F451061

General Info

Members Datasets Scaffolds Average Seq Length
473 261 946 96

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_1463501|Ga0451843_1463501_32_367
Length 111
Sequence MTQAAGVQVTSIAGWDDRAMDAPVDLTALAINVVIPEELRWRDTRRDEEFELQSLTIRMLPDGTLAAKAYGRPVAGGRGAYVSFPVPDRPELAALVAAAADEAARRWAAHA

Samples

Sample ID Description Type Environment
1 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
123 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
259 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
260 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
261 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.42
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 13.11
Rhizosphere 82.45
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451843_1463501 3300041509 Bacteria 1223
2 JGI25406J46586_10024357 3300003203 Bacteria 2373
3 rootL2_10236471 3300003322 Bacteria 1755
4 Ga0006562J51391_1145100 3300003578 Bacteria 1780
5 Ga0006562J51391_1145102 3300003578 Bacteria 1020
6 Ga0070690_100607228 3300005330 Bacteria 831
7 Ga0070680_100727857 3300005336 Bacteria 854
8 Ga0070682_100198224 3300005337 Bacteria 1414
9 Ga0070682_100917961 3300005337 Bacteria 721
10 Ga0070682_102045197 3300005337 Bacteria 504
11 Ga0068868_100644771 3300005338 Bacteria 942
12 Ga0070660_100933535 3300005339 Bacteria 732
13 Ga0070689_101422952 3300005340 Bacteria 627
14 Ga0070691_10359556 3300005341 Bacteria 811
15 Ga0070687_101338279 3300005343 Bacteria 533
16 Ga0070692_10261767 3300005345 Bacteria 1040
17 Ga0070671_100090923 3300005355 Bacteria 2555
18 Ga0070671_100901864 3300005355 Bacteria 772
19 Ga0070674_102012570 3300005356 Bacteria 526
20 Ga0070659_100578251 3300005366 Bacteria 964
21 Ga0070709_10134186 3300005434 Bacteria 1693
22 Ga0070709_11024050 3300005434 Bacteria 658
23 Ga0070709_11172623 3300005434 Bacteria 616
24 Ga0070714_100587682 3300005435 Bacteria 1068
25 Ga0070713_100325585 3300005436 Bacteria 1420
26 Ga0070713_100492831 3300005436 Bacteria 1155
27 Ga0070713_100995724 3300005436 Bacteria 808
28 Ga0070710_10014795 3300005437 Bacteria 3932
29 Ga0070710_10261237 3300005437 Bacteria 1116
30 Ga0070710_10371714 3300005437 Bacteria 951
31 Ga0070710_10766158 3300005437 Unclassified 686
32 Ga0070711_100087066 3300005439 Bacteria 2241
33 Ga0070711_101561830 3300005439 Bacteria 576
34 Ga0070705_100894437 3300005440 Bacteria 714
35 Ga0070694_100252930 3300005444 Bacteria 1333
36 Ga0070663_100808119 3300005455 Bacteria 804
37 Ga0070662_101045097 3300005457 Bacteria 700
38 Ga0070685_10687783 3300005466 Bacteria 745
39 Ga0070699_101191582 3300005518 Bacteria 699
40 Ga0070699_102084528 3300005518 Bacteria 518
41 Ga0070679_100953658 3300005530 Bacteria 802
42 Ga0070672_100996686 3300005543 Bacteria 742
43 Ga0070695_100545855 3300005545 Bacteria 903
44 Ga0070695_100764180 3300005545 Bacteria 772
45 Ga0070693_100249219 3300005547 Bacteria 1176
46 Ga0070665_100198427 3300005548 Bacteria 2007
47 Ga0070704_100647671 3300005549 Bacteria 932
48 Ga0070704_100985645 3300005549 Bacteria 762
49 Ga0068855_100280734 3300005563 Bacteria 1849
50 Ga0068855_101729820 3300005563 Bacteria 637
51 Ga0068854_101782331 3300005578 Bacteria 564
52 Ga0068854_101931851 3300005578 Bacteria 543
53 Ga0068856_100051798 3300005614 Bacteria 4047
54 Ga0068856_100478169 3300005614 Bacteria 1267
55 Ga0068856_100589523 3300005614 Bacteria 1133
56 Ga0070702_100599208 3300005615 Bacteria 826
57 Ga0070702_101522744 3300005615 Bacteria 551
58 Ga0068864_100288507 3300005618 Bacteria 1534
59 Ga0068863_101237061 3300005841 Bacteria 753
60 Ga0068863_101279525 3300005841 Bacteria 740
61 Ga0068858_100864422 3300005842 Bacteria 884
62 Ga0068860_101054550 3300005843 Bacteria 832
63 Ga0068860_102118259 3300005843 Bacteria 584
64 Ga0081539_10000877 3300005985 Bacteria 57649
65 Ga0070717_10039310 3300006028 Bacteria 3849
66 Ga0070717_10105870 3300006028 Bacteria 2394
67 Ga0070717_10130286 3300006028 Bacteria 2162
68 Ga0070717_10306545 3300006028 Bacteria 1412
69 Ga0075365_10364327 3300006038 Bacteria 1019
70 Ga0075365_10936071 3300006038 Bacteria 611
71 Ga0070715_10079711 3300006163 Bacteria 1483
72 Ga0070716_100048256 3300006173 Bacteria 2406
73 Ga0070716_100152943 3300006173 Bacteria 1486
74 Ga0070716_100318093 3300006173 Bacteria 1089
75 Ga0070712_100068153 3300006175 Bacteria 2534
76 Ga0070712_100164610 3300006175 Bacteria 1715
77 Ga0075367_10895025 3300006178 Bacteria 566
78 Ga0097621_100132791 3300006237 Bacteria 2120
79 Ga0097621_100306527 3300006237 Bacteria 1404
80 Ga0068871_100319068 3300006358 Bacteria 1368
81 Ga0068871_100626788 3300006358 Bacteria 980
82 Ga0075430_100179387 3300006846 Bacteria 1762
83 Ga0075431_100684675 3300006847 Bacteria 1004
84 Ga0075434_100197307 3300006871 Bacteria 2032
85 Ga0075429_100482937 3300006880 Bacteria 1086
86 Ga0105251_10436811 3300009011 Bacteria 605
87 Ga0105245_10288984 3300009098 Bacteria 1605
88 Ga0105247_10071311 3300009101 Bacteria 2172
89 Ga0105247_10267648 3300009101 Bacteria 1174
90 Ga0105243_12564204 3300009148 Bacteria 549
91 Ga0105242_10715277 3300009176 Bacteria 982
92 Ga0105248_10076361 3300009177 Bacteria 3766
93 Ga0105237_10062866 3300009545 Bacteria 3711
94 Ga0105237_11302898 3300009545 Bacteria 733
95 Ga0105238_10137728 3300009551 Bacteria 2419
96 Ga0105238_10872571 3300009551 Bacteria 917
97 Ga0105238_11756727 3300009551 Bacteria 652
98 Ga0105249_11016834 3300009553 Bacteria 898
99 Ga0105239_10330770 3300010375 Bacteria 1719
100 Ga0105239_12551981 3300010375 Bacteria 596
101 Ga0105246_10036075 3300011119 Bacteria 3310
102 Ga0105246_12034585 3300011119 Bacteria 555
103 Ga0157371_10455064 3300013102 Bacteria 941
104 Ga0157370_10257215 3300013104 Bacteria 1614
105 Ga0157369_10018174 3300013105 Bacteria 7886
106 Ga0157369_10119909 3300013105 Bacteria 2791
107 Ga0157369_10372967 3300013105 Bacteria 1481
108 Ga0157374_10723727 3300013296 Bacteria 1009
109 Ga0157374_11070304 3300013296 Bacteria 826
110 Ga0163162_10083409 3300013306 Bacteria 3270
111 Ga0163162_10539291 3300013306 Bacteria 1295
112 Ga0157372_10749069 3300013307 Bacteria 1136
113 Ga0163163_10533048 3300014325 Bacteria 1236
114 Ga0157380_10225739 3300014326 Bacteria 1679
115 Ga0157380_11567041 3300014326 Bacteria 713
116 Ga0157377_11532663 3300014745 Bacteria 531
117 Ga0157379_10636316 3300014968 Bacteria 998
118 Ga0157379_10813560 3300014968 Bacteria 882
119 Ga0157379_11518560 3300014968 Bacteria 652
120 Ga0213875_10088642 3300021388 Bacteria 1443
121 Ga0207692_10018700 3300025898 Bacteria 3115
122 Ga0207692_10050668 3300025898 Bacteria 2101
123 Ga0207692_10215567 3300025898 Bacteria 1135
124 Ga0207692_10382407 3300025898 Bacteria 874
125 Ga0207699_10019433 3300025906 Bacteria 3623
126 Ga0207699_10116917 3300025906 Bacteria 1718
127 Ga0207699_10150507 3300025906 Bacteria 1539
128 Ga0207699_10201694 3300025906 Bacteria 1348
129 Ga0207699_10355034 3300025906 Bacteria 1036
130 Ga0207654_10634752 3300025911 Bacteria 764
131 Ga0207654_11104143 3300025911 Bacteria 578
132 Ga0207707_10646175 3300025912 Bacteria 892
133 Ga0207671_10358223 3300025914 Bacteria 1157
134 Ga0207693_10177939 3300025915 Bacteria 1674
135 Ga0207663_10299912 3300025916 Bacteria 1200
136 Ga0207663_10315309 3300025916 Bacteria 1173
137 Ga0207660_10638029 3300025917 Bacteria 868
138 Ga0207657_11227505 3300025919 Bacteria 569
139 Ga0207694_10545840 3300025924 Bacteria 972
140 Ga0207687_10425316 3300025927 Bacteria 1097
141 Ga0207700_10129042 3300025928 Bacteria 2061
142 Ga0207700_11188260 3300025928 Bacteria 681
143 Ga0207664_10211439 3300025929 Bacteria 1678
144 Ga0207664_10284883 3300025929 Bacteria 1450
145 Ga0207664_10501089 3300025929 Bacteria 1087
146 Ga0207644_10302269 3300025931 Bacteria 1290
147 Ga0207670_11709535 3300025936 Bacteria 535
148 Ga0207704_11819487 3300025938 Bacteria 524
149 Ga0207665_10006967 3300025939 Bacteria 7482
150 Ga0207665_10340065 3300025939 Bacteria 1131
151 Ga0207665_10657990 3300025939 Bacteria 821
152 Ga0207691_10587459 3300025940 Bacteria 943
153 Ga0207711_10064452 3300025941 Bacteria 3165
154 Ga0207689_10017513 3300025942 Bacteria 6060
155 Ga0207667_11463966 3300025949 Bacteria 655
156 Ga0207667_11503009 3300025949 Bacteria 644
157 Ga0207639_10540975 3300026041 Bacteria 1068
158 Ga0207678_10016850 3300026067 Bacteria 6416
159 Ga0207702_10025768 3300026078 Bacteria 4882
160 Ga0207702_10137508 3300026078 Bacteria 2206
161 Ga0207702_10184719 3300026078 Bacteria 1922
162 Ga0207702_10603925 3300026078 Bacteria 1077
163 Ga0207702_11258360 3300026078 Bacteria 734
164 Ga0207641_10250609 3300026088 Bacteria 1654
165 Ga0207641_10816057 3300026088 Bacteria 923
166 Ga0207676_11117946 3300026095 Bacteria 779
167 Ga0207674_10578308 3300026116 Bacteria 1085
168 Ga0207675_102624714 3300026118 Bacteria 513
169 Ga0207683_10125739 3300026121 Bacteria 2304
170 Ga0268266_10329685 3300028379 Bacteria 1430
171 Ga0268264_11091640 3300028381 Bacteria 806
172 Ga0268264_12265435 3300028381 Bacteria 550
173 Ga0307514_10093965 3300031649 Bacteria 2175
174 Ga0307516_10006718 3300031730 Bacteria 13445
175 Ga0307405_10104510 3300031731 Bacteria 1906
176 Ga0307413_10032196 3300031824 Bacteria 2969
177 Ga0307518_10029571 3300031838 Bacteria 3966
178 Ga0307410_10004925 3300031852 Bacteria 6995
179 Ga0307410_10623429 3300031852 Bacteria 902
180 Ga0307407_10002201 3300031903 Bacteria 7520
181 Ga0307407_10376038 3300031903 Bacteria 1013
182 Ga0307407_10919905 3300031903 Bacteria 672
183 Ga0307412_10897419 3300031911 Bacteria 776
184 Ga0307412_11440075 3300031911 Bacteria 625
185 Ga0307409_100002547 3300031995 Bacteria 9560
186 Ga0307409_100133178 3300031995 Bacteria 2128
187 Ga0307416_100003134 3300032002 Bacteria 9681
188 Ga0307416_103105624 3300032002 Bacteria 556
189 Ga0307414_10032652 3300032004 Bacteria 3431
190 Ga0307411_10027743 3300032005 Bacteria 3431
191 Ga0307411_10299537 3300032005 Bacteria 1289
192 Ga0307415_100002950 3300032126 Bacteria 8544
193 Ga0307510_10197109 3300033180 Bacteria 1554
194 Ga0307510_10233867 3300033180 Bacteria 1338
195 Ga0373930_0133513 3300034816 Bacteria 613
196 Ga0373958_0005201 3300034819 Bacteria 1965
197 Ga0373928_0128804 3300035084 Bacteria 685
198 Ga0373944_0003016 3300035089 Bacteria 4327
199 Ga0373949_0016945 3300035090 Bacteria 1638
200 Ga0373951_0055320 3300035091 Bacteria 984
201 Ga0373923_0014194 3300035111 Bacteria 2987
202 Ga0373923_0082231 3300035111 Bacteria 1398
203 Ga0373932_0385155 3300035112 Bacteria 540
204 Ga0373936_0000848 3300035113 Bacteria 10882
205 Ga0373936_0143007 3300035113 Bacteria 1033
206 Ga0373945_0000180 3300035116 Bacteria 16902
207 Ga0373953_0116622 3300035117 Bacteria 1132
208 Ga0373957_0018992 3300035120 Bacteria 2413
209 Ga0373943_0002968 3300035170 Bacteria 7699
210 Ga0373943_0041628 3300035170 Bacteria 2222
211 Ga0373946_0001056 3300035171 Bacteria 9482
212 Ga0373955_0025978 3300035172 Bacteria 3012
213 Ga0373924_0142197 3300035410 Bacteria 1047
214 Ga0373924_0440788 3300035410 Bacteria 583
215 Ga0373931_0062023 3300035691 Bacteria 2017
216 Ga0373935_0000268 3300035692 Bacteria 25733
217 Ga0373935_0171752 3300035692 Bacteria 1483
218 Ga0373935_1395946 3300035692 Bacteria 523
219 Ga0373927_0016556 3300035695 Bacteria 4862
220 Ga0373927_0247279 3300035695 Bacteria 1172
221 Ga0373933_0047665 3300035724 Bacteria 2549
222 Ga0373947_0000374 3300035725 Bacteria 25329
223 Ga0373947_0054185 3300035725 Bacteria 2420
224 Ga0373937_0042687 3300036401 Bacteria 4137
225 Ga0373937_1861601 3300036401 Bacteria 548
226 Ga0373925_0035626 3300037068 Bacteria 3672
227 Ga0373925_1505996 3300037068 Bacteria 550
228 Ga0373925_1592860 3300037068 Bacteria 534
229 Ga0395899_0158951 3300037312 Bacteria 1598
230 Ga0395900_1060361 3300037418 Bacteria 729
231 Ga0395900_1476894 3300037418 Bacteria 592
232 Ga0395898_0375278 3300037466 Bacteria 1356
233 Ga0395898_0623866 3300037466 Bacteria 1021
234 Ga0395905_0622179 3300037471 Bacteria 982
235 Ga0436364_0178667 3300037853 Bacteria 2116
236 Ga0451797_0935595 3300041453 Bacteria 835
237 Ga0451800_0409488 3300041459 Bacteria 519
238 Ga0451835_0349124 3300041492 Bacteria 511
239 Ga0451851_0009950 3300041507 Bacteria 865
240 Ga0451853_3054543 3300041512 Bacteria 2885
241 Ga0451853_3869033 3300041512 Bacteria 794
242 Ga0466969_0038321 3300044656 Bacteria 2413
243 Ga0466972_0006871 3300044658 Bacteria 5711
244 Ga0466972_0064225 3300044658 Bacteria 1757
245 Ga0466972_0191885 3300044658 Bacteria 958
246 Ga0466965_0000002 3300044683 Bacteria 297957
247 Ga0466965_0001514 3300044683 Bacteria 9421
248 Ga0466965_0121779 3300044683 Bacteria 1348
249 Ga0466965_0276446 3300044683 Bacteria 906
250 Ga0466965_0780528 3300044683 Bacteria 552
251 Ga0466966_0006422 3300044684 Bacteria 7776
252 Ga0466966_0032726 3300044684 Bacteria 3367
253 Ga0466966_0618038 3300044684 Bacteria 652
254 Ga0466961_0003600 3300044693 Bacteria 9666
255 Ga0466961_0221027 3300044693 Bacteria 1167
256 Ga0466961_0273200 3300044693 Unclassified 1035
257 Ga0466963_0002579 3300044694 Bacteria 10168
258 Ga0466963_0029071 3300044694 Bacteria 3554
259 Ga0466963_0541669 3300044694 Bacteria 822
260 Ga0466964_0003045 3300044706 Bacteria 6084
261 Ga0466964_0004642 3300044706 Bacteria 5079
262 Ga0466964_0129949 3300044706 Bacteria 1146
263 Ga0466971_0000592 3300044719 Bacteria 14355
264 Ga0466971_0397367 3300044719 Unclassified 671
265 Ga0466971_0457367 3300044719 Bacteria 626
266 Ga0466971_0575182 3300044719 Unclassified 560
267 Ga0466968_0118566 3300044735 Bacteria 1196
268 Ga0466970_0004857 3300044765 Bacteria 6635
269 Ga0466970_0438339 3300044765 Bacteria 748
270 Ga0466970_0645407 3300044765 Unclassified 615
271 Ga0466957_0003537 3300044842 Bacteria 8600
272 Ga0466957_0078201 3300044842 Bacteria 2056
273 Ga0466957_1161374 3300044842 Bacteria 558
274 Ga0466960_0073151 3300044901 Unclassified 1710
275 Ga0466960_0132102 3300044901 Bacteria 1319
276 Ga0466960_0284276 3300044901 Bacteria 928
277 Ga0466960_0350579 3300044901 Bacteria 842
278 Ga0466960_0777104 3300044901 Bacteria 579
279 Ga0466959_0165531 3300045049 Bacteria 1553
280 Ga0466959_0234441 3300045049 Bacteria 1269
281 Ga0466958_0086611 3300045836 Bacteria 1933
282 Ga0466958_0094813 3300045836 Bacteria 1849
283 Ga0466958_0788437 3300045836 Bacteria 619
284 Ga0466967_0017271 3300045976 Bacteria 5722
285 Ga0466967_0157072 3300045976 Bacteria 2131
286 Ga0466967_0347290 3300045976 Bacteria 1435
287 Ga0466967_0359429 3300045976 Bacteria 1411
288 Ga0466967_2147915 3300045976 Bacteria 554
289 Ga0495651_0075027 3300046462 Bacteria 2565
290 Ga0495651_0092569 3300046462 Bacteria 2264
291 Ga0495653_0000846 3300046463 Bacteria 23582
292 Ga0495582_0104501 3300046473 Bacteria 1587
293 Ga0495664_0001511 3300046477 Bacteria 12324
294 Ga0495608_0247383 3300046511 Bacteria 1112
295 Ga0495618_0033034 3300046514 Bacteria 3243
296 Ga0495618_0149840 3300046514 Bacteria 1490
297 Ga0495628_0101605 3300046516 Bacteria 2219
298 Ga0495630_0008704 3300046517 Bacteria 7289
299 Ga0495652_0029067 3300046529 Bacteria 4856
300 Ga0495652_0277337 3300046529 Bacteria 1229
301 Ga0495640_0265851 3300046533 Bacteria 1071
302 Ga0495587_0047596 3300046536 Bacteria 2542
303 Ga0495587_0062896 3300046536 Bacteria 2172
304 Ga0495645_0323086 3300046543 Bacteria 1001
305 Ga0495667_0004264 3300046559 Bacteria 9639
306 Ga0495667_0006938 3300046559 Bacteria 7681
307 Ga0495667_0364192 3300046559 Unclassified 913
308 Ga0495634_0052046 3300046642 Bacteria 2746
309 Ga0495635_0002898 3300046663 Bacteria 11780
310 Ga0495635_0025597 3300046663 Bacteria 4110
311 Ga0495657_0022364 3300046675 Bacteria 4530
312 Ga0495646_0039134 3300046680 Bacteria 2925
313 Ga0495646_0056862 3300046680 Bacteria 2344
314 Ga0495647_0133492 3300046681 Bacteria 1053
315 Ga0495624_0433845 3300046690 Bacteria 787
316 Ga0495600_0126675 3300046809 Bacteria 1661
317 Ga0495600_0770530 3300046809 Bacteria 575
318 Ga0495581_0048205 3300047315 Bacteria 2461
319 Ga0495581_0114784 3300047315 Bacteria 1566
320 Ga0495604_0679708 3300047317 Bacteria 655
321 Ga0495674_0000257 3300047319 Bacteria 45119
322 Ga0495674_0352565 3300047319 Bacteria 1194
323 Ga0495676_0021132 3300047321 Bacteria 5696
324 Ga0495680_0007588 3300047322 Bacteria 9916
325 Ga0495680_0010698 3300047322 Bacteria 8182
326 Ga0495675_0396059 3300047444 Bacteria 806
327 Ga0495684_0364077 3300047471 Bacteria 1023
328 Ga0495602_0315881 3300048088 Bacteria 1138
329 Ga0495602_0863075 3300048088 Bacteria 604
330 Ga0496100_0056960 3300048903 Bacteria 2558
331 Ga0496100_0252451 3300048903 Bacteria 1305
332 Ga0496100_0401310 3300048903 Bacteria 1044
333 Ga0496100_0628326 3300048903 Bacteria 835
334 Ga0496100_1247871 3300048903 Bacteria 586
335 Ga0496100_1377557 3300048903 Bacteria 557
336 Ga0496101_0029417 3300048904 Bacteria 3842
337 Ga0496101_0067899 3300048904 Bacteria 2605
338 Ga0496101_0072895 3300048904 Bacteria 2521
339 Ga0496101_0444858 3300048904 Bacteria 1022
340 Ga0496101_0523087 3300048904 Bacteria 937
341 Ga0496101_1002944 3300048904 Bacteria 657
342 Ga0496102_0057253 3300048905 Bacteria 3558
343 Ga0496102_0062521 3300048905 Bacteria 3409
344 Ga0496102_0113362 3300048905 Bacteria 2529
345 Ga0496103_0192126 3300048906 Bacteria 1313
346 Ga0496103_0314837 3300048906 Bacteria 1007
347 Ga0496103_0497155 3300048906 Bacteria 780
348 Ga0496104_0791690 3300048907 Bacteria 854
349 Ga0496104_1158747 3300048907 Bacteria 676
350 Ga0496104_1374916 3300048907 Bacteria 609
351 Ga0496105_0059183 3300048908 Bacteria 3161
352 Ga0496105_0111417 3300048908 Bacteria 2258
353 Ga0496105_0173286 3300048908 Bacteria 1768
354 Ga0496105_1302167 3300048908 Bacteria 530
355 Ga0496106_0105447 3300048909 Bacteria 2190
356 Ga0496106_0406029 3300048909 Bacteria 1095
357 Ga0496106_0482081 3300048909 Bacteria 996
358 Ga0496107_0034639 3300048910 Bacteria 3617
359 Ga0496107_0223874 3300048910 Bacteria 1400
360 Ga0496107_0910948 3300048910 Bacteria 641
361 Ga0496108_0057993 3300048911 Bacteria 3253
362 Ga0496108_0119318 3300048911 Bacteria 2261
363 Ga0496108_0256681 3300048911 Bacteria 1521
364 Ga0496108_0280808 3300048911 Bacteria 1450
365 Ga0496108_0530685 3300048911 Bacteria 1027
366 Ga0496108_1057415 3300048911 Bacteria 691
367 Ga0496109_0049782 3300048912 Bacteria 3815
368 Ga0496109_0091986 3300048912 Bacteria 2805
369 Ga0496109_0198840 3300048912 Bacteria 1884
370 Ga0496109_1502849 3300048912 Bacteria 608
371 Ga0496110_0057852 3300048913 Bacteria 3414
372 Ga0496110_0273174 3300048913 Bacteria 1539
373 Ga0496110_0382689 3300048913 Bacteria 1282
374 Ga0496110_0902727 3300048913 Bacteria 789
375 Ga0496111_0010453 3300048914 Bacteria 6228
376 Ga0496111_0050385 3300048914 Bacteria 3004
377 Ga0496111_0428826 3300048914 Bacteria 976
378 Ga0496111_0543974 3300048914 Bacteria 853
379 Ga0496112_0018469 3300048915 Bacteria 6567
380 Ga0496112_0061833 3300048915 Bacteria 3692
381 Ga0496112_0185233 3300048915 Bacteria 2045
382 Ga0496112_1444672 3300048915 Bacteria 602
383 Ga0496112_1478140 3300048915 Bacteria 593
384 Ga0496114_0140583 3300048917 Bacteria 2090
385 Ga0496114_0546651 3300048917 Bacteria 1023
386 Ga0496114_0630222 3300048917 Bacteria 944
387 Ga0496114_0889343 3300048917 Bacteria 771
388 Ga0496114_1178614 3300048917 Bacteria 652
389 Ga0496115_0152434 3300048918 Bacteria 1909
390 Ga0501031_0007588 3300049568 Bacteria 7064
391 Ga0501031_0030601 3300049568 Bacteria 3512
392 Ga0501032_0018370 3300049569 Bacteria 4900
393 Ga0501032_0103517 3300049569 Bacteria 1886
394 Ga0501033_0011399 3300049570 Bacteria 6805
395 Ga0501033_0216793 3300049570 Bacteria 1363
396 Ga0501033_0780962 3300049570 Bacteria 646
397 Ga0501034_0054416 3300049571 Bacteria 4028
398 Ga0501034_0071616 3300049571 Bacteria 3476
399 Ga0501034_0129641 3300049571 Bacteria 2506
400 Ga0501034_1650714 3300049571 Unclassified 513
401 Ga0501036_0054214 3300049572 Bacteria 3396
402 Ga0501036_0061512 3300049572 Bacteria 3180
403 Ga0501036_0213795 3300049572 Bacteria 1620
404 Ga0501036_0464259 3300049572 Bacteria 1054
405 Ga0501037_0354463 3300049573 Bacteria 1012
406 Ga0501038_0003679 3300049574 Bacteria 14281
407 Ga0501038_0061461 3300049574 Bacteria 3212
408 Ga0501038_0130731 3300049574 Bacteria 2062
409 Ga0501038_0134162 3300049574 Bacteria 2030
410 Ga0501038_0372829 3300049574 Bacteria 1108
411 Ga0501039_0021684 3300049575 Bacteria 4929
412 Ga0501039_0588465 3300049575 Bacteria 872
413 Ga0501039_0945207 3300049575 Bacteria 670
414 Ga0501040_0025610 3300049576 Bacteria 3967
415 Ga0501041_0034175 3300049577 Bacteria 3078
416 Ga0501041_0338401 3300049577 Bacteria 950
417 Ga0501041_0717804 3300049577 Bacteria 640
418 Ga0501042_0009098 3300049578 Bacteria 6603
419 Ga0501042_0067433 3300049578 Bacteria 2558
420 Ga0501042_0199759 3300049578 Bacteria 1442
421 Ga0501043_0109720 3300049579 Bacteria 2167
422 Ga0501043_0169133 3300049579 Bacteria 1706
423 Ga0501046_0215743 3300049580 Bacteria 1423
424 Ga0501046_0810281 3300049580 Bacteria 656
425 Ga0501048_0004155 3300049582 Bacteria 11039
426 Ga0501048_0908300 3300049582 Bacteria 633
427 Ga0501067_0470365 3300049583 Unclassified 702
428 Ga0501069_0620520 3300049585 Unclassified 650
429 Ga0501070_0087255 3300049586 Bacteria 2583
430 Ga0501070_0112408 3300049586 Bacteria 2251
431 Ga0501070_0620117 3300049586 Bacteria 861
432 Ga0501071_0007415 3300049587 Bacteria 7201
433 Ga0501071_0385529 3300049587 Bacteria 1069
434 Ga0501072_0023586 3300049588 Bacteria 4779
435 Ga0501073_0707964 3300049589 Bacteria 695
436 Ga0501075_0015899 3300049591 Bacteria 5412
437 Ga0501076_0017422 3300049592 Bacteria 5459
438 Ga0501076_0455570 3300049592 Bacteria 1053
439 Ga0501077_0062762 3300049593 Bacteria 2357
440 Ga0501233_086443 3300049668 Bacteria 814
441 Ga0501079_0043334 3300049741 Bacteria 3473
442 Ga0501080_0025701 3300049742 Bacteria 5469
443 Ga0501081_0020063 3300049743 Bacteria 4456
444 Ga0501083_0290182 3300049744 Bacteria 1064
445 Ga0501035_0059863 3300049822 Bacteria 3392
446 Ga0501035_0257482 3300049822 Bacteria 1480
447 Ga0501035_0798427 3300049822 Bacteria 754
448 Ga0501044_0454712 3300049823 Bacteria 1187
449 Ga0501045_0014801 3300049824 Bacteria 5531
450 Ga0501045_0083326 3300049824 Bacteria 2359
451 Ga0501045_0904575 3300049824 Bacteria 648
452 Ga0501045_1113517 3300049824 Bacteria 577
453 Ga0501212_020447 3300049851 Bacteria 1020
454 nmdc:mga0yw44_1236718_c1 3300050492 Bacteria 504
455 nmdc:mga05p37_1185223_c1 3300050507 Bacteria 791
456 nmdc:mga09592_791102_c1 3300050508 Bacteria 803
457 nmdc:mga0qj67_162455_c1 3300050509 Bacteria 1813
458 nmdc:mga0n895_460546_c1 3300050512 Bacteria 1283
459 nmdc:mga0n895_642504_c1 3300050512 Bacteria 1060
460 nmdc:mga08x19_1239111_c1 3300050514 Bacteria 529
461 Ga0495601_0165374 3300053077 Bacteria 1446
462 Ga0495595_0326474 3300053084 Bacteria 773
463 Ga0495619_0555156 3300053085 Bacteria 788
464 Ga0501084_0257377 3300054114 Bacteria 1473
465 Ga0501082_0079321 3300060353 Bacteria 2832
466 Ga0501082_0328884 3300060353 Bacteria 1332
467 Ga0466962_0072570 3300061719 Bacteria 1644
468 Ga0466962_0154597 3300061719 Bacteria 1114
469 Ga0530510_0034478 3300061734 Bacteria 3646
470 2819691916 2818991462 Bacteria 4320267
471 2884996202 2884994152 Bacteria 4492978
472 2906801292 2906799679 Bacteria 4031749
473 8045832814 8045830549 Bacteria 4444727
474 Ga0451843_1463501
475 JGI25406J46586_10024357
476 rootL2_10236471
477 Ga0006562J51391_1145100
478 Ga0006562J51391_1145102
479 Ga0070690_100607228
480 Ga0070680_100727857
481 Ga0070682_100198224
482 Ga0070682_100917961
483 Ga0070682_102045197
484 Ga0068868_100644771
485 Ga0070660_100933535
486 Ga0070689_101422952
487 Ga0070691_10359556
488 Ga0070687_101338279
489 Ga0070692_10261767
490 Ga0070671_100090923
491 Ga0070671_100901864
492 Ga0070674_102012570
493 Ga0070659_100578251
494 Ga0070709_10134186
495 Ga0070709_11024050
496 Ga0070709_11172623
497 Ga0070714_100587682
498 Ga0070713_100325585
499 Ga0070713_100492831
500 Ga0070713_100995724
501 Ga0070710_10014795
502 Ga0070710_10261237
503 Ga0070710_10371714
504 Ga0070710_10766158
505 Ga0070711_100087066
506 Ga0070711_101561830
507 Ga0070705_100894437
508 Ga0070694_100252930
509 Ga0070663_100808119
510 Ga0070662_101045097
511 Ga0070685_10687783
512 Ga0070699_101191582
513 Ga0070699_102084528
514 Ga0070679_100953658
515 Ga0070672_100996686
516 Ga0070695_100545855
517 Ga0070695_100764180
518 Ga0070693_100249219
519 Ga0070665_100198427
520 Ga0070704_100647671
521 Ga0070704_100985645
522 Ga0068855_100280734
523 Ga0068855_101729820
524 Ga0068854_101782331
525 Ga0068854_101931851
526 Ga0068856_100051798
527 Ga0068856_100478169
528 Ga0068856_100589523
529 Ga0070702_100599208
530 Ga0070702_101522744
531 Ga0068864_100288507
532 Ga0068863_101237061
533 Ga0068863_101279525
534 Ga0068858_100864422
535 Ga0068860_101054550
536 Ga0068860_102118259
537 Ga0081539_10000877
538 Ga0070717_10039310
539 Ga0070717_10105870
540 Ga0070717_10130286
541 Ga0070717_10306545
542 Ga0075365_10364327
543 Ga0075365_10936071
544 Ga0070715_10079711
545 Ga0070716_100048256
546 Ga0070716_100152943
547 Ga0070716_100318093
548 Ga0070712_100068153
549 Ga0070712_100164610
550 Ga0075367_10895025
551 Ga0097621_100132791
552 Ga0097621_100306527
553 Ga0068871_100319068
554 Ga0068871_100626788
555 Ga0075430_100179387
556 Ga0075431_100684675
557 Ga0075434_100197307
558 Ga0075429_100482937
559 Ga0105251_10436811
560 Ga0105245_10288984
561 Ga0105247_10071311
562 Ga0105247_10267648
563 Ga0105243_12564204
564 Ga0105242_10715277
565 Ga0105248_10076361
566 Ga0105237_10062866
567 Ga0105237_11302898
568 Ga0105238_10137728
569 Ga0105238_10872571
570 Ga0105238_11756727
571 Ga0105249_11016834
572 Ga0105239_10330770
573 Ga0105239_12551981
574 Ga0105246_10036075
575 Ga0105246_12034585
576 Ga0157371_10455064
577 Ga0157370_10257215
578 Ga0157369_10018174
579 Ga0157369_10119909
580 Ga0157369_10372967
581 Ga0157374_10723727
582 Ga0157374_11070304
583 Ga0163162_10083409
584 Ga0163162_10539291
585 Ga0157372_10749069
586 Ga0163163_10533048
587 Ga0157380_10225739
588 Ga0157380_11567041
589 Ga0157377_11532663
590 Ga0157379_10636316
591 Ga0157379_10813560
592 Ga0157379_11518560
593 Ga0213875_10088642
594 Ga0207692_10018700
595 Ga0207692_10050668
596 Ga0207692_10215567
597 Ga0207692_10382407
598 Ga0207699_10019433
599 Ga0207699_10116917
600 Ga0207699_10150507
601 Ga0207699_10201694
602 Ga0207699_10355034
603 Ga0207654_10634752
604 Ga0207654_11104143
605 Ga0207707_10646175
606 Ga0207671_10358223
607 Ga0207693_10177939
608 Ga0207663_10299912
609 Ga0207663_10315309
610 Ga0207660_10638029
611 Ga0207657_11227505
612 Ga0207694_10545840
613 Ga0207687_10425316
614 Ga0207700_10129042
615 Ga0207700_11188260
616 Ga0207664_10211439
617 Ga0207664_10284883
618 Ga0207664_10501089
619 Ga0207644_10302269
620 Ga0207670_11709535
621 Ga0207704_11819487
622 Ga0207665_10006967
623 Ga0207665_10340065
624 Ga0207665_10657990
625 Ga0207691_10587459
626 Ga0207711_10064452
627 Ga0207689_10017513
628 Ga0207667_11463966
629 Ga0207667_11503009
630 Ga0207639_10540975
631 Ga0207678_10016850
632 Ga0207702_10025768
633 Ga0207702_10137508
634 Ga0207702_10184719
635 Ga0207702_10603925
636 Ga0207702_11258360
637 Ga0207641_10250609
638 Ga0207641_10816057
639 Ga0207676_11117946
640 Ga0207674_10578308
641 Ga0207675_102624714
642 Ga0207683_10125739
643 Ga0268266_10329685
644 Ga0268264_11091640
645 Ga0268264_12265435
646 Ga0307514_10093965
647 Ga0307516_10006718
648 Ga0307405_10104510
649 Ga0307413_10032196
650 Ga0307518_10029571
651 Ga0307410_10004925
652 Ga0307410_10623429
653 Ga0307407_10002201
654 Ga0307407_10376038
655 Ga0307407_10919905
656 Ga0307412_10897419
657 Ga0307412_11440075
658 Ga0307409_100002547
659 Ga0307409_100133178
660 Ga0307416_100003134
661 Ga0307416_103105624
662 Ga0307414_10032652
663 Ga0307411_10027743
664 Ga0307411_10299537
665 Ga0307415_100002950
666 Ga0307510_10197109
667 Ga0307510_10233867
668 Ga0373930_0133513
669 Ga0373958_0005201
670 Ga0373928_0128804
671 Ga0373944_0003016
672 Ga0373949_0016945
673 Ga0373951_0055320
674 Ga0373923_0014194
675 Ga0373923_0082231
676 Ga0373932_0385155
677 Ga0373936_0000848
678 Ga0373936_0143007
679 Ga0373945_0000180
680 Ga0373953_0116622
681 Ga0373957_0018992
682 Ga0373943_0002968
683 Ga0373943_0041628
684 Ga0373946_0001056
685 Ga0373955_0025978
686 Ga0373924_0142197
687 Ga0373924_0440788
688 Ga0373931_0062023
689 Ga0373935_0000268
690 Ga0373935_0171752
691 Ga0373935_1395946
692 Ga0373927_0016556
693 Ga0373927_0247279
694 Ga0373933_0047665
695 Ga0373947_0000374
696 Ga0373947_0054185
697 Ga0373937_0042687
698 Ga0373937_1861601
699 Ga0373925_0035626
700 Ga0373925_1505996
701 Ga0373925_1592860
702 Ga0395899_0158951
703 Ga0395900_1060361
704 Ga0395900_1476894
705 Ga0395898_0375278
706 Ga0395898_0623866
707 Ga0395905_0622179
708 Ga0436364_0178667
709 Ga0451797_0935595
710 Ga0451800_0409488
711 Ga0451835_0349124
712 Ga0451851_0009950
713 Ga0451853_3054543
714 Ga0451853_3869033
715 Ga0466969_0038321
716 Ga0466972_0006871
717 Ga0466972_0064225
718 Ga0466972_0191885
719 Ga0466965_0000002
720 Ga0466965_0001514
721 Ga0466965_0121779
722 Ga0466965_0276446
723 Ga0466965_0780528
724 Ga0466966_0006422
725 Ga0466966_0032726
726 Ga0466966_0618038
727 Ga0466961_0003600
728 Ga0466961_0221027
729 Ga0466961_0273200
730 Ga0466963_0002579
731 Ga0466963_0029071
732 Ga0466963_0541669
733 Ga0466964_0003045
734 Ga0466964_0004642
735 Ga0466964_0129949
736 Ga0466971_0000592
737 Ga0466971_0397367
738 Ga0466971_0457367
739 Ga0466971_0575182
740 Ga0466968_0118566
741 Ga0466970_0004857
742 Ga0466970_0438339
743 Ga0466970_0645407
744 Ga0466957_0003537
745 Ga0466957_0078201
746 Ga0466957_1161374
747 Ga0466960_0073151
748 Ga0466960_0132102
749 Ga0466960_0284276
750 Ga0466960_0350579
751 Ga0466960_0777104
752 Ga0466959_0165531
753 Ga0466959_0234441
754 Ga0466958_0086611
755 Ga0466958_0094813
756 Ga0466958_0788437
757 Ga0466967_0017271
758 Ga0466967_0157072
759 Ga0466967_0347290
760 Ga0466967_0359429
761 Ga0466967_2147915
762 Ga0495651_0075027
763 Ga0495651_0092569
764 Ga0495653_0000846
765 Ga0495582_0104501
766 Ga0495664_0001511
767 Ga0495608_0247383
768 Ga0495618_0033034
769 Ga0495618_0149840
770 Ga0495628_0101605
771 Ga0495630_0008704
772 Ga0495652_0029067
773 Ga0495652_0277337
774 Ga0495640_0265851
775 Ga0495587_0047596
776 Ga0495587_0062896
777 Ga0495645_0323086
778 Ga0495667_0004264
779 Ga0495667_0006938
780 Ga0495667_0364192
781 Ga0495634_0052046
782 Ga0495635_0002898
783 Ga0495635_0025597
784 Ga0495657_0022364
785 Ga0495646_0039134
786 Ga0495646_0056862
787 Ga0495647_0133492
788 Ga0495624_0433845
789 Ga0495600_0126675
790 Ga0495600_0770530
791 Ga0495581_0048205
792 Ga0495581_0114784
793 Ga0495604_0679708
794 Ga0495674_0000257
795 Ga0495674_0352565
796 Ga0495676_0021132
797 Ga0495680_0007588
798 Ga0495680_0010698
799 Ga0495675_0396059
800 Ga0495684_0364077
801 Ga0495602_0315881
802 Ga0495602_0863075
803 Ga0496100_0056960
804 Ga0496100_0252451
805 Ga0496100_0401310
806 Ga0496100_0628326
807 Ga0496100_1247871
808 Ga0496100_1377557
809 Ga0496101_0029417
810 Ga0496101_0067899
811 Ga0496101_0072895
812 Ga0496101_0444858
813 Ga0496101_0523087
814 Ga0496101_1002944
815 Ga0496102_0057253
816 Ga0496102_0062521
817 Ga0496102_0113362
818 Ga0496103_0192126
819 Ga0496103_0314837
820 Ga0496103_0497155
821 Ga0496104_0791690
822 Ga0496104_1158747
823 Ga0496104_1374916
824 Ga0496105_0059183
825 Ga0496105_0111417
826 Ga0496105_0173286
827 Ga0496105_1302167
828 Ga0496106_0105447
829 Ga0496106_0406029
830 Ga0496106_0482081
831 Ga0496107_0034639
832 Ga0496107_0223874
833 Ga0496107_0910948
834 Ga0496108_0057993
835 Ga0496108_0119318
836 Ga0496108_0256681
837 Ga0496108_0280808
838 Ga0496108_0530685
839 Ga0496108_1057415
840 Ga0496109_0049782
841 Ga0496109_0091986
842 Ga0496109_0198840
843 Ga0496109_1502849
844 Ga0496110_0057852
845 Ga0496110_0273174
846 Ga0496110_0382689
847 Ga0496110_0902727
848 Ga0496111_0010453
849 Ga0496111_0050385
850 Ga0496111_0428826
851 Ga0496111_0543974
852 Ga0496112_0018469
853 Ga0496112_0061833
854 Ga0496112_0185233
855 Ga0496112_1444672
856 Ga0496112_1478140
857 Ga0496114_0140583
858 Ga0496114_0546651
859 Ga0496114_0630222
860 Ga0496114_0889343
861 Ga0496114_1178614
862 Ga0496115_0152434
863 Ga0501031_0007588
864 Ga0501031_0030601
865 Ga0501032_0018370
866 Ga0501032_0103517
867 Ga0501033_0011399
868 Ga0501033_0216793
869 Ga0501033_0780962
870 Ga0501034_0054416
871 Ga0501034_0071616
872 Ga0501034_0129641
873 Ga0501034_1650714
874 Ga0501036_0054214
875 Ga0501036_0061512
876 Ga0501036_0213795
877 Ga0501036_0464259
878 Ga0501037_0354463
879 Ga0501038_0003679
880 Ga0501038_0061461
881 Ga0501038_0130731
882 Ga0501038_0134162
883 Ga0501038_0372829
884 Ga0501039_0021684
885 Ga0501039_0588465
886 Ga0501039_0945207
887 Ga0501040_0025610
888 Ga0501041_0034175
889 Ga0501041_0338401
890 Ga0501041_0717804
891 Ga0501042_0009098
892 Ga0501042_0067433
893 Ga0501042_0199759
894 Ga0501043_0109720
895 Ga0501043_0169133
896 Ga0501046_0215743
897 Ga0501046_0810281
898 Ga0501048_0004155
899 Ga0501048_0908300
900 Ga0501067_0470365
901 Ga0501069_0620520
902 Ga0501070_0087255
903 Ga0501070_0112408
904 Ga0501070_0620117
905 Ga0501071_0007415
906 Ga0501071_0385529
907 Ga0501072_0023586
908 Ga0501073_0707964
909 Ga0501075_0015899
910 Ga0501076_0017422
911 Ga0501076_0455570
912 Ga0501077_0062762
913 Ga0501233_086443
914 Ga0501079_0043334
915 Ga0501080_0025701
916 Ga0501081_0020063
917 Ga0501083_0290182
918 Ga0501035_0059863
919 Ga0501035_0257482
920 Ga0501035_0798427
921 Ga0501044_0454712
922 Ga0501045_0014801
923 Ga0501045_0083326
924 Ga0501045_0904575
925 Ga0501045_1113517
926 Ga0501212_020447
927 nmdc:mga0yw44_1236718_c1
928 nmdc:mga05p37_1185223_c1
929 nmdc:mga09592_791102_c1
930 nmdc:mga0qj67_162455_c1
931 nmdc:mga0n895_460546_c1
932 nmdc:mga0n895_642504_c1
933 nmdc:mga08x19_1239111_c1
934 Ga0495601_0165374
935 Ga0495595_0326474
936 Ga0495619_0555156
937 Ga0501084_0257377
938 Ga0501082_0079321
939 Ga0501082_0328884
940 Ga0466962_0072570
941 Ga0466962_0154597
942 Ga0530510_0034478
943 2819691916
944 2884996202
945 2906801292
946 8045832814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.6262 24 71
3oyy-assembly1.cif.gz_A structure of pseudomonas aeruginosa elongation factor p 0.5349 11 67
5dlq-assembly2.cif.gz_E crystal structure of rangtp-exportin 4-eif5a complex 0.5331 11 67
3oyy-assembly2.cif.gz_B structure of pseudomonas aeruginosa elongation factor p 0.527 15 71
5cyb-assembly1.cif.gz_A-2 structure of a lipocalin lipoprotein affecting virulence in streptococcus pneumoniae 0.5224 22 53
ID Description Score Start End Superfamily
af_F4JUX3_73_134_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6638 24 67 2.30.30.30
af_Q4DXQ6_38_94_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6417 23 71 2.30.30.30
3cinA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.6256 30 55 3.30.360.10
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6211 23 77 2.30.30.30
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6186 24 71 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1H4Z9X9-F1-model_v4 Uncharacterized protein 0.9854 2 92
AF-A0A1C6TB04-F1-model_v4 Uncharacterized protein 0.9843 2 96
AF-A0A1H1YGY9-F1-model_v4 Uncharacterized protein 0.9803 6 96
AF-A0A0A0JPG1-F1-model_v4 Uncharacterized protein 0.9797 6 96
AF-A0A2T3VG97-F1-model_v4 deleted 0.9796 2 96

Map