F451145

General Info

Members Datasets Scaffolds Average Seq Length
474 249 948 152

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10105651|Ga0070681_101056512
Length 180
Sequence MATGEFRRTTSERTRALTLIAIAADHAGFPLKALAVQELEHLGQEVLDLGAFDASQPDDYPDFAELLANAIISGEAARGVLICGSGVGASIAANKFPGIRAAICHDTYSAHQGVEHDNMNVLCLGSRVVGTELAAEIVRVWAQAVFSNEERHVRRLNKVLAIERRNLRDKSSVSAPSSQR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
139 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
197 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
223 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
224 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 3.16
Rhizosphere 95.99
Stem 0
Stem Tuber 0
Unclassified 24.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10105651 3300005458 Bacteria 2758
2 MBSR1b_contig_4224032 2162886012 Bacteria 871
3 Ga0065714_10095990 3300005288 Bacteria 1772
4 Ga0065712_10084454 3300005290 Bacteria 2762
5 Ga0065715_10121939 3300005293 Bacteria 2190
6 Ga0065715_10445001 3300005293 Unclassified 832
7 Ga0065715_10456896 3300005293 Bacteria 777
8 Ga0070658_10052942 3300005327 Unclassified 3293
9 Ga0070658_10116686 3300005327 Bacteria 2215
10 Ga0070658_10613262 3300005327 Bacteria 943
11 Ga0070683_100005754 3300005329 Bacteria 10357
12 Ga0070683_100131949 3300005329 Bacteria 2364
13 Ga0070683_100291622 3300005329 Bacteria 1552
14 Ga0070683_100681054 3300005329 Bacteria 985
15 Ga0070683_101021834 3300005329 Bacteria 794
16 Ga0070690_100004397 3300005330 Bacteria 7819
17 Ga0070670_100149459 3300005331 Unclassified 2022
18 Ga0068869_100301430 3300005334 Unclassified 1294
19 Ga0068869_100690717 3300005334 Unclassified 869
20 Ga0070680_100593878 3300005336 Bacteria 950
21 Ga0070660_100291609 3300005339 Bacteria 1336
22 Ga0070689_100078284 3300005340 Bacteria 2592
23 Ga0070687_100228953 3300005343 Bacteria 1143
24 Ga0070661_100185204 3300005344 Bacteria 1586
25 Ga0070692_10122767 3300005345 Bacteria 1450
26 Ga0070692_10460727 3300005345 Unclassified 816
27 Ga0070692_11289703 3300005345 Unclassified 523
28 Ga0070669_100040530 3300005353 Bacteria 3385
29 Ga0070675_100917528 3300005354 Bacteria 803
30 Ga0070714_100542061 3300005435 Bacteria 1113
31 Ga0070713_101190923 3300005436 Unclassified 737
32 Ga0070701_10018043 3300005438 Bacteria 3311
33 Ga0070705_100004959 3300005440 Bacteria 6482
34 Ga0070700_100164798 3300005441 Unclassified 1529
35 Ga0070694_100193748 3300005444 Bacteria 1511
36 Ga0070708_100379415 3300005445 Bacteria 1333
37 Ga0070708_100587169 3300005445 Bacteria 1050
38 Ga0070662_100033098 3300005457 Bacteria 3638
39 Ga0070681_10237993 3300005458 Bacteria 1734
40 Ga0070706_100064530 3300005467 Bacteria 3385
41 Ga0070707_100322543 3300005468 Bacteria 1501
42 Ga0070698_100025739 3300005471 Bacteria 6130
43 Ga0070698_100106538 3300005471 Bacteria 2772
44 Ga0070699_100936121 3300005518 Unclassified 794
45 Ga0070679_100025866 3300005530 Bacteria 5759
46 Ga0070679_100190393 3300005530 Bacteria 2021
47 Ga0070679_101250172 3300005530 Bacteria 688
48 Ga0070679_101482557 3300005530 Bacteria 625
49 Ga0070684_100239527 3300005535 Bacteria 1657
50 Ga0070684_100415428 3300005535 Bacteria 1241
51 Ga0068853_100243744 3300005539 Bacteria 1648
52 Ga0070686_100004059 3300005544 Bacteria 8055
53 Ga0070695_100088338 3300005545 Bacteria 2064
54 Ga0070696_100103360 3300005546 Unclassified 2044
55 Ga0070696_101652214 3300005546 Bacteria 551
56 Ga0070693_100002113 3300005547 Bacteria 9094
57 Ga0070693_100087520 3300005547 Bacteria 1871
58 Ga0070693_100193934 3300005547 Bacteria 1315
59 Ga0070704_100642649 3300005549 Unclassified 936
60 Ga0068855_100398731 3300005563 Bacteria 1508
61 Ga0068855_100621645 3300005563 Unclassified 1163
62 Ga0070664_100746702 3300005564 Bacteria 913
63 Ga0068857_100478567 3300005577 Unclassified 1167
64 Ga0068857_100896767 3300005577 Unclassified 850
65 Ga0070702_100043739 3300005615 Bacteria 2525
66 Ga0070702_100098527 3300005615 Unclassified 1788
67 Ga0068852_100357636 3300005616 Bacteria 1427
68 Ga0068852_100773816 3300005616 Unclassified 973
69 Ga0068852_100877346 3300005616 Unclassified 914
70 Ga0068859_100075459 3300005617 Bacteria 3412
71 Ga0068859_100883745 3300005617 Bacteria 979
72 Ga0068864_101166575 3300005618 Unclassified 768
73 Ga0068861_101086110 3300005719 Unclassified 768
74 Ga0068851_10003520 3300005834 Bacteria 6965
75 Ga0068870_10171241 3300005840 Bacteria 1296
76 Ga0068870_10176635 3300005840 Bacteria 1278
77 Ga0068870_10697904 3300005840 Bacteria 700
78 Ga0068863_100797597 3300005841 Bacteria 942
79 Ga0068860_100190451 3300005843 Bacteria 1985
80 Ga0068860_100410121 3300005843 Bacteria 1342
81 Ga0068860_101777594 3300005843 Unclassified 638
82 Ga0068862_100118795 3300005844 Bacteria 2328
83 Ga0081538_10009257 3300005981 Bacteria 8246
84 Ga0081538_10009861 3300005981 Bacteria 7899
85 Ga0081539_10001390 3300005985 Bacteria 41681
86 Ga0068871_100281068 3300006358 Bacteria 1456
87 Ga0075430_100141752 3300006846 Bacteria 2001
88 Ga0075430_100247257 3300006846 Bacteria 1478
89 Ga0075431_100297384 3300006847 Unclassified 1631
90 Ga0075431_100540910 3300006847 Bacteria 1153
91 Ga0075431_101003386 3300006847 Unclassified 802
92 Ga0075429_100874296 3300006880 Unclassified 787
93 Ga0075429_100976538 3300006880 Bacteria 741
94 Ga0097620_100075455 3300006931 Bacteria 3412
95 Ga0097620_100883751 3300006931 Bacteria 979
96 Ga0075435_101096449 3300007076 Bacteria 696
97 Ga0105240_10343676 3300009093 Bacteria 1694
98 Ga0111539_10478355 3300009094 Bacteria 1450
99 Ga0111539_11248396 3300009094 Bacteria 863
100 Ga0105247_10009216 3300009101 Bacteria 6002
101 Ga0105247_10011020 3300009101 Bacteria 5456
102 Ga0105247_10816140 3300009101 Unclassified 713
103 Ga0114129_11582432 3300009147 Bacteria 803
104 Ga0114129_11754525 3300009147 Unclassified 756
105 Ga0105243_10787898 3300009148 Bacteria 936
106 Ga0105243_11204190 3300009148 Unclassified 771
107 Ga0105241_10354079 3300009174 Bacteria 1275
108 Ga0105248_10827180 3300009177 Bacteria 1045
109 Ga0105237_10008467 3300009545 Bacteria 11131
110 Ga0105239_11314133 3300010375 Unclassified 834
111 Ga0105246_10626713 3300011119 Bacteria 933
112 Ga0157373_10015912 3300013100 Bacteria 5491
113 Ga0157373_10508115 3300013100 Unclassified 871
114 Ga0157371_10064847 3300013102 Unclassified 2587
115 Ga0157371_10095237 3300013102 Unclassified 2110
116 Ga0157369_10012231 3300013105 Bacteria 9746
117 Ga0157369_10230349 3300013105 Bacteria 1937
118 Ga0163162_10462302 3300013306 Unclassified 1400
119 Ga0163162_11242848 3300013306 Unclassified 846
120 Ga0163162_11318661 3300013306 Unclassified 820
121 Ga0157372_10060204 3300013307 Unclassified 4249
122 Ga0157372_10065476 3300013307 Bacteria 4080
123 Ga0157372_10516563 3300013307 Bacteria 1392
124 Ga0157372_10584559 3300013307 Unclassified 1302
125 Ga0157372_11407801 3300013307 Bacteria 804
126 Ga0157375_12053948 3300013308 Unclassified 680
127 Ga0163163_10650015 3300014325 Bacteria 1118
128 Ga0163163_11884722 3300014325 Unclassified 658
129 Ga0163163_11889981 3300014325 Bacteria 657
130 Ga0157380_10296080 3300014326 Bacteria 1488
131 Ga0157380_10853555 3300014326 Unclassified 932
132 Ga0157379_10404734 3300014968 Bacteria 1255
133 Ga0157379_11103181 3300014968 Unclassified 760
134 Ga0224712_10072345 3300022467 Bacteria 1403
135 Ga0207656_10001837 3300025321 Bacteria 7050
136 Ga0207653_10093686 3300025885 Bacteria 1055
137 Ga0207710_10000655 3300025900 Bacteria 19599
138 Ga0207643_10163262 3300025908 Bacteria 1341
139 Ga0207705_10060995 3300025909 Unclassified 2724
140 Ga0207654_10304754 3300025911 Bacteria 1084
141 Ga0207671_10007688 3300025914 Bacteria 9305
142 Ga0207660_10217712 3300025917 Bacteria 1497
143 Ga0207660_10328484 3300025917 Bacteria 1222
144 Ga0207662_10166851 3300025918 Unclassified 1410
145 Ga0207657_10248438 3300025919 Bacteria 1419
146 Ga0207649_10295946 3300025920 Bacteria 1182
147 Ga0207652_10110577 3300025921 Bacteria 2436
148 Ga0207646_11105819 3300025922 Unclassified 697
149 Ga0207681_10405209 3300025923 Bacteria 1102
150 Ga0207650_10076542 3300025925 Bacteria 2528
151 Ga0207659_10432433 3300025926 Bacteria 1106
152 Ga0207687_10736890 3300025927 Bacteria 838
153 Ga0207664_10316310 3300025929 Bacteria 1377
154 Ga0207690_10882021 3300025932 Unclassified 741
155 Ga0207690_10983517 3300025932 Unclassified 702
156 Ga0207709_10229023 3300025935 Bacteria 1345
157 Ga0207709_10616330 3300025935 Bacteria 861
158 Ga0207670_10059714 3300025936 Bacteria 2594
159 Ga0207670_10335258 3300025936 Unclassified 1194
160 Ga0207670_10898021 3300025936 Bacteria 742
161 Ga0207669_10388371 3300025937 Bacteria 1090
162 Ga0207711_10582771 3300025941 Bacteria 1044
163 Ga0207689_10384287 3300025942 Bacteria 1169
164 Ga0207661_10553427 3300025944 Unclassified 1054
165 Ga0207661_10811534 3300025944 Bacteria 861
166 Ga0207667_10811475 3300025949 Bacteria 932
167 Ga0207651_10985141 3300025960 Bacteria 753
168 Ga0207640_11058227 3300025981 Unclassified 716
169 Ga0207640_11297425 3300025981 Bacteria 650
170 Ga0207703_10823258 3300026035 Unclassified 887
171 Ga0207703_10835383 3300026035 Unclassified 880
172 Ga0207639_10677509 3300026041 Unclassified 955
173 Ga0207678_10144853 3300026067 Bacteria 2028
174 Ga0207708_10164850 3300026075 Bacteria 1752
175 Ga0207708_10347018 3300026075 Bacteria 1217
176 Ga0207702_10568942 3300026078 Bacteria 1110
177 Ga0207702_10886094 3300026078 Bacteria 884
178 Ga0207648_11645723 3300026089 Bacteria 603
179 Ga0207676_10441613 3300026095 Unclassified 1225
180 Ga0207674_10205569 3300026116 Bacteria 1918
181 Ga0207674_10229106 3300026116 Bacteria 1806
182 Ga0207674_10841515 3300026116 Unclassified 885
183 Ga0207674_11003794 3300026116 Bacteria 804
184 Ga0207675_100196420 3300026118 Bacteria 1936
185 Ga0207675_100779622 3300026118 Unclassified 968
186 Ga0207698_10337475 3300026142 Bacteria 1418
187 Ga0207698_10346988 3300026142 Bacteria 1400
188 Ga0207698_10477207 3300026142 Bacteria 1209
189 Ga0207698_11884625 3300026142 Unclassified 613
190 Ga0207698_12057181 3300026142 Unclassified 585
191 Ga0268265_11494686 3300028380 Bacteria 679
192 Ga0268264_10029795 3300028381 Bacteria 4472
193 Ga0268264_10034063 3300028381 Bacteria 4188
194 Ga0268264_10250245 3300028381 Bacteria 1646
195 Ga0265338_10090777 3300028800 Bacteria 2527
196 Ga0265332_10010816 3300031238 Bacteria 4054
197 Ga0265316_10913516 3300031344 Bacteria 613
198 Ga0307408_100044595 3300031548 Bacteria 3161
199 Ga0307408_100243153 3300031548 Bacteria 1480
200 Ga0307408_100330937 3300031548 Bacteria 1286
201 Ga0307408_100741427 3300031548 Bacteria 886
202 Ga0307408_101354801 3300031548 Bacteria 668
203 Ga0316579_10049436 3300031691 Bacteria 1965
204 Ga0316579_10059080 3300031691 Bacteria 1802
205 Ga0265342_10150486 3300031712 Bacteria 1292
206 Ga0316576_10018040 3300031727 Bacteria 4808
207 Ga0307405_10031591 3300031731 Bacteria 3119
208 Ga0307405_10079497 3300031731 Bacteria 2138
209 Ga0307405_10282504 3300031731 Bacteria 1250
210 Ga0307405_10320179 3300031731 Bacteria 1184
211 Ga0307405_10340146 3300031731 Bacteria 1153
212 Ga0307405_10394774 3300031731 Bacteria 1081
213 Ga0307405_10474549 3300031731 Bacteria 997
214 Ga0307405_10504607 3300031731 Bacteria 970
215 Ga0307405_11301847 3300031731 Bacteria 632
216 Ga0307413_10080059 3300031824 Bacteria 2090
217 Ga0307413_10155913 3300031824 Bacteria 1598
218 Ga0307413_10157603 3300031824 Bacteria 1591
219 Ga0307410_10069822 3300031852 Bacteria 2431
220 Ga0307410_10247180 3300031852 Bacteria 1385
221 Ga0307410_10750537 3300031852 Bacteria 826
222 Ga0307410_10809411 3300031852 Bacteria 797
223 Ga0307406_10684868 3300031901 Bacteria 854
224 Ga0307406_10715311 3300031901 Bacteria 837
225 Ga0307407_10030751 3300031903 Bacteria 2900
226 Ga0307407_10044041 3300031903 Bacteria 2513
227 Ga0307407_10154126 3300031903 Bacteria 1496
228 Ga0307407_10209123 3300031903 Bacteria 1312
229 Ga0307412_10319754 3300031911 Bacteria 1234
230 Ga0307412_10355131 3300031911 Bacteria 1178
231 Ga0307412_10412022 3300031911 Bacteria 1103
232 Ga0307412_12181010 3300031911 Bacteria 515
233 Ga0307409_100017871 3300031995 Bacteria 4743
234 Ga0307409_100018323 3300031995 Bacteria 4703
235 Ga0307409_100019004 3300031995 Bacteria 4640
236 Ga0307409_100019732 3300031995 Bacteria 4574
237 Ga0307409_100047127 3300031995 Bacteria 3269
238 Ga0307409_100253762 3300031995 Bacteria 1609
239 Ga0307409_100361062 3300031995 Bacteria 1374
240 Ga0307409_101256459 3300031995 Bacteria 765
241 Ga0307409_101858997 3300031995 Bacteria 631
242 Ga0307416_100017409 3300032002 Bacteria 5029
243 Ga0307416_100036812 3300032002 Bacteria 3758
244 Ga0307416_100066064 3300032002 Bacteria 2976
245 Ga0307416_100858765 3300032002 Bacteria 1006
246 Ga0307416_100961644 3300032002 Bacteria 956
247 Ga0307416_102792701 3300032002 Bacteria 584
248 Ga0307414_10135037 3300032004 Bacteria 1922
249 Ga0307414_10182322 3300032004 Bacteria 1690
250 Ga0307414_10204799 3300032004 Bacteria 1608
251 Ga0307414_10692255 3300032004 Bacteria 922
252 Ga0307414_11157622 3300032004 Bacteria 715
253 Ga0307411_10060612 3300032005 Bacteria 2514
254 Ga0307415_100035241 3300032126 Bacteria 3267
255 Ga0307415_100076454 3300032126 Bacteria 2373
256 Ga0307415_100125991 3300032126 Bacteria 1930
257 Ga0307415_100492186 3300032126 Bacteria 1070
258 Ga0307415_100510801 3300032126 Bacteria 1053
259 Ga0316585_10020953 3300032137 Bacteria 2005
260 Ga0316580_10007967 3300032139 Bacteria 3166
261 Ga0373940_0099669 3300035088 Bacteria 880
262 Ga0373946_0462575 3300035171 Unclassified 647
263 Ga0373961_0231417 3300035241 Bacteria 662
264 Ga0373931_0390719 3300035691 Bacteria 879
265 Ga0373931_0560785 3300035691 Unclassified 743
266 Ga0316582_0022228 3300036647 Bacteria 3762
267 Ga0395905_1712431 3300037471 Bacteria 534
268 Ga0436364_0609671 3300037853 Bacteria 5954
269 Ga0436365_0511550 3300039437 Bacteria 1795
270 Ga0436360_0665814 3300039438 Unclassified 997
271 Ga0436360_0895380 3300039438 Bacteria 562
272 Ga0439453_0008924 3300041408 Bacteria 1622
273 Ga0439462_0046975 3300042015 Bacteria 1157
274 Ga0450895_028216 3300042132 Unclassified 541
275 Ga0439440_0104003 3300042993 Bacteria 775
276 Ga0466961_0624596 3300044693 Bacteria 647
277 Ga0466963_0014557 3300044694 Bacteria 4854
278 Ga0466963_0083396 3300044694 Bacteria 2168
279 Ga0466963_0116977 3300044694 Bacteria 1832
280 Ga0466963_0167176 3300044694 Bacteria 1532
281 Ga0466963_0407856 3300044694 Unclassified 958
282 Ga0466963_0845198 3300044694 Bacteria 645
283 Ga0466964_0038623 3300044706 Bacteria 1920
284 Ga0453684_0003532 3300044712 Bacteria 34968
285 Ga0453684_0094313 3300044712 Bacteria 3682
286 Ga0453684_0199965 3300044712 Bacteria 2330
287 Ga0453684_0608573 3300044712 Bacteria 1197
288 Ga0466971_0025552 3300044719 Bacteria 2637
289 Ga0466971_0551359 3300044719 Bacteria 572
290 Ga0466970_0543205 3300044765 Bacteria 671
291 Ga0466957_0100522 3300044842 Bacteria 1823
292 Ga0466957_0520776 3300044842 Bacteria 826
293 Ga0466957_0633239 3300044842 Unclassified 751
294 Ga0466960_0117005 3300044901 Bacteria 1392
295 Ga0466959_0434442 3300045049 Unclassified 891
296 Ga0451576_0207122 3300045051 Bacteria 2048
297 Ga0451576_0349444 3300045051 Unclassified 1548
298 Ga0466958_0277599 3300045836 Unclassified 1074
299 Ga0466967_0000792 3300045976 Bacteria 16506
300 Ga0466967_0003553 3300045976 Bacteria 10209
301 Ga0466967_0015151 3300045976 Bacteria 6035
302 Ga0466967_0049482 3300045976 Bacteria 3675
303 Ga0466967_0058103 3300045976 Bacteria 3417
304 Ga0466967_0313064 3300045976 Unclassified 1512
305 Ga0466967_0328181 3300045976 Unclassified 1477
306 Ga0466967_0455801 3300045976 Bacteria 1250
307 Ga0466967_0875276 3300045976 Bacteria 893
308 Ga0466967_1007592 3300045976 Bacteria 829
309 Ga0466967_1784365 3300045976 Bacteria 612
310 Ga0495641_0000048 3300046461 Bacteria 74033
311 Ga0495653_0628530 3300046463 Unclassified 658
312 Ga0495653_0838211 3300046463 Unclassified 551
313 Ga0495594_0068920 3300046499 Bacteria 1965
314 Ga0495630_0342997 3300046517 Bacteria 1143
315 Ga0495631_0104171 3300046518 Bacteria 1221
316 Ga0495663_0102984 3300046525 Bacteria 942
317 Ga0495665_0126589 3300046531 Bacteria 1338
318 Ga0495586_0200067 3300046535 Unclassified 1132
319 Ga0495587_0076119 3300046536 Bacteria 1949
320 Ga0495645_0018710 3300046543 Bacteria 4980
321 Ga0495656_0067038 3300046615 Bacteria 1583
322 Ga0495656_0188521 3300046615 Bacteria 1017
323 Ga0495668_0394810 3300046616 Bacteria 760
324 Ga0495657_0028256 3300046675 Bacteria 3948
325 Ga0495623_0208044 3300046679 Bacteria 1121
326 Ga0495646_0540121 3300046680 Unclassified 596
327 Ga0495658_0008313 3300046683 Bacteria 5143
328 Ga0495613_0954955 3300046689 Unclassified 552
329 Ga0495649_0140998 3300046694 Bacteria 1269
330 Ga0495600_0353692 3300046809 Bacteria 920
331 Ga0495604_0846008 3300047317 Unclassified 574
332 Ga0495673_0023138 3300047469 Bacteria 3030
333 Ga0495686_0000003 3300047472 Bacteria 899502
334 Ga0495686_0002958 3300047472 Bacteria 15188
335 Ga0495686_0030566 3300047472 Bacteria 3497
336 Ga0495602_0151030 3300048088 Unclassified 1826
337 Ga0495602_1169938 3300048088 Unclassified 502
338 Ga0496102_0454418 3300048905 Bacteria 1202
339 Ga0496104_0899739 3300048907 Bacteria 790
340 Ga0496104_1453121 3300048907 Unclassified 589
341 Ga0496108_0157325 3300048911 Bacteria 1963
342 Ga0496109_0153701 3300048912 Bacteria 2155
343 Ga0496109_0984996 3300048912 Bacteria 781
344 Ga0496111_0459725 3300048914 Bacteria 939
345 Ga0496111_0894581 3300048914 Bacteria 640
346 Ga0496112_0085416 3300048915 Bacteria 3122
347 Ga0496112_0217673 3300048915 Bacteria 1866
348 Ga0496112_0218932 3300048915 Bacteria 1860
349 Ga0496112_0327565 3300048915 Bacteria 1476
350 Ga0496113_0337301 3300048916 Bacteria 1209
351 Ga0496113_0762276 3300048916 Bacteria 770
352 Ga0496115_0324766 3300048918 Bacteria 1258
353 Ga0501291_009397 3300049514 Bacteria 1371
354 Ga0501299_042642 3300049522 Unclassified 915
355 Ga0501031_0372601 3300049568 Unclassified 924
356 Ga0501032_0417013 3300049569 Unclassified 862
357 Ga0501032_0573022 3300049569 Unclassified 719
358 Ga0501032_1015819 3300049569 Unclassified 521
359 Ga0501033_0319413 3300049570 Unclassified 1091
360 Ga0501034_0006595 3300049571 Bacteria 12455
361 Ga0501034_0098574 3300049571 Bacteria 2918
362 Ga0501034_0632432 3300049571 Bacteria 973
363 Ga0501036_0101664 3300049572 Bacteria 2432
364 Ga0501036_0130866 3300049572 Unclassified 2119
365 Ga0501036_0133932 3300049572 Bacteria 2091
366 Ga0501037_0348673 3300049573 Bacteria 1022
367 Ga0501037_0521768 3300049573 Unclassified 804
368 Ga0501038_0144588 3300049574 Bacteria 1943
369 Ga0501038_0283697 3300049574 Bacteria 1303
370 Ga0501038_0328570 3300049574 Bacteria 1195
371 Ga0501038_0838102 3300049574 Bacteria 682
372 Ga0501039_0057050 3300049575 Bacteria 3025
373 Ga0501039_0188649 3300049575 Bacteria 1621
374 Ga0501039_0278831 3300049575 Bacteria 1314
375 Ga0501040_0105859 3300049576 Bacteria 1965
376 Ga0501041_0135157 3300049577 Unclassified 1536
377 Ga0501041_0291417 3300049577 Bacteria 1028
378 Ga0501042_0078050 3300049578 Bacteria 2371
379 Ga0501042_0084995 3300049578 Bacteria 2269
380 Ga0501042_0100701 3300049578 Unclassified 2077
381 Ga0501042_0456878 3300049578 Bacteria 926
382 Ga0501043_0034609 3300049579 Bacteria 3973
383 Ga0501043_0372649 3300049579 Unclassified 1082
384 Ga0501046_0141919 3300049580 Unclassified 1817
385 Ga0501046_0287114 3300049580 Bacteria 1204
386 Ga0501047_0055652 3300049581 Bacteria 3825
387 Ga0501048_0032612 3300049582 Bacteria 3764
388 Ga0501048_0173944 3300049582 Bacteria 1526
389 Ga0501048_0186818 3300049582 Unclassified 1469
390 Ga0501068_0280218 3300049584 Unclassified 1065
391 Ga0501070_0131188 3300049586 Bacteria 2070
392 Ga0501071_0012828 3300049587 Bacteria 5698
393 Ga0501071_0036752 3300049587 Bacteria 3494
394 Ga0501071_0427468 3300049587 Unclassified 1012
395 Ga0501071_0601360 3300049587 Unclassified 845
396 Ga0501072_0035849 3300049588 Bacteria 3887
397 Ga0501072_0223505 3300049588 Unclassified 1500
398 Ga0501072_0264655 3300049588 Bacteria 1368
399 Ga0501073_0010137 3300049589 Bacteria 6924
400 Ga0501073_0874068 3300049589 Unclassified 619
401 Ga0501074_0045654 3300049590 Bacteria 3169
402 Ga0501074_0096241 3300049590 Bacteria 2120
403 Ga0501074_0146404 3300049590 Unclassified 1689
404 Ga0501075_0024611 3300049591 Bacteria 4418
405 Ga0501075_0024741 3300049591 Bacteria 4407
406 Ga0501075_0176167 3300049591 Bacteria 1632
407 Ga0501075_1535322 3300049591 Bacteria 504
408 Ga0501076_0006450 3300049592 Bacteria 8513
409 Ga0501076_0021728 3300049592 Bacteria 4926
410 Ga0501076_0054893 3300049592 Bacteria 3158
411 Ga0501076_0406815 3300049592 Unclassified 1119
412 Ga0501076_0512064 3300049592 Unclassified 989
413 Ga0501077_0026756 3300049593 Bacteria 3662
414 Ga0501201_006233 3300049651 Unclassified 1127
415 Ga0501224_014989 3300049664 Unclassified 1148
416 Ga0501253_004947 3300049683 Bacteria 1715
417 Ga0501225_0011019 3300049705 Bacteria 2549
418 Ga0501079_0030203 3300049741 Bacteria 4164
419 Ga0501079_0266114 3300049741 Bacteria 1340
420 Ga0501079_0519847 3300049741 Unclassified 936
421 Ga0501080_0142940 3300049742 Bacteria 2212
422 Ga0501081_0012728 3300049743 Bacteria 5534
423 Ga0501081_0055471 3300049743 Bacteria 2738
424 Ga0501081_0512167 3300049743 Unclassified 895
425 Ga0501270_004994 3300049767 Bacteria 1519
426 Ga0501035_0231437 3300049822 Unclassified 1575
427 Ga0501035_0283267 3300049822 Unclassified 1400
428 Ga0501035_0583174 3300049822 Unclassified 913
429 Ga0501035_0768726 3300049822 Bacteria 772
430 Ga0501044_0391918 3300049823 Bacteria 1303
431 Ga0501044_0497136 3300049823 Unclassified 1121
432 Ga0501045_0026519 3300049824 Bacteria 4169
433 Ga0501045_0045485 3300049824 Bacteria 3196
434 Ga0501045_0068384 3300049824 Bacteria 2609
435 Ga0501212_015996 3300049851 Unclassified 1123
436 nmdc:mga05p37_1580601_c1 3300050507 Bacteria 647
437 nmdc:mga05p37_83983_c1 3300050507 Bacteria 3923
438 nmdc:mga0qj67_152313_c1 3300050509 Bacteria 1876
439 nmdc:mga0qj67_636259_c1 3300050509 Bacteria 852
440 nmdc:mga0qj67_972510_c1 3300050509 Bacteria 667
441 nmdc:mga06r32_1258317_c1 3300050510 Bacteria 685
442 nmdc:mga06r32_229448_c1 3300050510 Bacteria 1844
443 nmdc:mga06r32_706750_c1 3300050510 Bacteria 973
444 nmdc:mga06r32_899577_c1 3300050510 Unclassified 842
445 nmdc:mga08y16_1324320_c1 3300050511 Bacteria 686
446 nmdc:mga0n895_359484_c1 3300050512 Bacteria 1474
447 nmdc:mga0a205_223704_c1 3300050515 Bacteria 1767
448 Ga0500556_0005480 3300053104 Bacteria 3584
449 Ga0500628_148026 3300053129 Bacteria 655
450 Ga0501084_0035219 3300054114 Unclassified 4185
451 Ga0501084_0469943 3300054114 Bacteria 1063
452 Ga0501084_1416603 3300054114 Bacteria 582
453 Ga0590071_000261 3300059421 Bacteria 15373
454 Ga0590071_011463 3300059421 Bacteria 2074
455 Ga0590071_026987 3300059421 Bacteria 1363
456 Ga0590074_060283 3300059423 Unclassified 705
457 Ga0590075_001232 3300059424 Bacteria 6460
458 Ga0590075_019136 3300059424 Bacteria 1697
459 Ga0590077_000488 3300059426 Bacteria 11123
460 Ga0590077_000949 3300059426 Bacteria 7390
461 Ga0501082_0056347 3300060353 Bacteria 3385
462 Ga0501082_0079630 3300060353 Unclassified 2827
463 Ga0501082_0104447 3300060353 Bacteria 2451
464 Ga0501082_0403270 3300060353 Unclassified 1193
465 Ga0501082_1220789 3300060353 Bacteria 657
466 Ga0501082_1562433 3300060353 Unclassified 576
467 Ga0466962_0047502 3300061719 Bacteria 2051
468 Ga0466962_0061653 3300061719 Bacteria 1790
469 Ga0530510_0001206 3300061734 Bacteria 17244
470 Ga0530510_0013996 3300061734 Bacteria 5653
471 Ga0530510_0264896 3300061734 Bacteria 1282
472 Ga0530510_0501665 3300061734 Bacteria 920
473 Ga0530510_0553192 3300061734 Unclassified 874
474 Ga0530510_0571582 3300061734 Unclassified 859
475 Ga0070681_10105651
476 MBSR1b_contig_4224032
477 Ga0065714_10095990
478 Ga0065712_10084454
479 Ga0065715_10121939
480 Ga0065715_10445001
481 Ga0065715_10456896
482 Ga0070658_10052942
483 Ga0070658_10116686
484 Ga0070658_10613262
485 Ga0070683_100005754
486 Ga0070683_100131949
487 Ga0070683_100291622
488 Ga0070683_100681054
489 Ga0070683_101021834
490 Ga0070690_100004397
491 Ga0070670_100149459
492 Ga0068869_100301430
493 Ga0068869_100690717
494 Ga0070680_100593878
495 Ga0070660_100291609
496 Ga0070689_100078284
497 Ga0070687_100228953
498 Ga0070661_100185204
499 Ga0070692_10122767
500 Ga0070692_10460727
501 Ga0070692_11289703
502 Ga0070669_100040530
503 Ga0070675_100917528
504 Ga0070714_100542061
505 Ga0070713_101190923
506 Ga0070701_10018043
507 Ga0070705_100004959
508 Ga0070700_100164798
509 Ga0070694_100193748
510 Ga0070708_100379415
511 Ga0070708_100587169
512 Ga0070662_100033098
513 Ga0070681_10237993
514 Ga0070706_100064530
515 Ga0070707_100322543
516 Ga0070698_100025739
517 Ga0070698_100106538
518 Ga0070699_100936121
519 Ga0070679_100025866
520 Ga0070679_100190393
521 Ga0070679_101250172
522 Ga0070679_101482557
523 Ga0070684_100239527
524 Ga0070684_100415428
525 Ga0068853_100243744
526 Ga0070686_100004059
527 Ga0070695_100088338
528 Ga0070696_100103360
529 Ga0070696_101652214
530 Ga0070693_100002113
531 Ga0070693_100087520
532 Ga0070693_100193934
533 Ga0070704_100642649
534 Ga0068855_100398731
535 Ga0068855_100621645
536 Ga0070664_100746702
537 Ga0068857_100478567
538 Ga0068857_100896767
539 Ga0070702_100043739
540 Ga0070702_100098527
541 Ga0068852_100357636
542 Ga0068852_100773816
543 Ga0068852_100877346
544 Ga0068859_100075459
545 Ga0068859_100883745
546 Ga0068864_101166575
547 Ga0068861_101086110
548 Ga0068851_10003520
549 Ga0068870_10171241
550 Ga0068870_10176635
551 Ga0068870_10697904
552 Ga0068863_100797597
553 Ga0068860_100190451
554 Ga0068860_100410121
555 Ga0068860_101777594
556 Ga0068862_100118795
557 Ga0081538_10009257
558 Ga0081538_10009861
559 Ga0081539_10001390
560 Ga0068871_100281068
561 Ga0075430_100141752
562 Ga0075430_100247257
563 Ga0075431_100297384
564 Ga0075431_100540910
565 Ga0075431_101003386
566 Ga0075429_100874296
567 Ga0075429_100976538
568 Ga0097620_100075455
569 Ga0097620_100883751
570 Ga0075435_101096449
571 Ga0105240_10343676
572 Ga0111539_10478355
573 Ga0111539_11248396
574 Ga0105247_10009216
575 Ga0105247_10011020
576 Ga0105247_10816140
577 Ga0114129_11582432
578 Ga0114129_11754525
579 Ga0105243_10787898
580 Ga0105243_11204190
581 Ga0105241_10354079
582 Ga0105248_10827180
583 Ga0105237_10008467
584 Ga0105239_11314133
585 Ga0105246_10626713
586 Ga0157373_10015912
587 Ga0157373_10508115
588 Ga0157371_10064847
589 Ga0157371_10095237
590 Ga0157369_10012231
591 Ga0157369_10230349
592 Ga0163162_10462302
593 Ga0163162_11242848
594 Ga0163162_11318661
595 Ga0157372_10060204
596 Ga0157372_10065476
597 Ga0157372_10516563
598 Ga0157372_10584559
599 Ga0157372_11407801
600 Ga0157375_12053948
601 Ga0163163_10650015
602 Ga0163163_11884722
603 Ga0163163_11889981
604 Ga0157380_10296080
605 Ga0157380_10853555
606 Ga0157379_10404734
607 Ga0157379_11103181
608 Ga0224712_10072345
609 Ga0207656_10001837
610 Ga0207653_10093686
611 Ga0207710_10000655
612 Ga0207643_10163262
613 Ga0207705_10060995
614 Ga0207654_10304754
615 Ga0207671_10007688
616 Ga0207660_10217712
617 Ga0207660_10328484
618 Ga0207662_10166851
619 Ga0207657_10248438
620 Ga0207649_10295946
621 Ga0207652_10110577
622 Ga0207646_11105819
623 Ga0207681_10405209
624 Ga0207650_10076542
625 Ga0207659_10432433
626 Ga0207687_10736890
627 Ga0207664_10316310
628 Ga0207690_10882021
629 Ga0207690_10983517
630 Ga0207709_10229023
631 Ga0207709_10616330
632 Ga0207670_10059714
633 Ga0207670_10335258
634 Ga0207670_10898021
635 Ga0207669_10388371
636 Ga0207711_10582771
637 Ga0207689_10384287
638 Ga0207661_10553427
639 Ga0207661_10811534
640 Ga0207667_10811475
641 Ga0207651_10985141
642 Ga0207640_11058227
643 Ga0207640_11297425
644 Ga0207703_10823258
645 Ga0207703_10835383
646 Ga0207639_10677509
647 Ga0207678_10144853
648 Ga0207708_10164850
649 Ga0207708_10347018
650 Ga0207702_10568942
651 Ga0207702_10886094
652 Ga0207648_11645723
653 Ga0207676_10441613
654 Ga0207674_10205569
655 Ga0207674_10229106
656 Ga0207674_10841515
657 Ga0207674_11003794
658 Ga0207675_100196420
659 Ga0207675_100779622
660 Ga0207698_10337475
661 Ga0207698_10346988
662 Ga0207698_10477207
663 Ga0207698_11884625
664 Ga0207698_12057181
665 Ga0268265_11494686
666 Ga0268264_10029795
667 Ga0268264_10034063
668 Ga0268264_10250245
669 Ga0265338_10090777
670 Ga0265332_10010816
671 Ga0265316_10913516
672 Ga0307408_100044595
673 Ga0307408_100243153
674 Ga0307408_100330937
675 Ga0307408_100741427
676 Ga0307408_101354801
677 Ga0316579_10049436
678 Ga0316579_10059080
679 Ga0265342_10150486
680 Ga0316576_10018040
681 Ga0307405_10031591
682 Ga0307405_10079497
683 Ga0307405_10282504
684 Ga0307405_10320179
685 Ga0307405_10340146
686 Ga0307405_10394774
687 Ga0307405_10474549
688 Ga0307405_10504607
689 Ga0307405_11301847
690 Ga0307413_10080059
691 Ga0307413_10155913
692 Ga0307413_10157603
693 Ga0307410_10069822
694 Ga0307410_10247180
695 Ga0307410_10750537
696 Ga0307410_10809411
697 Ga0307406_10684868
698 Ga0307406_10715311
699 Ga0307407_10030751
700 Ga0307407_10044041
701 Ga0307407_10154126
702 Ga0307407_10209123
703 Ga0307412_10319754
704 Ga0307412_10355131
705 Ga0307412_10412022
706 Ga0307412_12181010
707 Ga0307409_100017871
708 Ga0307409_100018323
709 Ga0307409_100019004
710 Ga0307409_100019732
711 Ga0307409_100047127
712 Ga0307409_100253762
713 Ga0307409_100361062
714 Ga0307409_101256459
715 Ga0307409_101858997
716 Ga0307416_100017409
717 Ga0307416_100036812
718 Ga0307416_100066064
719 Ga0307416_100858765
720 Ga0307416_100961644
721 Ga0307416_102792701
722 Ga0307414_10135037
723 Ga0307414_10182322
724 Ga0307414_10204799
725 Ga0307414_10692255
726 Ga0307414_11157622
727 Ga0307411_10060612
728 Ga0307415_100035241
729 Ga0307415_100076454
730 Ga0307415_100125991
731 Ga0307415_100492186
732 Ga0307415_100510801
733 Ga0316585_10020953
734 Ga0316580_10007967
735 Ga0373940_0099669
736 Ga0373946_0462575
737 Ga0373961_0231417
738 Ga0373931_0390719
739 Ga0373931_0560785
740 Ga0316582_0022228
741 Ga0395905_1712431
742 Ga0436364_0609671
743 Ga0436365_0511550
744 Ga0436360_0665814
745 Ga0436360_0895380
746 Ga0439453_0008924
747 Ga0439462_0046975
748 Ga0450895_028216
749 Ga0439440_0104003
750 Ga0466961_0624596
751 Ga0466963_0014557
752 Ga0466963_0083396
753 Ga0466963_0116977
754 Ga0466963_0167176
755 Ga0466963_0407856
756 Ga0466963_0845198
757 Ga0466964_0038623
758 Ga0453684_0003532
759 Ga0453684_0094313
760 Ga0453684_0199965
761 Ga0453684_0608573
762 Ga0466971_0025552
763 Ga0466971_0551359
764 Ga0466970_0543205
765 Ga0466957_0100522
766 Ga0466957_0520776
767 Ga0466957_0633239
768 Ga0466960_0117005
769 Ga0466959_0434442
770 Ga0451576_0207122
771 Ga0451576_0349444
772 Ga0466958_0277599
773 Ga0466967_0000792
774 Ga0466967_0003553
775 Ga0466967_0015151
776 Ga0466967_0049482
777 Ga0466967_0058103
778 Ga0466967_0313064
779 Ga0466967_0328181
780 Ga0466967_0455801
781 Ga0466967_0875276
782 Ga0466967_1007592
783 Ga0466967_1784365
784 Ga0495641_0000048
785 Ga0495653_0628530
786 Ga0495653_0838211
787 Ga0495594_0068920
788 Ga0495630_0342997
789 Ga0495631_0104171
790 Ga0495663_0102984
791 Ga0495665_0126589
792 Ga0495586_0200067
793 Ga0495587_0076119
794 Ga0495645_0018710
795 Ga0495656_0067038
796 Ga0495656_0188521
797 Ga0495668_0394810
798 Ga0495657_0028256
799 Ga0495623_0208044
800 Ga0495646_0540121
801 Ga0495658_0008313
802 Ga0495613_0954955
803 Ga0495649_0140998
804 Ga0495600_0353692
805 Ga0495604_0846008
806 Ga0495673_0023138
807 Ga0495686_0000003
808 Ga0495686_0002958
809 Ga0495686_0030566
810 Ga0495602_0151030
811 Ga0495602_1169938
812 Ga0496102_0454418
813 Ga0496104_0899739
814 Ga0496104_1453121
815 Ga0496108_0157325
816 Ga0496109_0153701
817 Ga0496109_0984996
818 Ga0496111_0459725
819 Ga0496111_0894581
820 Ga0496112_0085416
821 Ga0496112_0217673
822 Ga0496112_0218932
823 Ga0496112_0327565
824 Ga0496113_0337301
825 Ga0496113_0762276
826 Ga0496115_0324766
827 Ga0501291_009397
828 Ga0501299_042642
829 Ga0501031_0372601
830 Ga0501032_0417013
831 Ga0501032_0573022
832 Ga0501032_1015819
833 Ga0501033_0319413
834 Ga0501034_0006595
835 Ga0501034_0098574
836 Ga0501034_0632432
837 Ga0501036_0101664
838 Ga0501036_0130866
839 Ga0501036_0133932
840 Ga0501037_0348673
841 Ga0501037_0521768
842 Ga0501038_0144588
843 Ga0501038_0283697
844 Ga0501038_0328570
845 Ga0501038_0838102
846 Ga0501039_0057050
847 Ga0501039_0188649
848 Ga0501039_0278831
849 Ga0501040_0105859
850 Ga0501041_0135157
851 Ga0501041_0291417
852 Ga0501042_0078050
853 Ga0501042_0084995
854 Ga0501042_0100701
855 Ga0501042_0456878
856 Ga0501043_0034609
857 Ga0501043_0372649
858 Ga0501046_0141919
859 Ga0501046_0287114
860 Ga0501047_0055652
861 Ga0501048_0032612
862 Ga0501048_0173944
863 Ga0501048_0186818
864 Ga0501068_0280218
865 Ga0501070_0131188
866 Ga0501071_0012828
867 Ga0501071_0036752
868 Ga0501071_0427468
869 Ga0501071_0601360
870 Ga0501072_0035849
871 Ga0501072_0223505
872 Ga0501072_0264655
873 Ga0501073_0010137
874 Ga0501073_0874068
875 Ga0501074_0045654
876 Ga0501074_0096241
877 Ga0501074_0146404
878 Ga0501075_0024611
879 Ga0501075_0024741
880 Ga0501075_0176167
881 Ga0501075_1535322
882 Ga0501076_0006450
883 Ga0501076_0021728
884 Ga0501076_0054893
885 Ga0501076_0406815
886 Ga0501076_0512064
887 Ga0501077_0026756
888 Ga0501201_006233
889 Ga0501224_014989
890 Ga0501253_004947
891 Ga0501225_0011019
892 Ga0501079_0030203
893 Ga0501079_0266114
894 Ga0501079_0519847
895 Ga0501080_0142940
896 Ga0501081_0012728
897 Ga0501081_0055471
898 Ga0501081_0512167
899 Ga0501270_004994
900 Ga0501035_0231437
901 Ga0501035_0283267
902 Ga0501035_0583174
903 Ga0501035_0768726
904 Ga0501044_0391918
905 Ga0501044_0497136
906 Ga0501045_0026519
907 Ga0501045_0045485
908 Ga0501045_0068384
909 Ga0501212_015996
910 nmdc:mga05p37_1580601_c1
911 nmdc:mga05p37_83983_c1
912 nmdc:mga0qj67_152313_c1
913 nmdc:mga0qj67_636259_c1
914 nmdc:mga0qj67_972510_c1
915 nmdc:mga06r32_1258317_c1
916 nmdc:mga06r32_229448_c1
917 nmdc:mga06r32_706750_c1
918 nmdc:mga06r32_899577_c1
919 nmdc:mga08y16_1324320_c1
920 nmdc:mga0n895_359484_c1
921 nmdc:mga0a205_223704_c1
922 Ga0500556_0005480
923 Ga0500628_148026
924 Ga0501084_0035219
925 Ga0501084_0469943
926 Ga0501084_1416603
927 Ga0590071_000261
928 Ga0590071_011463
929 Ga0590071_026987
930 Ga0590074_060283
931 Ga0590075_001232
932 Ga0590075_019136
933 Ga0590077_000488
934 Ga0590077_000949
935 Ga0501082_0056347
936 Ga0501082_0079630
937 Ga0501082_0104447
938 Ga0501082_0403270
939 Ga0501082_1220789
940 Ga0501082_1562433
941 Ga0466962_0047502
942 Ga0466962_0061653
943 Ga0530510_0001206
944 Ga0530510_0013996
945 Ga0530510_0264896
946 Ga0530510_0501665
947 Ga0530510_0553192
948 Ga0530510_0571582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

20

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9877 1 148
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9832 2 146
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9819 2 146
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9815 2 143
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9808 1 144
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9814 2 146 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9808 1 144 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9771 2 143 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9754 1 128 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9693 1 128 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A1V6M1G7-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9994 1 144 GO:0004347
GO:0004801
GO:0005737
GO:0006094
GO:0006096
GO:0006098
GO:0097367
AF-A0A1H7KTS9-F1-model_v4 Ribose 5-phosphate isomerase B 0.9983 1 149 GO:0005975
GO:0016861
AF-A0A2V9AAN3-F1-model_v4 Ribose 5-phosphate isomerase B 0.9966 1 148 GO:0005975
GO:0016861
AF-A0A536LPP1-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9963 1 147 GO:0004751
GO:0005975
AF-A0A7S7NYL1-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9955 1 146 GO:0005975
GO:0016861

Map