263 Ga0207709_110732631 147
276 3300025936 Ga0207670_11315467 Ga0207670_113154672 147
277 3300025938 Ga0207704_10229869 Ga0207704_102298692 147
278 3300025940 Ga0207691_10123397 Ga0207691_101233972 147
279 3300025942 Ga0207689_10274105 Ga0207689_102741052 147
280 3300025972 Ga0207668_10281616 Ga0207668_102816161 147
281 3300026088 Ga0207641_11376715 Ga0207641_113767151 147
282 3300026089 Ga0207648_10001875 Ga0207648_100018757 147
283 3300026118 Ga0207675_100322508 Ga0207675_1003225082 147
284 3300033180 Ga0307510_10085836 Ga0307510_100858365 147
285 3300035398 Ga0316574_0359034 Ga0316574_0359034_57_500 147
286 3300041494 Ga0451837_0268285 Ga0451837_0268285_403_846 147
287 3300042006 Ga0439432_039672 Ga0439432_039672_977_1420 147
288 3300048924 Ga0496121_0048258 Ga0496121_0048258_2094_2537 147
289 3300049679 Ga0501249_000011 Ga0501249_000011_130150_130593 147
290 3300049776 Ga0501280_013449 Ga0501280_013449_651_1094 147
291 3300050493 nmdc:mga0k408_314708_c1 nmdc:mga0k408_314708_c1_270_713 147
292 3300053096 Ga0500641_0002824 Ga0500641_0002824_3784_4227 147
293 3300053118 Ga0500594_0122578 Ga0500594_0122578_112_555 147
294 3300053147 Ga0500589_020173 Ga0500589_020173_1132_1575 147
295 3300001979 JGI24740J21852_10027510 JGI24740J21852_100275103 148
296 3300001989 JGI24739J22299_10006244 JGI24739J22299_100062443 148
297 3300001990 JGI24737J22298_10003931 JGI24737J22298_100039314 148
298 3300002067 JGI24735J21928_10000249 JGI24735J21928_1000024911 148
299 3300002773 JGI25152J39213_1000372 JGI25152J39213_100037210 148
300 3300002774 JGI25150J39212_1000027 JGI25150J39212_100002710 148
301 3300003187 JGI25151J46595_10000120 JGI25151J46595_1000012074 148
302 3300003215 JGI25153J46596_10000090 JGI25153J46596_1000009074 148
303 3300003316 rootH1_10005357 rootH1_100053575 148
304 3300003316 rootH1_10005358 rootH1_100053585 148
305 3300003322 rootL2_10022419 rootL2_100224192 148
306 3300003322 rootL2_10108057 rootL2_101080572 148
307 3300003322 rootL2_10379420 rootL2_103794202 148
308 3300003761 Ga0055535_1008877 Ga0055535_10088772 148
309 3300003781 Ga0055536_1000071 Ga0055536_100007160 148
310 3300005293 Ga0065715_10097212 Ga0065715_100972122 148
311 3300005293 Ga0065715_10349011 Ga0065715_103490111 148
312 3300005295 Ga0065707_10117759 Ga0065707_101177592 148
313 3300005328 Ga0070676_10867306 Ga0070676_108673061 148
314 3300005334 Ga0068869_100030386 Ga0068869_1000303862 148
315 3300005343 Ga0070687_100103273 Ga0070687_1001032732 148
316 3300005353 Ga0070669_100035851 Ga0070669_1000358516 148
317 3300005353 Ga0070669_100284943 Ga0070669_1002849432 148
318 3300005354 Ga0070675_101092999 Ga0070675_1010929992 148
319 3300005355 Ga0070671_100974987 Ga0070671_1009749871 148
320 3300005356 Ga0070674_100187063 Ga0070674_1001870633 148
321 3300005356 Ga0070674_100549902 Ga0070674_1005499022 148
322 3300005365 Ga0070688_100010924 Ga0070688_1000109242 148
323 3300005367 Ga0070667_100005388 Ga0070667_1000053884 148
324 3300005455 Ga0070663_100542082 Ga0070663_1005420822 148
325 3300005456 Ga0070678_100057855 Ga0070678_1000578552 148
326 3300005468 Ga0070707_101238514 Ga0070707_1012385141 148
327 3300005471 Ga0070698_100024747 Ga0070698_1000247472 148
328 3300005543 Ga0070672_100251099 Ga0070672_1002510991 148
329 3300005543 Ga0070672_101705991 Ga0070672_1017059911 148
330 3300005548 Ga0070665_101547578 Ga0070665_1015475782 148
331 3300005564 Ga0070664_100905223 Ga0070664_1009052231 148
332 3300005577 Ga0068857_100045158 Ga0068857_1000451582 148
333 3300005577 Ga0068857_101046150 Ga0068857_1010461502 148
334 3300005577 Ga0068857_101261862 Ga0068857_1012618621 148
335 3300005577 Ga0068857_102065558 Ga0068857_1020655581 148
336 3300005578 Ga0068854_101551441 Ga0068854_1015514411 148
337 3300005616 Ga0068852_100299827 Ga0068852_1002998272 148
338 3300005617 Ga0068859_100001403 Ga0068859_10000140320 148
339 3300005617 Ga0068859_100871504 Ga0068859_1008715042 148
340 3300005617 Ga0068859_101229854 Ga0068859_1012298542 148
341 3300005618 Ga0068864_100008785 Ga0068864_1000087854 148
342 3300005719 Ga0068861_100428917 Ga0068861_1004289172 148
343 3300005719 Ga0068861_100434836 Ga0068861_1004348361 148
344 3300005834 Ga0068851_10014056 Ga0068851_100140563 148
345 3300005840 Ga0068870_10389330 Ga0068870_103893301 148
346 3300005841 Ga0068863_100140043 Ga0068863_1001400432 148
347 3300005841 Ga0068863_101868283 Ga0068863_1018682831 148
348 3300005843 Ga0068860_100010234 Ga0068860_10001023410 148
349 3300006237 Ga0097621_100037413 Ga0097621_1000374132 148
350 3300006237 Ga0097621_100148670 Ga0097621_1001486702 148
351 3300006353 Ga0075370_10029467 Ga0075370_100294673 148
352 3300006358 Ga0068871_100003646 Ga0068871_1000036466 148
353 3300006358 Ga0068871_100545073 Ga0068871_1005450733 148
354 3300006881 Ga0068865_100459750 Ga0068865_1004597502 148
355 3300006931 Ga0097620_100001403 Ga0097620_10000140320 148
356 3300006931 Ga0097620_100871731 Ga0097620_1008717312 148
357 3300006931 Ga0097620_101229781 Ga0097620_1012297812 148
358 3300006946 Ga0079104_1000023 Ga0079104_10000237 148
359 3300009011 Ga0105251_10130387 Ga0105251_101303872 148
360 3300009174 Ga0105241_10306111 Ga0105241_103061112 148
361 3300009545 Ga0105237_10002152 Ga0105237_100021524 148
362 3300009545 Ga0105237_10175075 Ga0105237_101750751 148
363 3300010375 Ga0105239_10000136 Ga0105239_100001365 148
364 3300010375 Ga0105239_10012648 Ga0105239_100126483 148
365 3300013102 Ga0157371_10029421 Ga0157371_100294213 148
366 3300013102 Ga0157371_10418948 Ga0157371_104189482 148
367 3300013104 Ga0157370_10104946 Ga0157370_101049463 148
368 3300013105 Ga0157369_10084824 Ga0157369_100848243 148
369 3300013105 Ga0157369_10252614 Ga0157369_102526142 148
370 3300013297 Ga0157378_10012621 Ga0157378_100126217 148
371 3300013297 Ga0157378_10016988 Ga0157378_100169883 148
372 3300013306 Ga0163162_10000184 Ga0163162_1000018459 148
373 3300013306 Ga0163162_10457293 Ga0163162_104572932 148
374 3300013306 Ga0163162_10503607 Ga0163162_105036072 148
375 3300013307 Ga0157372_10000245 Ga0157372_1000024549 148
376 3300013307 Ga0157372_10027032 Ga0157372_100270326 148
377 3300013307 Ga0157372_10167279 Ga0157372_101672795 148
378 3300013308 Ga0157375_10153543 Ga0157375_101535432 148
379 3300013308 Ga0157375_10428148 Ga0157375_104281482 148
380 3300014326 Ga0157380_11409001 Ga0157380_114090011 148
381 3300014326 Ga0157380_11873018 Ga0157380_118730181 148
382 3300014497 Ga0182008_10000221 Ga0182008_1000022122 148
383 3300015261 Ga0182006_1000126 Ga0182006_100012629 148
384 3300015261 Ga0182006_1000294 Ga0182006_100029438 148
385 3300015261 Ga0182006_1001161 Ga0182006_10011615 148
386 3300015261 Ga0182006_1074919 Ga0182006_10749192 148
387 3300017792 Ga0163161_10000354 Ga0163161_1000035427 148
388 3300017792 Ga0163161_10352680 Ga0163161_103526801 148
389 3300017792 Ga0163161_10749881 Ga0163161_107498812 148
390 3300025242 Ga0209258_100625 Ga0209258_1006258 148
391 3300025245 Ga0207425_1000004 Ga0207425_1000004219 148
392 3300025246 Ga0209646_1004224 Ga0209646_10042242 148
393 3300025254 Ga0209148_1000631 Ga0209148_10006318 148
394 3300025258 Ga0209129_1000048 Ga0209129_1000048219 148
395 3300025294 Ga0209025_1000009 Ga0209025_1000009219 148
396 3300025297 Ga0209758_1000010 Ga0209758_1000010220 148
397 3300025321 Ga0207656_10082389 Ga0207656_100823892 148
398 3300025913 Ga0207695_10242932 Ga0207695_102429322 148
399 3300025914 Ga0207671_10005743 Ga0207671_100057435 148
400 3300025914 Ga0207671_10075317 Ga0207671_100753173 148
401 3300025918 Ga0207662_10892394 Ga0207662_108923941 148
402 3300025923 Ga0207681_10190700 Ga0207681_101907002 148
403 3300025937 Ga0207669_10366058 Ga0207669_103660582 148
404 3300025940 Ga0207691_11316023 Ga0207691_113160231 148
405 3300025942 Ga0207689_10007198 Ga0207689_1000719810 148
406 3300025945 Ga0207679_10772012 Ga0207679_107720122 148
407 3300025949 Ga0207667_10125026 Ga0207667_101250264 148
408 3300025986 Ga0207658_10025735 Ga0207658_100257353 148
409 3300026088 Ga0207641_10219062 Ga0207641_102190622 148
410 3300026089 Ga0207648_10360310 Ga0207648_103603102 148
411 3300026095 Ga0207676_10012940 Ga0207676_100129404 148
412 3300026116 Ga0207674_10053973 Ga0207674_100539734 148
413 3300026116 Ga0207674_11074258 Ga0207674_110742581 148
414 3300026118 Ga0207675_100002556 Ga0207675_1000025562 148
415 3300026142 Ga0207698_10451596 Ga0207698_104515962 148
416 3300026142 Ga0207698_11087763 Ga0207698_110877632 148
417 3300027111 Ga0209281_1000037 Ga0209281_1000037229 148
418 3300028381 Ga0268264_10024669 Ga0268264_100246694 148
419 3300031456 Ga0307513_10625251 Ga0307513_106252511 148
420 3300031507 Ga0307509_10493807 Ga0307509_104938072 148
421 3300031548 Ga0307408_100571777 Ga0307408_1005717771 148
422 3300031548 Ga0307408_101266462 Ga0307408_1012664622 148
423 3300031731 Ga0307405_10256386 Ga0307405_102563862 148
424 3300031903 Ga0307407_10000001 Ga0307407_1000000195 148
425 3300031903 Ga0307407_10055771 Ga0307407_100557712 148
426 3300031995 Ga0307409_100011555 Ga0307409_1000115555 148
427 3300031995 Ga0307409_100522544 Ga0307409_1005225442 148
428 3300031995 Ga0307409_100607605 Ga0307409_1006076052 148
429 3300032002 Ga0307416_100000008 Ga0307416_100000008294 148
430 3300032004 Ga0307414_10000283 Ga0307414_100002835 148
431 3300032004 Ga0307414_10001968 Ga0307414_100019684 148
432 3300032004 Ga0307414_10131933 Ga0307414_101319331 148
433 3300032005 Ga0307411_10263481 Ga0307411_102634812 148
434 3300032126 Ga0307415_101671612 Ga0307415_1016716121 148
435 3300037471 Ga0395905_0236819 Ga0395905_0236819_1112_1558 148
436 3300041452 Ga0451793_0419737 Ga0451793_0419737_63_512 148
437 3300041486 Ga0451807_1261185 Ga0451807_1261185_171_617 148
438 3300041505 Ga0451849_0387086 Ga0451849_0387086_479_925 148
439 3300042002 Ga0439442_016863 Ga0439442_016863_231_677 148
440 3300042004 Ga0439445_0072555 Ga0439445_0072555_74_520 148
441 3300042014 Ga0439457_021624 Ga0439457_021624_934_1380 148
442 3300042131 Ga0450894_032014 Ga0450894_032014_86_532 148
443 3300042156 Ga0439446_0084551 Ga0439446_0084551_392_841 148
444 3300042435 Ga0439434_0045564 Ga0439434_0045564_209_658 148
445 3300042435 Ga0439434_0073698 Ga0439434_0073698_129_581 148
446 3300042435 Ga0439434_0226474 Ga0439434_0226474_24_470 148
447 3300044673 Ga0453683_0079598 Ga0453683_0079598_1076_1522 148
448 3300044673 Ga0453683_0350365 Ga0453683_0350365_477_923 148
449 3300044712 Ga0453684_0029795 Ga0453684_0029795_3628_4074 148
450 3300046460 Ga0495638_0098391 Ga0495638_0098391_1055_1501 148
451 3300046512 Ga0495610_0019778 Ga0495610_0019778_2129_2578 148
452 3300046558 Ga0495633_0186752 Ga0495633_0186752_491_937 148
453 3300046648 Ga0495611_0101970 Ga0495611_0101970_863_1312 148
454 3300046660 Ga0495625_0047405 Ga0495625_0047405_133_579 148
455 3300046660 Ga0495625_0286931 Ga0495625_0286931_251_718 148
456 3300046660 Ga0495625_0368493 Ga0495625_0368493_48_494 148
457 3300049523 Ga0501300_001853 Ga0501300_001853_2446_2895 148
458 3300049661 Ga0501217_001006 Ga0501217_001006_3540_3989 148
459 3300049669 Ga0501235_042480 Ga0501235_042480_541_990 148
460 3300049671 Ga0501238_004140 Ga0501238_004140_1107_1556 148
461 3300050493 nmdc:mga0k408_35844_c1 nmdc:mga0k408_35844_c1_733_1179 148
462 3300050493 nmdc:mga0k408_671_c1 nmdc:mga0k408_671_c1_10057_10506 148
463 3300050496 nmdc:mga07m45_28871_c1 nmdc:mga07m45_28871_c1_250_696 148
464 3300053121 Ga0500607_034459 Ga0500607_034459_1540_1986 148
465 3300053142 Ga0500577_0013888 Ga0500577_0013888_686_1132 148
466 3300053156 Ga0500622_0002663 Ga0500622_0002663_1062_1508 148
467 3300053156 Ga0500622_0008277 Ga0500622_0008277_1842_2300 148
468 3300055283 Ga0500661_006668 Ga0500661_006668_648_1094 148
469 2162886007 SwRhRL2b_contig_519107 SwRhRL2b_0013.00000530 149
470 3300005289 Ga0065704_10000223 Ga0065704_1000022389 149
471 3300013100 Ga0157373_10000253 Ga0157373_1000025312 149
472 3300013102 Ga0157371_10003781 Ga0157371_1000378116 149
473 3300015261 Ga0182006_1028690 Ga0182006_10286903 149
474 3300031911 Ga0307412_10000237 Ga0307412_1000023722 149
475 3300032004 Ga0307414_10000656 Ga0307414_1000065614 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07609

DUF1572

Protein of unknown function (DUF1572)

19

171

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8133 3 149
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.8065 3 146
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.7961 3 146
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7821 4 146
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.7789 4 147
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8156 3 146 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7851 3 146 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7771 3 145 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7653 9 143 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7515 5 145 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A349PZ45-F1-model_v4 DinB superfamily protein 0.9951 1 104
AF-A0A1M4YR70-F1-model_v4 DinB superfamily protein 0.9844 3 149
AF-A0A1I5B1G0-F1-model_v4 DinB superfamily protein 0.9829 1 149
AF-A0A495SBK3-F1-model_v4 Uncharacterized protein DUF1572 0.9827 1 149
AF-A0A848FT22-F1-model_v4 DUF1572 family protein 0.9824 1 147

Feature Viewer

pLDDT pTM Quality
95.26 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map