F451246

General Info

Members Datasets Scaffolds Average Seq Length
474 383 948 219

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0234564|Ga0495684_0234564_398_1141
Length 247
Sequence MDQDRPKPDLIIFDCGVLVDSELLSCRCLSEVLAEFGLQLSVEQALELFLGRSTKAIEQYYRDLGQALPDDFFPRLKARVLETFAEALQPIAGVGAVLSELETPRCVASSSDLDRVSLSLDVTGLAPHFGDRLYTAQMVRHGKPAPDLFLHAAEKMQASPSRTLVIEDSVSGVQAAKAAGMMVWGFVGGGHYRARDGRAILSAAGADRVFAAGSISLPATPRTRSQRCCRCRAPRRSGWCRCVSPSG

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
61 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
62 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
63 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
100 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
101 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
102 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
227 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
228 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
229 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
230 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
231 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
232 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
233 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
234 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
235 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
236 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
237 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
238 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
239 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
240 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
241 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
242 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
243 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
244 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
245 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
246 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
247 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
248 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
249 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
250 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
251 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
252 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
253 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
254 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
255 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
256 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
257 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
258 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
259 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
260 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
261 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
262 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
263 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
264 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
265 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
266 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
267 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
268 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
269 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
270 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
271 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
272 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
273 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
274 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
275 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
276 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
277 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
278 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
279 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
280 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
281 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
282 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
283 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
284 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
285 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
286 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
287 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
288 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
289 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
290 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
291 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
292 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
293 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
294 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
295 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
296 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
297 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
298 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
299 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
300 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
301 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
302 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
303 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
304 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
305 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
306 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
307 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
308 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
309 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
310 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
311 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
312 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
313 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
314 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
315 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
316 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
317 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
318 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
319 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
320 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
321 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
322 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
323 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
324 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
325 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
326 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
327 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
328 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
329 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
330 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
331 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
332 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
333 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
334 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
335 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
336 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
337 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
338 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
339 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
340 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
341 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
342 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
343 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
344 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
345 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
346 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
347 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
348 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
349 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
350 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
351 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
352 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
353 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
354 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
355 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
356 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
357 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
358 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
359 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
360 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
361 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
362 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
363 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
364 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
365 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
366 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
367 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
368 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
369 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
370 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
371 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
372 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
373 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
374 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
375 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
376 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
377 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
378 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
379 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
380 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
381 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
382 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
383 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.88
Metatranscriptomes 0
Isolates 33.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.5
Nodule 26.79
Rhizoplane 5.91
Rhizosphere 40.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_0234564 3300047471 Bacteria 1341
2 JGI25153J46596_10002408 3300003215 Bacteria 10802
3 JGI25153J46596_10003304 3300003215 Bacteria 9062
4 JGI25153J46596_10023334 3300003215 Bacteria 2258
5 rootL2_10279811 3300003322 Bacteria 1418
6 JGI25160J50197_1014111 3300003354 Bacteria 2688
7 Ga0055531_10024686 3300003794 Bacteria 2208
8 Ga0065165_1004881 3300005262 Bacteria 7928
9 Ga0070676_10568056 3300005328 Bacteria 814
10 Ga0070670_100125611 3300005331 Bacteria 2214
11 Ga0068869_100299651 3300005334 Bacteria 1298
12 Ga0070666_10097617 3300005335 Bacteria 2023
13 Ga0070668_100117009 3300005347 Bacteria 2126
14 Ga0070668_100182332 3300005347 Bacteria 1716
15 Ga0070669_100294807 3300005353 Bacteria 1303
16 Ga0070671_100038513 3300005355 Bacteria 3968
17 Ga0070667_100149506 3300005367 Bacteria 2051
18 Ga0070667_100426273 3300005367 Bacteria 1210
19 Ga0070714_100464155 3300005435 Bacteria 1204
20 Ga0070710_10530978 3300005437 Bacteria 810
21 Ga0070711_100002401 3300005439 Bacteria 10677
22 Ga0070663_100234404 3300005455 Bacteria 1446
23 Ga0070663_101030940 3300005455 Bacteria 716
24 Ga0070678_100523901 3300005456 Bacteria 1049
25 Ga0070662_100032032 3300005457 Bacteria 3694
26 Ga0070662_100401258 3300005457 Bacteria 1132
27 Ga0070662_100694056 3300005457 Bacteria 861
28 Ga0068853_100170510 3300005539 Bacteria 1969
29 Ga0070665_100129482 3300005548 Bacteria 2526
30 Ga0068855_100464620 3300005563 Bacteria 1379
31 Ga0070664_100503105 3300005564 Bacteria 1117
32 Ga0068854_100115762 3300005578 Bacteria 2028
33 Ga0068854_100288947 3300005578 Bacteria 1322
34 Ga0068856_100196420 3300005614 Bacteria 2032
35 Ga0068852_100012064 3300005616 Bacteria 6542
36 Ga0068852_100468586 3300005616 Bacteria 1250
37 Ga0068851_10161040 3300005834 Bacteria 1233
38 Ga0075365_10018188 3300006038 Bacteria 4316
39 Ga0075365_10079599 3300006038 Bacteria 2217
40 Ga0075365_10113515 3300006038 Bacteria 1864
41 Ga0075368_10015880 3300006042 Bacteria 2798
42 Ga0075363_100006188 3300006048 Bacteria 5410
43 Ga0075364_10077116 3300006051 Bacteria 2200
44 Ga0075364_10215956 3300006051 Bacteria 1301
45 Ga0070716_100637955 3300006173 Bacteria 806
46 Ga0070712_100254175 3300006175 Bacteria 1406
47 Ga0075362_10008309 3300006177 Bacteria 3964
48 Ga0075367_10027483 3300006178 Bacteria 3237
49 Ga0075367_10043660 3300006178 Bacteria 2626
50 Ga0075367_10445570 3300006178 Bacteria 820
51 Ga0075369_10102741 3300006186 Bacteria 1283
52 Ga0075369_10130815 3300006186 Bacteria 1140
53 Ga0075369_10164811 3300006186 Bacteria 1016
54 Ga0075366_10054681 3300006195 Bacteria 2371
55 Ga0075370_10053280 3300006353 Bacteria 2296
56 Ga0075370_10280893 3300006353 Bacteria 989
57 Ga0099823_1096512 3300006944 Bacteria 945
58 Ga0105240_10004337 3300009093 Bacteria 21648
59 Ga0105245_10018598 3300009098 Bacteria 6077
60 Ga0105243_10483080 3300009148 Bacteria 1170
61 Ga0105241_10007558 3300009174 Bacteria 7991
62 Ga0105241_10037331 3300009174 Bacteria 3659
63 Ga0105241_10061229 3300009174 Bacteria 2898
64 Ga0105248_10159221 3300009177 Bacteria 2547
65 Ga0105248_10210797 3300009177 Bacteria 2189
66 Ga0105237_10025698 3300009545 Bacteria 6020
67 Ga0105237_10077329 3300009545 Bacteria 3318
68 Ga0105238_10035637 3300009551 Bacteria 5057
69 Ga0105249_10492916 3300009553 Bacteria 1269
70 Ga0105249_10528195 3300009553 Bacteria 1228
71 Ga0105239_10008922 3300010375 Bacteria 11345
72 Ga0105239_10057044 3300010375 Bacteria 4284
73 Ga0105239_10141232 3300010375 Bacteria 2683
74 Ga0105239_10275908 3300010375 Bacteria 1892
75 Ga0105239_10559083 3300010375 Bacteria 1303
76 Ga0105246_10034959 3300011119 Bacteria 3354
77 Ga0157374_10620963 3300013296 Bacteria 1091
78 Ga0157378_10196188 3300013297 Bacteria 1907
79 Ga0163162_10344435 3300013306 Bacteria 1623
80 Ga0157372_10535703 3300013307 Bacteria 1365
81 Ga0157375_10238894 3300013308 Bacteria 1976
82 Ga0163163_10119459 3300014325 Bacteria 2669
83 Ga0163163_10212513 3300014325 Bacteria 1984
84 Ga0182008_10156793 3300014497 Bacteria 1144
85 Ga0157376_10195525 3300014969 Bacteria 1857
86 Ga0163161_10551168 3300017792 Bacteria 945
87 Ga0214544_1000004 3300021320 Bacteria 455869
88 Ga0214542_1000001 3300021321 Bacteria 1018696
89 Ga0214545_1000001 3300021324 Bacteria 1092817
90 Ga0214543_1000006 3300021327 Bacteria 443395
91 Ga0209677_106384 3300025253 Bacteria 2800
92 Ga0209148_1000261 3300025254 Bacteria 82670
93 Ga0209233_1005733 3300025261 Bacteria 4094
94 Ga0209455_1011462 3300025272 Bacteria 2179
95 Ga0209564_1029889 3300025295 Bacteria 1702
96 Ga0209758_1000011 3300025297 Bacteria 1049685
97 Ga0209758_1000345 3300025297 Bacteria 84958
98 Ga0209758_1000887 3300025297 Bacteria 41030
99 Ga0209758_1001280 3300025297 Bacteria 31015
100 Ga0207426_1000400 3300025302 Bacteria 73493
101 Ga0207426_1000402 3300025302 Bacteria 72738
102 Ga0207426_1002639 3300025302 Bacteria 11080
103 Ga0209257_1001089 3300025304 Bacteria 35523
104 Ga0209257_1020513 3300025304 Bacteria 2440
105 Ga0207680_10318600 3300025903 Bacteria 1087
106 Ga0207647_10002713 3300025904 Bacteria 13371
107 Ga0207699_10178695 3300025906 Bacteria 1425
108 Ga0207654_10031564 3300025911 Bacteria 2919
109 Ga0207654_10131474 3300025911 Bacteria 1585
110 Ga0207695_10000008 3300025913 Bacteria 1058268
111 Ga0207671_10039678 3300025914 Bacteria 3487
112 Ga0207693_10198261 3300025915 Bacteria 1579
113 Ga0207663_10116663 3300025916 Bacteria 1820
114 Ga0207657_10185363 3300025919 Bacteria 1681
115 Ga0207657_10242724 3300025919 Bacteria 1438
116 Ga0207650_10127247 3300025925 Bacteria 1990
117 Ga0207687_10355113 3300025927 Bacteria 1195
118 Ga0207664_10566657 3300025929 Bacteria 1019
119 Ga0207644_10201692 3300025931 Bacteria 1569
120 Ga0207706_10189341 3300025933 Bacteria 1806
121 Ga0207706_10375944 3300025933 Bacteria 1233
122 Ga0207661_10412610 3300025944 Bacteria 1226
123 Ga0207679_10537626 3300025945 Bacteria 1047
124 Ga0207712_10352098 3300025961 Bacteria 1225
125 Ga0207668_10308610 3300025972 Bacteria 1308
126 Ga0207640_10259717 3300025981 Bacteria 1353
127 Ga0207658_10437060 3300025986 Bacteria 1156
128 Ga0207703_11057607 3300026035 Bacteria 779
129 Ga0207639_10147697 3300026041 Bacteria 1966
130 Ga0207678_10038951 3300026067 Bacteria 4127
131 Ga0207678_10185918 3300026067 Bacteria 1775
132 Ga0207702_10082245 3300026078 Bacteria 2799
133 Ga0207675_100483869 3300026118 Bacteria 1230
134 Ga0207683_10364067 3300026121 Bacteria 1328
135 Ga0207698_10048184 3300026142 Bacteria 3233
136 Ga0209389_1000001 3300027296 Bacteria 463799
137 Ga0209389_1000010 3300027296 Bacteria 223892
138 Ga0209589_1000016 3300027357 Bacteria 223788
139 Ga0209489_100016 3300027361 Bacteria 223873
140 Ga0209489_124989 3300027361 Bacteria 953
141 Ga0209489_124990 3300027361 Bacteria 953
142 Ga0209700_100007 3300027363 Bacteria 454608
143 Ga0209813_10028947 3300027866 Bacteria 1619
144 Ga0268266_10122540 3300028379 Bacteria 2315
145 Ga0307510_10126894 3300033180 Bacteria 2238
146 Ga0395898_0272018 3300037466 Bacteria 1616
147 Ga0395905_0006627 3300037471 Bacteria 11611
148 Ga0395905_0356409 3300037471 Bacteria 1355
149 Ga0395901_0618058 3300038443 Bacteria 1091
150 Ga0395901_0781913 3300038443 Bacteria 945
151 Ga0436365_0574234 3300039437 Bacteria 1171
152 Ga0436365_0655438 3300039437 Bacteria 6521
153 Ga0451849_0857608 3300041505 Bacteria 1132
154 Ga0451853_2391725 3300041512 Bacteria 1176
155 Ga0466972_0004985 3300044658 Bacteria 6661
156 Ga0466972_0065814 3300044658 Bacteria 1733
157 Ga0466965_0068499 3300044683 Bacteria 1782
158 Ga0466966_0000275 3300044684 Bacteria 33692
159 Ga0466961_0000008 3300044693 Bacteria 142607
160 Ga0466963_0001539 3300044694 Bacteria 12491
161 Ga0466968_0023441 3300044735 Bacteria 2514
162 Ga0466968_0184590 3300044735 Bacteria 971
163 Ga0466960_0056537 3300044901 Bacteria 1910
164 Ga0466959_0004924 3300045049 Bacteria 9043
165 Ga0466967_0029273 3300045976 Bacteria 4607
166 Ga0495629_0003355 3300046459 Bacteria 12097
167 Ga0495651_0003476 3300046462 Bacteria 12075
168 Ga0495605_0133295 3300046474 Bacteria 1119
169 Ga0495664_0001788 3300046477 Bacteria 11409
170 Ga0495585_0056223 3300046492 Bacteria 2174
171 Ga0495606_0124756 3300046507 Bacteria 1537
172 Ga0495608_0283239 3300046511 Bacteria 1028
173 Ga0495610_0082532 3300046512 Bacteria 1473
174 Ga0495616_0111787 3300046513 Bacteria 1268
175 Ga0495618_0142055 3300046514 Bacteria 1535
176 Ga0495628_0030618 3300046516 Bacteria 4357
177 Ga0495643_0040818 3300046522 Bacteria 2532
178 Ga0495643_0105477 3300046522 Bacteria 1439
179 Ga0495648_0009261 3300046524 Bacteria 7654
180 Ga0495648_0270076 3300046524 Bacteria 811
181 Ga0495652_0007021 3300046529 Bacteria 10410
182 Ga0495652_0117427 3300046529 Bacteria 2128
183 Ga0495587_0005670 3300046536 Bacteria 8139
184 Ga0495597_0108399 3300046542 Bacteria 1166
185 Ga0495645_0072981 3300046543 Bacteria 2472
186 Ga0495622_0211101 3300046557 Bacteria 862
187 Ga0495667_0116425 3300046559 Bacteria 1726
188 Ga0495668_0102723 3300046616 Bacteria 1564
189 Ga0495668_0108156 3300046616 Bacteria 1521
190 Ga0495668_0148959 3300046616 Bacteria 1281
191 Ga0495634_0066435 3300046642 Bacteria 2388
192 Ga0495634_0071532 3300046642 Bacteria 2283
193 Ga0495611_0064431 3300046648 Bacteria 1669
194 Ga0495625_0183090 3300046660 Bacteria 1392
195 Ga0495625_0308226 3300046660 Bacteria 1011
196 Ga0495635_0038691 3300046663 Bacteria 3301
197 Ga0495588_0086683 3300046674 Bacteria 1637
198 Ga0495657_0001348 3300046675 Bacteria 21351
199 Ga0495599_0160914 3300046678 Bacteria 1387
200 Ga0495623_0010845 3300046679 Bacteria 5899
201 Ga0495624_0201353 3300046690 Bacteria 1209
202 Ga0495671_0088966 3300046692 Bacteria 1512
203 Ga0495649_0006416 3300046694 Bacteria 7323
204 Ga0495600_0028497 3300046809 Bacteria 3613
205 Ga0495581_0049653 3300047315 Bacteria 2423
206 Ga0495604_0006572 3300047317 Bacteria 9216
207 Ga0495604_0032548 3300047317 Bacteria 4131
208 Ga0495674_0023893 3300047319 Bacteria 5626
209 Ga0495676_0015988 3300047321 Bacteria 6665
210 Ga0495680_0005484 3300047322 Bacteria 11926
211 Ga0495683_0147251 3300047323 Bacteria 1099
212 Ga0495687_007327 3300047443 Bacteria 6524
213 Ga0495673_0083090 3300047469 Bacteria 1323
214 Ga0495673_0097927 3300047469 Bacteria 1190
215 Ga0495673_0162597 3300047469 Bacteria 856
216 Ga0495673_0165511 3300047469 Bacteria 846
217 Ga0495593_0047589 3300047673 Bacteria 2281
218 Ga0495602_0017394 3300048088 Bacteria 7209
219 Ga0495602_0107477 3300048088 Bacteria 2274
220 Ga0496100_0169480 3300048903 Bacteria 1571
221 Ga0496101_0475580 3300048904 Bacteria 986
222 Ga0496102_0026445 3300048905 Bacteria 5175
223 Ga0496102_0400687 3300048905 Bacteria 1290
224 Ga0496102_0460222 3300048905 Bacteria 1193
225 Ga0496103_0042148 3300048906 Bacteria 2807
226 Ga0496104_0006928 3300048907 Bacteria 9998
227 Ga0496104_0023025 3300048907 Bacteria 5724
228 Ga0496104_0289125 3300048907 Bacteria 1551
229 Ga0496104_0450235 3300048907 Bacteria 1199
230 Ga0496105_0019267 3300048908 Bacteria 5503
231 Ga0496105_0095496 3300048908 Bacteria 2455
232 Ga0496105_0218857 3300048908 Bacteria 1550
233 Ga0496106_0402773 3300048909 Bacteria 1100
234 Ga0496106_0682344 3300048909 Bacteria 819
235 Ga0496108_0014576 3300048911 Bacteria 6417
236 Ga0496109_0100146 3300048912 Bacteria 2688
237 Ga0496110_0034882 3300048913 Bacteria 4361
238 Ga0496110_0248473 3300048913 Bacteria 1619
239 Ga0496111_0222817 3300048914 Bacteria 1401
240 Ga0496112_0228530 3300048915 Bacteria 1815
241 Ga0496112_0326844 3300048915 Bacteria 1477
242 Ga0496113_0032651 3300048916 Bacteria 3783
243 Ga0496113_0045235 3300048916 Bacteria 3264
244 Ga0496113_0081169 3300048916 Bacteria 2485
245 Ga0496114_0295258 3300048917 Bacteria 1430
246 Ga0496114_0393424 3300048917 Bacteria 1227
247 Ga0496115_0149973 3300048918 Bacteria 1925
248 Ga0496116_0013446 3300048919 Bacteria 6598
249 Ga0496116_0091997 3300048919 Bacteria 1841
250 Ga0496117_0140413 3300048920 Bacteria 1448
251 Ga0496118_0172351 3300048921 Bacteria 1320
252 Ga0496119_0016187 3300048922 Bacteria 5695
253 Ga0496119_0063138 3300048922 Bacteria 2204
254 Ga0496119_0112597 3300048922 Bacteria 1508
255 Ga0496120_0017787 3300048923 Bacteria 4596
256 Ga0496121_0017615 3300048924 Bacteria 7278
257 Ga0496121_0027735 3300048924 Bacteria 5293
258 Ga0496121_0227599 3300048924 Bacteria 1308
259 Ga0496121_0296621 3300048924 Bacteria 1099
260 Ga0496124_0226865 3300048927 Bacteria 1400
261 Ga0496125_0092612 3300048928 Bacteria 2259
262 Ga0496126_0022621 3300048929 Bacteria 6110
263 Ga0496126_0312093 3300048929 Bacteria 1294
264 Ga0495682_0022641 3300049460 Bacteria 2349
265 Ga0495682_0106159 3300049460 Bacteria 1007
266 Ga0501032_0019854 3300049569 Bacteria 4691
267 Ga0501033_0077910 3300049570 Bacteria 2432
268 Ga0501034_0004793 3300049571 Bacteria 14958
269 Ga0501036_0003294 3300049572 Bacteria 12883
270 Ga0501037_0005005 3300049573 Bacteria 9638
271 Ga0501038_0010966 3300049574 Bacteria 8277
272 Ga0501039_0001298 3300049575 Bacteria 18251
273 Ga0501043_0014834 3300049579 Bacteria 6101
274 Ga0501046_0001714 3300049580 Bacteria 20920
275 Ga0501047_0008302 3300049581 Bacteria 9801
276 Ga0501047_0160943 3300049581 Bacteria 2116
277 Ga0501048_0142031 3300049582 Bacteria 1698
278 Ga0501067_0020644 3300049583 Bacteria 3645
279 Ga0501068_0119243 3300049584 Bacteria 1644
280 Ga0501069_0019890 3300049585 Bacteria 3632
281 Ga0501070_0015775 3300049586 Bacteria 6353
282 Ga0501073_0002004 3300049589 Bacteria 15198
283 Ga0501074_0027363 3300049590 Bacteria 4135
284 Ga0501080_0002095 3300049742 Bacteria 17315
285 Ga0501080_0012324 3300049742 Bacteria 7835
286 Ga0501035_0041670 3300049822 Bacteria 4145
287 Ga0501035_0339059 3300049822 Bacteria 1260
288 Ga0501044_0002857 3300049823 Bacteria 19658
289 Ga0501044_0017018 3300049823 Bacteria 7802
290 Ga0501044_0310309 3300049823 Bacteria 1504
291 nmdc:mga03n38_119413_c1 3300050490 Bacteria 1294
292 nmdc:mga00v17_147384_c1 3300050491 Bacteria 1511
293 nmdc:mga00v17_214088_c1 3300050491 Bacteria 1247
294 nmdc:mga00v17_73311_c1 3300050491 Bacteria 2126
295 nmdc:mga0yw44_651353_c1 3300050492 Bacteria 716
296 nmdc:mga0yw44_79978_c1 3300050492 Bacteria 2046
297 nmdc:mga0yw44_84271_c1 3300050492 Bacteria 1998
298 nmdc:mga06z11_201901_c1 3300050494 Bacteria 1155
299 nmdc:mga06z11_40366_c1 3300050494 Bacteria 2329
300 nmdc:mga04h51_48202_c1 3300050495 Bacteria 1419
301 nmdc:mga07m45_120472_c1 3300050496 Bacteria 1515
302 nmdc:mga07m45_7487_c1 3300050496 Bacteria 5580
303 Ga0495595_0030583 3300053084 Bacteria 2416
304 Ga0500578_0030628 3300053086 Bacteria 3458
305 Ga0500578_0324789 3300053086 Bacteria 906
306 Ga0500578_0396104 3300053086 Bacteria 797
307 Ga0500651_0226000 3300053093 Bacteria 1096
308 Ga0500650_0094358 3300053098 Bacteria 1401
309 Ga0500556_0002598 3300053104 Bacteria 5689
310 Ga0500562_111481 3300053108 Bacteria 745
311 Ga0500569_045727 3300053109 Bacteria 1301
312 Ga0500642_0000126 3300053130 Bacteria 34999
313 Ga0500559_0031356 3300053136 Bacteria 2280
314 Ga0500577_0190712 3300053142 Bacteria 882
315 Ga0500616_0096444 3300053153 Bacteria 1453
316 Ga0500622_0015168 3300053156 Bacteria 4131
317 Ga0500599_008829 3300053736 Bacteria 1313
318 2507507939 2507262055 Bacteria 8048963
319 2508542052 2508501009 Bacteria 7784016
320 2511399353 2511231028 Bacteria 8046582
321 2513622529 2513237092 Bacteria 8341956
322 2513639369 2513237094 Bacteria 8789602
323 2513647239 2513237095 Bacteria 8976980
324 2513700070 2513237102 Bacteria 7703324
325 2513715218 2513237104 Bacteria 10034502
326 2513877565 2513237139 Bacteria 8737671
327 2514009711 2513237161 Bacteria 8871253
328 2517103853 2517093001 Bacteria 9002274
329 2524441837 2524023205 Bacteria 8918781
330 2528855846 2528768022 Bacteria 10457665
331 2617346521 2617270735 Bacteria 9163226
332 2617378626 2617270741 Bacteria 8201522
333 2745081293 2744054633 Bacteria 8678936
334 2793060829 2791355196 Bacteria 7323613
335 2805918425 2802429603 Bacteria 8777136
336 2818236277 2816332527 Bacteria 8933356
337 2824607125 2824600985 Bacteria 8488197
338 2824616574 2824609381 Bacteria 8672835
339 2824624516 2824617872 Bacteria 8814715
340 2824633431 2824626560 Bacteria 8813858
341 2824642101 2824635225 Bacteria 8785348
342 2824651769 2824644064 Bacteria 8743947
343 2824659492 2824653114 Bacteria 8493680
344 2824669253 2824661429 Bacteria 9877870
345 2824675707 2824671348 Bacteria 8369588
346 2824693390 2824687955 Bacteria 8360029
347 2824700409 2824696289 Bacteria 8335049
348 2824721991 2824714736 Bacteria 8717648
349 2824731827 2824723954 Bacteria 8758240
350 2824735772 2824732956 Bacteria 7810675
351 2824751127 2824746037 Bacteria 7911610
352 2824774779 2824773399 Bacteria 8360218
353 2838122941 2838122688 Bacteria 8803140
354 2841944777 2841941048 Bacteria 8688029
355 2841957770 2841949485 Bacteria 8680857
356 2841959981 2841957949 Bacteria 8652217
357 2841974482 2841966195 Bacteria 8673214
358 2841978639 2841974524 Bacteria 8931498
359 2841989009 2841983080 Bacteria 8395090
360 2842040373 2842038055 Bacteria 8002051
361 2842046682 2842045827 Bacteria 8006841
362 2844319752 2844315083 Bacteria 8138177
363 2847937069 2847930680 Bacteria 9342022
364 2847947461 2847939898 Bacteria 8606328
365 2857513057 2857509624 Bacteria 7472071
366 2874617205 2874612657 Bacteria 8252029
367 2874626657 2874620515 Bacteria 8290088
368 2874635293 2874628541 Bacteria 8630250
369 2876764300 2876761206 Bacteria 10111113
370 2879083253 2879083081 Bacteria 8587928
371 2879101557 2879099564 Bacteria 10442239
372 2881364647 2881364244 Bacteria 7710352
373 2881672039 2881665667 Bacteria 8175609
374 2885369621 2885366525 Bacteria 8326213
375 2885418204 2885409591 Bacteria 9235467
376 2888385172 2888378607 Bacteria 9652610
377 2888393067 2888388044 Bacteria 7304136
378 2888425314 2888419890 Bacteria 7857137
379 2903730571 2903727486 Bacteria 8281579
380 2904671997 2904666416 Bacteria 8226587
381 2906609625 2906602504 Bacteria 8295279
382 2906628917 2906626472 Bacteria 8826946
383 2906651239 2906643746 Bacteria 8722424
384 2908780872 2908775508 Bacteria 8092255
385 2922397355 2922393267 Bacteria 8285685
386 2929620540 2929615660 Bacteria 9193770
387 2929626433 2929624759 Bacteria 9339455
388 2932784696 2932784394 Bacteria 9704911
389 2932795410 2932794094 Bacteria 7915132
390 2932805941 2932801729 Bacteria 7987968
391 2932809676 2932809354 Bacteria 9135765
392 2932818581 2932818245 Bacteria 9955613
393 2932828464 2932828146 Bacteria 9745859
394 2933582458 2933577622 Bacteria 9116884
395 2935609562 2935608549 Bacteria 8203142
396 2935617437 2935616580 Bacteria 9032984
397 2935639081 2935638405 Bacteria 10015038
398 2935652287 2935648319 Bacteria 8801166
399 2935660869 2935656913 Bacteria 8965014
400 2935666067 2935665750 Bacteria 9571747
401 2935675715 2935675223 Bacteria 9928132
402 2935685275 2935684952 Bacteria 9590419
403 2935694965 2935694250 Bacteria 9291695
404 2935704088 2935703347 Bacteria 10242284
405 2935713828 2935713505 Bacteria 9608509
406 2935724447 2935722832 Bacteria 9608746
407 2935733195 2935732158 Bacteria 9706831
408 2935742574 2935741537 Bacteria 9707219
409 2935751240 2935750917 Bacteria 9590372
410 2935760236 2935760218 Bacteria 9817913
411 2935769960 2935769743 Bacteria 7878163
412 2935782020 2935777560 Bacteria 8077691
413 2935785798 2935785616 Bacteria 7962367
414 2935794274 2935793552 Bacteria 8012592
415 2935802171 2935801545 Bacteria 9301974
416 2935810995 2935810662 Bacteria 9401221
417 2935822724 2935819856 Bacteria 8261050
418 2935828576 2935827899 Bacteria 10038562
419 2935839952 2935837841 Bacteria 9454360
420 2935848306 2935847175 Bacteria 8228321
421 2935856062 2935855204 Bacteria 9035059
422 2935865994 2935864058 Bacteria 9784707
423 2935877681 2935873716 Bacteria 9632195
424 2935883696 2935883170 Bacteria 7964738
425 2935909891 2935908558 Bacteria 8568796
426 2935917615 2935916978 Bacteria 9113783
427 2935927371 2935926038 Bacteria 8601059
428 2935936784 2935934488 Bacteria 8602579
429 2935944913 2935942939 Bacteria 8599779
430 2935953350 2935951376 Bacteria 8602333
431 2935961159 2935959822 Bacteria 7869783
432 2935970190 2935967501 Bacteria 8603075
433 2935986756 2935984226 Bacteria 8302647
434 2935992625 2935992306 Bacteria 9802711
435 2936002497 2936002035 Bacteria 9362176
436 2936014925 2936011229 Bacteria 8801034
437 2936022094 2936019824 Bacteria 8804134
438 2936032782 2936028420 Bacteria 8965941
439 2936037586 2936037263 Bacteria 9446081
440 2936050666 2936046547 Bacteria 8903709
441 2936059558 2936055302 Bacteria 8785755
442 2940557958 2940556831 Bacteria 9590747
443 2941540708 2941538514 Bacteria 9402094
444 3005485036 3005483717 Bacteria 7877331
445 3005507366 3005506211 Bacteria 6943378
446 3005587327 3005587118 Bacteria 7794411
447 3005599969 3005594810 Bacteria 8716512
448 3005715564 3005710791 Bacteria 7622528
449 3005722895 3005718088 Bacteria 8283608
450 8016521046 8016511872 Bacteria 9921665
451 8016534148 8016530956 Bacteria 8155261
452 8016547381 8016539877 Bacteria 8155419
453 8016554763 8016548790 Bacteria 8155074
454 8016563129 8016557553 Bacteria 8154380
455 8016572491 8016566248 Bacteria 8158151
456 8016576659 8016575299 Bacteria 8154085
457 8016593833 8016583857 Bacteria 10421953
458 8016600886 8016595262 Bacteria 8149947
459 8016609590 8016603502 Bacteria 8731218
460 8016615326 8016613128 Bacteria 8794220
461 8016625885 8016622563 Bacteria 7999408
462 8016639470 8016630954 Bacteria 9217207
463 8017064558 8017057580 Bacteria 10023680
464 8019533924 8019530166 Bacteria 8155624
465 8019545755 8019538911 Bacteria 7872763
466 8019552968 8019547302 Bacteria 7996444
467 8019583935 8019576017 Bacteria 10049540
468 8019591741 8019586578 Bacteria 10212056
469 8019599596 8019597564 Bacteria 10041141
470 8019618949 8019608314 Bacteria 10042931
471 8019649064 8019648815 Bacteria 10014479
472 8019690777 8019687851 Bacteria 8712826
473 8055745402 8055742211 Bacteria 9226248
474 8056968758 8056967851 Bacteria 9038162
475 Ga0495684_0234564
476 JGI25153J46596_10002408
477 JGI25153J46596_10003304
478 JGI25153J46596_10023334
479 rootL2_10279811
480 JGI25160J50197_1014111
481 Ga0055531_10024686
482 Ga0065165_1004881
483 Ga0070676_10568056
484 Ga0070670_100125611
485 Ga0068869_100299651
486 Ga0070666_10097617
487 Ga0070668_100117009
488 Ga0070668_100182332
489 Ga0070669_100294807
490 Ga0070671_100038513
491 Ga0070667_100149506
492 Ga0070667_100426273
493 Ga0070714_100464155
494 Ga0070710_10530978
495 Ga0070711_100002401
496 Ga0070663_100234404
497 Ga0070663_101030940
498 Ga0070678_100523901
499 Ga0070662_100032032
500 Ga0070662_100401258
501 Ga0070662_100694056
502 Ga0068853_100170510
503 Ga0070665_100129482
504 Ga0068855_100464620
505 Ga0070664_100503105
506 Ga0068854_100115762
507 Ga0068854_100288947
508 Ga0068856_100196420
509 Ga0068852_100012064
510 Ga0068852_100468586
511 Ga0068851_10161040
512 Ga0075365_10018188
513 Ga0075365_10079599
514 Ga0075365_10113515
515 Ga0075368_10015880
516 Ga0075363_100006188
517 Ga0075364_10077116
518 Ga0075364_10215956
519 Ga0070716_100637955
520 Ga0070712_100254175
521 Ga0075362_10008309
522 Ga0075367_10027483
523 Ga0075367_10043660
524 Ga0075367_10445570
525 Ga0075369_10102741
526 Ga0075369_10130815
527 Ga0075369_10164811
528 Ga0075366_10054681
529 Ga0075370_10053280
530 Ga0075370_10280893
531 Ga0099823_1096512
532 Ga0105240_10004337
533 Ga0105245_10018598
534 Ga0105243_10483080
535 Ga0105241_10007558
536 Ga0105241_10037331
537 Ga0105241_10061229
538 Ga0105248_10159221
539 Ga0105248_10210797
540 Ga0105237_10025698
541 Ga0105237_10077329
542 Ga0105238_10035637
543 Ga0105249_10492916
544 Ga0105249_10528195
545 Ga0105239_10008922
546 Ga0105239_10057044
547 Ga0105239_10141232
548 Ga0105239_10275908
549 Ga0105239_10559083
550 Ga0105246_10034959
551 Ga0157374_10620963
552 Ga0157378_10196188
553 Ga0163162_10344435
554 Ga0157372_10535703
555 Ga0157375_10238894
556 Ga0163163_10119459
557 Ga0163163_10212513
558 Ga0182008_10156793
559 Ga0157376_10195525
560 Ga0163161_10551168
561 Ga0214544_1000004
562 Ga0214542_1000001
563 Ga0214545_1000001
564 Ga0214543_1000006
565 Ga0209677_106384
566 Ga0209148_1000261
567 Ga0209233_1005733
568 Ga0209455_1011462
569 Ga0209564_1029889
570 Ga0209758_1000011
571 Ga0209758_1000345
572 Ga0209758_1000887
573 Ga0209758_1001280
574 Ga0207426_1000400
575 Ga0207426_1000402
576 Ga0207426_1002639
577 Ga0209257_1001089
578 Ga0209257_1020513
579 Ga0207680_10318600
580 Ga0207647_10002713
581 Ga0207699_10178695
582 Ga0207654_10031564
583 Ga0207654_10131474
584 Ga0207695_10000008
585 Ga0207671_10039678
586 Ga0207693_10198261
587 Ga0207663_10116663
588 Ga0207657_10185363
589 Ga0207657_10242724
590 Ga0207650_10127247
591 Ga0207687_10355113
592 Ga0207664_10566657
593 Ga0207644_10201692
594 Ga0207706_10189341
595 Ga0207706_10375944
596 Ga0207661_10412610
597 Ga0207679_10537626
598 Ga0207712_10352098
599 Ga0207668_10308610
600 Ga0207640_10259717
601 Ga0207658_10437060
602 Ga0207703_11057607
603 Ga0207639_10147697
604 Ga0207678_10038951
605 Ga0207678_10185918
606 Ga0207702_10082245
607 Ga0207675_100483869
608 Ga0207683_10364067
609 Ga0207698_10048184
610 Ga0209389_1000001
611 Ga0209389_1000010
612 Ga0209589_1000016
613 Ga0209489_100016
614 Ga0209489_124989
615 Ga0209489_124990
616 Ga0209700_100007
617 Ga0209813_10028947
618 Ga0268266_10122540
619 Ga0307510_10126894
620 Ga0395898_0272018
621 Ga0395905_0006627
622 Ga0395905_0356409
623 Ga0395901_0618058
624 Ga0395901_0781913
625 Ga0436365_0574234
626 Ga0436365_0655438
627 Ga0451849_0857608
628 Ga0451853_2391725
629 Ga0466972_0004985
630 Ga0466972_0065814
631 Ga0466965_0068499
632 Ga0466966_0000275
633 Ga0466961_0000008
634 Ga0466963_0001539
635 Ga0466968_0023441
636 Ga0466968_0184590
637 Ga0466960_0056537
638 Ga0466959_0004924
639 Ga0466967_0029273
640 Ga0495629_0003355
641 Ga0495651_0003476
642 Ga0495605_0133295
643 Ga0495664_0001788
644 Ga0495585_0056223
645 Ga0495606_0124756
646 Ga0495608_0283239
647 Ga0495610_0082532
648 Ga0495616_0111787
649 Ga0495618_0142055
650 Ga0495628_0030618
651 Ga0495643_0040818
652 Ga0495643_0105477
653 Ga0495648_0009261
654 Ga0495648_0270076
655 Ga0495652_0007021
656 Ga0495652_0117427
657 Ga0495587_0005670
658 Ga0495597_0108399
659 Ga0495645_0072981
660 Ga0495622_0211101
661 Ga0495667_0116425
662 Ga0495668_0102723
663 Ga0495668_0108156
664 Ga0495668_0148959
665 Ga0495634_0066435
666 Ga0495634_0071532
667 Ga0495611_0064431
668 Ga0495625_0183090
669 Ga0495625_0308226
670 Ga0495635_0038691
671 Ga0495588_0086683
672 Ga0495657_0001348
673 Ga0495599_0160914
674 Ga0495623_0010845
675 Ga0495624_0201353
676 Ga0495671_0088966
677 Ga0495649_0006416
678 Ga0495600_0028497
679 Ga0495581_0049653
680 Ga0495604_0006572
681 Ga0495604_0032548
682 Ga0495674_0023893
683 Ga0495676_0015988
684 Ga0495680_0005484
685 Ga0495683_0147251
686 Ga0495687_007327
687 Ga0495673_0083090
688 Ga0495673_0097927
689 Ga0495673_0162597
690 Ga0495673_0165511
691 Ga0495593_0047589
692 Ga0495602_0017394
693 Ga0495602_0107477
694 Ga0496100_0169480
695 Ga0496101_0475580
696 Ga0496102_0026445
697 Ga0496102_0400687
698 Ga0496102_0460222
699 Ga0496103_0042148
700 Ga0496104_0006928
701 Ga0496104_0023025
702 Ga0496104_0289125
703 Ga0496104_0450235
704 Ga0496105_0019267
705 Ga0496105_0095496
706 Ga0496105_0218857
707 Ga0496106_0402773
708 Ga0496106_0682344
709 Ga0496108_0014576
710 Ga0496109_0100146
711 Ga0496110_0034882
712 Ga0496110_0248473
713 Ga0496111_0222817
714 Ga0496112_0228530
715 Ga0496112_0326844
716 Ga0496113_0032651
717 Ga0496113_0045235
718 Ga0496113_0081169
719 Ga0496114_0295258
720 Ga0496114_0393424
721 Ga0496115_0149973
722 Ga0496116_0013446
723 Ga0496116_0091997
724 Ga0496117_0140413
725 Ga0496118_0172351
726 Ga0496119_0016187
727 Ga0496119_0063138
728 Ga0496119_0112597
729 Ga0496120_0017787
730 Ga0496121_0017615
731 Ga0496121_0027735
732 Ga0496121_0227599
733 Ga0496121_0296621
734 Ga0496124_0226865
735 Ga0496125_0092612
736 Ga0496126_0022621
737 Ga0496126_0312093
738 Ga0495682_0022641
739 Ga0495682_0106159
740 Ga0501032_0019854
741 Ga0501033_0077910
742 Ga0501034_0004793
743 Ga0501036_0003294
744 Ga0501037_0005005
745 Ga0501038_0010966
746 Ga0501039_0001298
747 Ga0501043_0014834
748 Ga0501046_0001714
749 Ga0501047_0008302
750 Ga0501047_0160943
751 Ga0501048_0142031
752 Ga0501067_0020644
753 Ga0501068_0119243
754 Ga0501069_0019890
755 Ga0501070_0015775
756 Ga0501073_0002004
757 Ga0501074_0027363
758 Ga0501080_0002095
759 Ga0501080_0012324
760 Ga0501035_0041670
761 Ga0501035_0339059
762 Ga0501044_0002857
763 Ga0501044_0017018
764 Ga0501044_0310309
765 nmdc:mga03n38_119413_c1
766 nmdc:mga00v17_147384_c1
767 nmdc:mga00v17_214088_c1
768 nmdc:mga00v17_73311_c1
769 nmdc:mga0yw44_651353_c1
770 nmdc:mga0yw44_79978_c1
771 nmdc:mga0yw44_84271_c1
772 nmdc:mga06z11_201901_c1
773 nmdc:mga06z11_40366_c1
774 nmdc:mga04h51_48202_c1
775 nmdc:mga07m45_120472_c1
776 nmdc:mga07m45_7487_c1
777 Ga0495595_0030583
778 Ga0500578_0030628
779 Ga0500578_0324789
780 Ga0500578_0396104
781 Ga0500651_0226000
782 Ga0500650_0094358
783 Ga0500556_0002598
784 Ga0500562_111481
785 Ga0500569_045727
786 Ga0500642_0000126
787 Ga0500559_0031356
788 Ga0500577_0190712
789 Ga0500616_0096444
790 Ga0500622_0015168
791 Ga0500599_008829
792 2507507939
793 2508542052
794 2511399353
795 2513622529
796 2513639369
797 2513647239
798 2513700070
799 2513715218
800 2513877565
801 2514009711
802 2517103853
803 2524441837
804 2528855846
805 2617346521
806 2617378626
807 2745081293
808 2793060829
809 2805918425
810 2818236277
811 2824607125
812 2824616574
813 2824624516
814 2824633431
815 2824642101
816 2824651769
817 2824659492
818 2824669253
819 2824675707
820 2824693390
821 2824700409
822 2824721991
823 2824731827
824 2824735772
825 2824751127
826 2824774779
827 2838122941
828 2841944777
829 2841957770
830 2841959981
831 2841974482
832 2841978639
833 2841989009
834 2842040373
835 2842046682
836 2844319752
837 2847937069
838 2847947461
839 2857513057
840 2874617205
841 2874626657
842 2874635293
843 2876764300
844 2879083253
845 2879101557
846 2881364647
847 2881672039
848 2885369621
849 2885418204
850 2888385172
851 2888393067
852 2888425314
853 2903730571
854 2904671997
855 2906609625
856 2906628917
857 2906651239
858 2908780872
859 2922397355
860 2929620540
861 2929626433
862 2932784696
863 2932795410
864 2932805941
865 2932809676
866 2932818581
867 2932828464
868 2933582458
869 2935609562
870 2935617437
871 2935639081
872 2935652287
873 2935660869
874 2935666067
875 2935675715
876 2935685275
877 2935694965
878 2935704088
879 2935713828
880 2935724447
881 2935733195
882 2935742574
883 2935751240
884 2935760236
885 2935769960
886 2935782020
887 2935785798
888 2935794274
889 2935802171
890 2935810995
891 2935822724
892 2935828576
893 2935839952
894 2935848306
895 2935856062
896 2935865994
897 2935877681
898 2935883696
899 2935909891
900 2935917615
901 2935927371
902 2935936784
903 2935944913
904 2935953350
905 2935961159
906 2935970190
907 2935986756
908 2935992625
909 2936002497
910 2936014925
911 2936022094
912 2936032782
913 2936037586
914 2936050666
915 2936059558
916 2940557958
917 2941540708
918 3005485036
919 3005507366
920 3005587327
921 3005599969
922 3005715564
923 3005722895
924 8016521046
925 8016534148
926 8016547381
927 8016554763
928 8016563129
929 8016572491
930 8016576659
931 8016593833
932 8016600886
933 8016609590
934 8016615326
935 8016625885
936 8016639470
937 8017064558
938 8019533924
939 8019545755
940 8019552968
941 8019583935
942 8019591741
943 8019599596
944 8019618949
945 8019649064
946 8019690777
947 8055745402
948 8056968758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

8

180

0.88

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

11

186

0.86

PF13242

Hydrolase_like

HAD-hyrolase-like

140

211

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fdr-assembly1.cif.gz_A crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58 0.8585 9 217
7ocr-assembly1.cif.gz_B nadph and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8545 7 219
7ocs-assembly1.cif.gz_D mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii 0.8445 7 218
7ocs-assembly1.cif.gz_A mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii 0.8442 7 218
7ocs-assembly2.cif.gz_C mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii 0.8441 7 218
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9108 93 186 3.40.50.1000
4eenA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9037 5 217 3.40.50.1000
4eelA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.8964 24 85 1.10.150.240
4eenA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.8917 24 85 1.10.150.240
4eekA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.8858 25 79 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A291LX51-F1-model_v4 Hydrolase 0.9631 5 219 GO:0016787
AF-A0A434MFV5-F1-model_v4 Hydrolase 0.9616 6 169 GO:0016787
AF-A0A1Q4C3F0-F1-model_v4 Hydrolase 0.9609 6 219 GO:0016787
AF-A0A6M1LS45-F1-model_v4 HAD-IA family hydrolase 0.9605 5 186 GO:0016787
AF-A0A527ZK85-F1-model_v4 HAD family hydrolase 0.959 90 219 GO:0050308

Map