F451004

General Info

Members Datasets Scaffolds Average Seq Length
473 249 465 227

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10115338|Ga0157372_101153382
Length 261
Sequence MIIFCSQQLFFTDRLLCHSLQRSEHCSTKQNPELCFLVMERILQLTSDGSYTIAVPSMHVTYHSIHGAIQESMHVFINAGLQPLLHQFETLHIFEMGFGTGLNALLSLQQATQHNQKIFYYAAELFPLKPYEYSSLNYSSKLQNDSLQSYFKLMHECEWGKDVSIHPLFTLHKTNESLLNLITDHAFNLIFFDAFAPAAQPELWTQQVFKKVFQLLANKGMLVTYCSKGDVRRAMLAADFKVEKLQGPPRKREMLRAIKAI

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
176 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
191 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
192 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
193 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
212 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
213 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
219 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
220 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
246 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
249 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.36
Nodule 0
Rhizoplane 0.21
Rhizosphere 80.97
Stem 0
Stem Tuber 0
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004905 3300001979 Bacteria 5692
2 JGI24740J21852_10033948 3300001979 Bacteria 1613
3 JGI24739J22299_10124070 3300001989 Bacteria 770
4 JGI24744J21845_10022158 3300002077 Bacteria 1248
5 JGI25154J39366_1000012 3300002738 Bacteria 287601
6 JGI25406J46586_10002742 3300003203 Bacteria 8291
7 JGI25153J46596_10027577 3300003215 Unclassified 1986
8 rootH1_10060194 3300003316 Bacteria 1919
9 rootH1_10179425 3300003316 Bacteria 1096
10 rootH1_10190589 3300003316 Bacteria 2395
11 rootH2_10115022 3300003320 Bacteria 1638
12 rootH2_10135145 3300003320 Bacteria 1832
13 rootH2_10168463 3300003320 Bacteria 2158
14 rootH2_10198254 3300003320 Bacteria 1197
15 rootH2_10314643 3300003320 Bacteria 1261
16 rootL2_10014974 3300003322 Bacteria 21232
17 rootL2_10020852 3300003322 Bacteria 3243
18 rootL2_10051034 3300003322 Bacteria 4261
19 rootL2_10086591 3300003322 Bacteria 3381
20 rootL2_10113318 3300003322 Bacteria 1928
21 rootL2_10168080 3300003322 Bacteria 1314
22 rootL2_10201946 3300003322 Unclassified 2519
23 rootL2_10253065 3300003322 Unclassified 1586
24 rootH1_10020501 3300003323 Bacteria 26877
25 rootH1_10044480 3300003323 Bacteria 1884
26 JGI25160J50197_1003604 3300003354 Bacteria 6874
27 JGI25160J50197_1021931 3300003354 Bacteria 1883
28 Ga0055526_1011118 3300003771 Bacteria 4100
29 Ga0055526_1023425 3300003771 Bacteria 2061
30 Ga0055528_1000153 3300003790 Bacteria 57255
31 Ga0055530_10000805 3300003791 Bacteria 26057
32 Ga0055531_10000284 3300003794 Bacteria 51146
33 Ga0055531_10020731 3300003794 Bacteria 2586
34 Ga0065165_1000159 3300005262 Bacteria 116983
35 Ga0065714_10094168 3300005288 Bacteria 1824
36 Ga0065704_10181233 3300005289 Bacteria 1236
37 Ga0065712_10075441 3300005290 Bacteria 3844
38 Ga0065712_10247499 3300005290 Bacteria 960
39 Ga0065707_10110999 3300005295 Bacteria 2409
40 Ga0070676_10126559 3300005328 Bacteria 1611
41 Ga0070683_100009092 3300005329 Bacteria 8480
42 Ga0070683_100045346 3300005329 Bacteria 4057
43 Ga0070683_100188632 3300005329 Bacteria 1957
44 Ga0070683_100565705 3300005329 Bacteria 1087
45 Ga0070690_100149390 3300005330 Bacteria 1593
46 Ga0070690_100185000 3300005330 Bacteria 1441
47 Ga0070670_100024005 3300005331 Bacteria 5245
48 Ga0070670_100047379 3300005331 Bacteria 3699
49 Ga0070670_100171677 3300005331 Bacteria 1881
50 Ga0070677_10055701 3300005333 Unclassified 1615
51 Ga0068869_100005758 3300005334 Bacteria 7820
52 Ga0068869_100013589 3300005334 Bacteria 5418
53 Ga0068869_100048044 3300005334 Bacteria 3084
54 Ga0068869_100108289 3300005334 Bacteria 2111
55 Ga0068869_100377233 3300005334 Unclassified 1161
56 Ga0070666_10000064 3300005335 Bacteria 79823
57 Ga0070666_10035817 3300005335 Unclassified 3291
58 Ga0070666_10422133 3300005335 Bacteria 961
59 Ga0070680_100052387 3300005336 Bacteria 3331
60 Ga0070682_100037602 3300005337 Bacteria 2965
61 Ga0068868_100038803 3300005338 Bacteria 3697
62 Ga0068868_100249040 3300005338 Unclassified 1495
63 Ga0068868_100666110 3300005338 Unclassified 928
64 Ga0070689_100084778 3300005340 Bacteria 2490
65 Ga0070687_100084964 3300005343 Bacteria 1736
66 Ga0070687_100275836 3300005343 Bacteria 1056
67 Ga0070661_100010672 3300005344 Bacteria 6390
68 Ga0070661_100191444 3300005344 Unclassified 1560
69 Ga0070668_100037275 3300005347 Bacteria 3712
70 Ga0070668_100100088 3300005347 Bacteria 2296
71 Ga0070669_100011558 3300005353 Bacteria 6264
72 Ga0070669_100291224 3300005353 Bacteria 1311
73 Ga0070675_100002115 3300005354 Bacteria 14665
74 Ga0070675_100037225 3300005354 Bacteria 3962
75 Ga0070675_100046216 3300005354 Bacteria 3565
76 Ga0070675_100252942 3300005354 Bacteria 1543
77 Ga0070675_100602361 3300005354 Unclassified 996
78 Ga0070671_100014145 3300005355 Bacteria 6444
79 Ga0070671_100094207 3300005355 Bacteria 2510
80 Ga0070674_100016973 3300005356 Bacteria 4569
81 Ga0070674_100031799 3300005356 Bacteria 3500
82 Ga0070674_100073072 3300005356 Bacteria 2430
83 Ga0070673_100001051 3300005364 Bacteria 15685
84 Ga0070673_100001247 3300005364 Bacteria 14780
85 Ga0070673_100082188 3300005364 Bacteria 2614
86 Ga0070673_100860164 3300005364 Bacteria 839
87 Ga0070659_100032283 3300005366 Bacteria 4060
88 Ga0070659_100188757 3300005366 Bacteria 1693
89 Ga0070667_100010938 3300005367 Bacteria 7505
90 Ga0070667_100060084 3300005367 Bacteria 3217
91 Ga0070667_100273153 3300005367 Bacteria 1516
92 Ga0070667_100441170 3300005367 Bacteria 1189
93 Ga0070713_100372052 3300005436 Bacteria 1330
94 Ga0070701_10004865 3300005438 Bacteria 5494
95 Ga0070700_100043955 3300005441 Bacteria 2749
96 Ga0070700_100076697 3300005441 Bacteria 2147
97 Ga0070700_100253065 3300005441 Bacteria 1264
98 Ga0070678_100075808 3300005456 Unclassified 2532
99 Ga0070678_100382264 3300005456 Bacteria 1218
100 Ga0070662_100083564 3300005457 Bacteria 2383
101 Ga0070681_10308842 3300005458 Bacteria 1491
102 Ga0068867_100039399 3300005459 Bacteria 3445
103 Ga0068867_100193392 3300005459 Bacteria 1625
104 Ga0068867_100315401 3300005459 Unclassified 1293
105 Ga0070685_10032591 3300005466 Bacteria 2919
106 Ga0070685_10559713 3300005466 Unclassified 817
107 Ga0070679_100166221 3300005530 Bacteria 2180
108 Ga0070684_100004375 3300005535 Bacteria 10739
109 Ga0070684_100041221 3300005535 Unclassified 3980
110 Ga0068853_100115586 3300005539 Bacteria 2388
111 Ga0068853_100671786 3300005539 Bacteria 987
112 Ga0070686_100083930 3300005544 Bacteria 2116
113 Ga0070665_100182033 3300005548 Unclassified 2102
114 Ga0068855_100081596 3300005563 Bacteria 3748
115 Ga0070664_100002301 3300005564 Bacteria 15347
116 Ga0070664_100449055 3300005564 Bacteria 1183
117 Ga0068854_100092580 3300005578 Unclassified 2252
118 Ga0068854_100214856 3300005578 Bacteria 1519
119 Ga0068856_100089448 3300005614 Bacteria 3062
120 Ga0068852_100004036 3300005616 Bacteria 10318
121 Ga0068852_100075299 3300005616 Bacteria 2977
122 Ga0068852_100109367 3300005616 Bacteria 2510
123 Ga0068852_100195423 3300005616 Bacteria 1911
124 Ga0068852_100673015 3300005616 Bacteria 1044
125 Ga0068859_100000003 3300005617 Bacteria 479218
126 Ga0068859_100004846 3300005617 Bacteria 13695
127 Ga0068859_100090517 3300005617 Bacteria 3110
128 Ga0068864_100006628 3300005618 Bacteria 9477
129 Ga0068864_100065234 3300005618 Bacteria 3159
130 Ga0068864_100295274 3300005618 Unclassified 1516
131 Ga0068864_100438104 3300005618 Bacteria 1248
132 Ga0068864_100936538 3300005618 Bacteria 857
133 Ga0068866_10022853 3300005718 Bacteria 2900
134 Ga0068866_10211648 3300005718 Bacteria 1164
135 Ga0068861_100005751 3300005719 Bacteria 8412
136 Ga0068861_100111406 3300005719 Bacteria 2193
137 Ga0068861_100239746 3300005719 Unclassified 1542
138 Ga0068861_100750230 3300005719 Bacteria 912
139 Ga0068851_10069805 3300005834 Bacteria 1816
140 Ga0068870_10009295 3300005840 Bacteria 4465
141 Ga0068863_100003550 3300005841 Bacteria 15382
142 Ga0068858_100002928 3300005842 Bacteria 17176
143 Ga0068858_100710683 3300005842 Bacteria 978
144 Ga0068860_100004200 3300005843 Bacteria 14762
145 Ga0068860_100415839 3300005843 Bacteria 1332
146 Ga0068860_100699801 3300005843 Bacteria 1023
147 Ga0068862_100016622 3300005844 Bacteria 6126
148 Ga0068862_100137800 3300005844 Bacteria 2164
149 Ga0081539_10000534 3300005985 Bacteria 78990
150 Ga0070716_100365301 3300006173 Bacteria 1026
151 Ga0075366_10004372 3300006195 Bacteria 7580
152 Ga0075366_10205199 3300006195 Bacteria 1199
153 Ga0075366_10319450 3300006195 Bacteria 951
154 Ga0097621_100050152 3300006237 Unclassified 3393
155 Ga0097621_100053270 3300006237 Bacteria 3298
156 Ga0097621_100768281 3300006237 Bacteria 891
157 Ga0068871_100034178 3300006358 Bacteria 4032
158 Ga0068871_100235221 3300006358 Bacteria 1591
159 Ga0068871_100291446 3300006358 Bacteria 1430
160 Ga0075429_100181744 3300006880 Bacteria 1843
161 Ga0068865_100007946 3300006881 Bacteria 6550
162 Ga0068865_100026788 3300006881 Bacteria 3803
163 Ga0097620_100000003 3300006931 Bacteria 479218
164 Ga0097620_100004846 3300006931 Bacteria 13695
165 Ga0097620_100090518 3300006931 Bacteria 3110
166 Ga0111539_10002241 3300009094 Bacteria 25812
167 Ga0105245_10052557 3300009098 Unclassified 3654
168 Ga0105245_11136244 3300009098 Unclassified 828
169 Ga0114129_10001630 3300009147 Bacteria 30480
170 Ga0105241_10002666 3300009174 Bacteria 13368
171 Ga0105241_10165420 3300009174 Unclassified 1822
172 Ga0105241_10528225 3300009174 Bacteria 1056
173 Ga0105241_10570020 3300009174 Unclassified 1019
174 Ga0105242_10059536 3300009176 Bacteria 3134
175 Ga0105242_10223040 3300009176 Bacteria 1686
176 Ga0105237_10001055 3300009545 Bacteria 37018
177 Ga0105249_10022049 3300009553 Bacteria 5704
178 Ga0105249_10028477 3300009553 Bacteria 5042
179 Ga0105239_10010713 3300010375 Bacteria 10241
180 Ga0105239_10021156 3300010375 Bacteria 7174
181 Ga0105239_10437487 3300010375 Bacteria 1483
182 Ga0105246_10008490 3300011119 Bacteria 6316
183 Ga0105246_10014719 3300011119 Bacteria 4925
184 Ga0105246_10031070 3300011119 Bacteria 3532
185 Ga0157373_10003011 3300013100 Bacteria 12739
186 Ga0157371_10020010 3300013102 Bacteria 4928
187 Ga0157371_10233830 3300013102 Bacteria 1321
188 Ga0157370_10027313 3300013104 Bacteria 5628
189 Ga0157370_10177001 3300013104 Bacteria 1982
190 Ga0157369_10027453 3300013105 Bacteria 6311
191 Ga0157369_10191464 3300013105 Bacteria 2149
192 Ga0157374_10047672 3300013296 Bacteria 3974
193 Ga0157374_10125111 3300013296 Bacteria 2485
194 Ga0157374_10136688 3300013296 Unclassified 2377
195 Ga0157374_10423591 3300013296 Bacteria 1330
196 Ga0157374_10482674 3300013296 Bacteria 1243
197 Ga0157378_10009905 3300013297 Bacteria 8308
198 Ga0157378_10024818 3300013297 Bacteria 5279
199 Ga0157378_10037259 3300013297 Bacteria 4306
200 Ga0163162_10004389 3300013306 Bacteria 13572
201 Ga0163162_10075592 3300013306 Bacteria 3429
202 Ga0163162_10140403 3300013306 Bacteria 2529
203 Ga0163162_10160749 3300013306 Bacteria 2368
204 Ga0163162_10608583 3300013306 Bacteria 1218
205 Ga0157372_10025595 3300013307 Bacteria 6419
206 Ga0157372_10115338 3300013307 Bacteria 3080
207 Ga0157372_10198244 3300013307 Bacteria 2325
208 Ga0157375_10011400 3300013308 Bacteria 7847
209 Ga0157375_10070183 3300013308 Bacteria 3513
210 Ga0157375_10515628 3300013308 Bacteria 1359
211 Ga0157375_10821630 3300013308 Bacteria 1077
212 Ga0163163_10288116 3300014325 Bacteria 1694
213 Ga0163163_10412084 3300014325 Unclassified 1410
214 Ga0157380_10003158 3300014326 Bacteria 11251
215 Ga0157380_10004013 3300014326 Bacteria 10163
216 Ga0157377_10002055 3300014745 Bacteria 8826
217 Ga0157377_10014770 3300014745 Bacteria 3980
218 Ga0157377_10086706 3300014745 Bacteria 1841
219 Ga0157379_10114811 3300014968 Unclassified 2420
220 Ga0157379_10855506 3300014968 Bacteria 861
221 Ga0157376_10423532 3300014969 Bacteria 1293
222 Ga0157376_10737255 3300014969 Bacteria 993
223 Ga0163161_10078593 3300017792 Bacteria 2425
224 Ga0163161_10579385 3300017792 Unclassified 923
225 Ga0163161_10619256 3300017792 Bacteria 894
226 Ga0213876_10005890 3300021384 Bacteria 6702
227 Ga0213876_10022204 3300021384 Bacteria 3356
228 Ga0209646_1000009 3300025246 Bacteria 652154
229 Ga0209026_1000209 3300025250 Bacteria 81291
230 Ga0209673_1000016 3300025273 Bacteria 506202
231 Ga0209673_1049566 3300025273 Unclassified 1122
232 Ga0209564_1005601 3300025295 Bacteria 7076
233 Ga0209564_1022792 3300025295 Bacteria 2198
234 Ga0209564_1036395 3300025295 Bacteria 1405
235 Ga0209758_1006726 3300025297 Bacteria 8099
236 Ga0209758_1007907 3300025297 Bacteria 7061
237 Ga0209758_1030840 3300025297 Bacteria 2211
238 Ga0209050_1000608 3300025298 Bacteria 56778
239 Ga0207426_1000658 3300025302 Bacteria 42320
240 Ga0207426_1000834 3300025302 Bacteria 32701
241 Ga0207426_1039666 3300025302 Bacteria 1473
242 Ga0209051_1025501 3300025303 Bacteria 2404
243 Ga0209257_1000071 3300025304 Bacteria 335832
244 Ga0209257_1000831 3300025304 Bacteria 44552
245 Ga0207697_10064175 3300025315 Unclassified 1531
246 Ga0207697_10226096 3300025315 Bacteria 826
247 Ga0207682_10226370 3300025893 Unclassified 866
248 Ga0207642_10042205 3300025899 Bacteria 2003
249 Ga0207688_10065865 3300025901 Unclassified 2048
250 Ga0207680_10000388 3300025903 Bacteria 21000
251 Ga0207680_10066259 3300025903 Bacteria 2220
252 Ga0207680_10229614 3300025903 Unclassified 1275
253 Ga0207647_10041306 3300025904 Bacteria 2901
254 Ga0207647_10048630 3300025904 Bacteria 2633
255 Ga0207647_10154446 3300025904 Bacteria 1340
256 Ga0207645_10001118 3300025907 Bacteria 22193
257 Ga0207645_10050151 3300025907 Bacteria 2665
258 Ga0207645_10140222 3300025907 Unclassified 1575
259 Ga0207645_10236836 3300025907 Bacteria 1206
260 Ga0207643_10017131 3300025908 Bacteria 3957
261 Ga0207654_10001481 3300025911 Bacteria 12399
262 Ga0207654_10144828 3300025911 Unclassified 1519
263 Ga0207707_10397642 3300025912 Bacteria 1183
264 Ga0207671_10001848 3300025914 Bacteria 23634
265 Ga0207671_10031686 3300025914 Bacteria 3939
266 Ga0207662_10005415 3300025918 Bacteria 6804
267 Ga0207662_10091806 3300025918 Bacteria 1868
268 Ga0207652_10092172 3300025921 Bacteria 2665
269 Ga0207681_10002654 3300025923 Bacteria 11336
270 Ga0207681_10257745 3300025923 Unclassified 1364
271 Ga0207650_10044610 3300025925 Bacteria 3259
272 Ga0207650_10161326 3300025925 Bacteria 1776
273 Ga0207659_10099600 3300025926 Bacteria 2189
274 Ga0207659_10148949 3300025926 Bacteria 1825
275 Ga0207644_10207232 3300025931 Bacteria 1549
276 Ga0207644_10298433 3300025931 Bacteria 1298
277 Ga0207690_10164236 3300025932 Bacteria 1658
278 Ga0207690_10619704 3300025932 Bacteria 884
279 Ga0207706_10003276 3300025933 Bacteria 15486
280 Ga0207706_10026010 3300025933 Bacteria 5241
281 Ga0207686_10028592 3300025934 Unclassified 3279
282 Ga0207670_10009853 3300025936 Bacteria 5471
283 Ga0207669_10098196 3300025937 Bacteria 1928
284 Ga0207669_10098820 3300025937 Bacteria 1923
285 Ga0207704_10048200 3300025938 Bacteria 2553
286 Ga0207665_10170487 3300025939 Unclassified 1571
287 Ga0207691_10029880 3300025940 Bacteria 5097
288 Ga0207689_10001731 3300025942 Bacteria 20624
289 Ga0207689_10002903 3300025942 Bacteria 15819
290 Ga0207689_10132645 3300025942 Bacteria 2050
291 Ga0207661_10061020 3300025944 Bacteria 3045
292 Ga0207661_10167183 3300025944 Bacteria 1912
293 Ga0207679_10220338 3300025945 Unclassified 1596
294 Ga0207651_10036799 3300025960 Bacteria 3200
295 Ga0207651_10110418 3300025960 Unclassified 2063
296 Ga0207651_10128377 3300025960 Unclassified 1936
297 Ga0207651_10346594 3300025960 Bacteria 1249
298 Ga0207712_10014560 3300025961 Bacteria 5064
299 Ga0207668_10105362 3300025972 Bacteria 2104
300 Ga0207658_10036299 3300025986 Bacteria 3533
301 Ga0207658_10255034 3300025986 Bacteria 1492
302 Ga0207677_10029575 3300026023 Bacteria 3484
303 Ga0207677_10042459 3300026023 Bacteria 3015
304 Ga0207677_10110919 3300026023 Bacteria 2043
305 Ga0207677_10770882 3300026023 Bacteria 859
306 Ga0207703_10006525 3300026035 Bacteria 9307
307 Ga0207639_10130848 3300026041 Bacteria 2077
308 Ga0207639_10158314 3300026041 Bacteria 1905
309 Ga0207678_11082635 3300026067 Bacteria 710
310 Ga0207708_10048621 3300026075 Bacteria 3229
311 Ga0207708_10114288 3300026075 Bacteria 2098
312 Ga0207708_10275637 3300026075 Bacteria 1362
313 Ga0207641_10000026 3300026088 Bacteria 245091
314 Ga0207648_10003325 3300026089 Bacteria 16891
315 Ga0207648_10015205 3300026089 Bacteria 7082
316 Ga0207648_10160407 3300026089 Bacteria 1986
317 Ga0207648_10160732 3300026089 Bacteria 1984
318 Ga0207676_10003977 3300026095 Bacteria 10429
319 Ga0207676_10237502 3300026095 Bacteria 1633
320 Ga0207674_10022101 3300026116 Bacteria 6837
321 Ga0207674_10169057 3300026116 Bacteria 2140
322 Ga0207675_100000144 3300026118 Bacteria 61517
323 Ga0207675_100020719 3300026118 Bacteria 6130
324 Ga0207675_100022457 3300026118 Bacteria 5876
325 Ga0207675_100050055 3300026118 Bacteria 3899
326 Ga0207675_100116280 3300026118 Bacteria 2528
327 Ga0207683_10004506 3300026121 Bacteria 12018
328 Ga0207683_10450839 3300026121 Bacteria 1186
329 Ga0207698_10001999 3300026142 Bacteria 12012
330 Ga0207698_10096879 3300026142 Bacteria 2432
331 Ga0207698_10164294 3300026142 Unclassified 1946
332 Ga0207698_10198156 3300026142 Bacteria 1796
333 Ga0207428_10193369 3300027907 Bacteria 1533
334 Ga0268265_10006981 3300028380 Bacteria 7639
335 Ga0268265_10244669 3300028380 Bacteria 1585
336 Ga0268264_10001142 3300028381 Bacteria 25957
337 Ga0268264_10177634 3300028381 Bacteria 1931
338 Ga0307515_10000031 3300028794 Bacteria 358648
339 Ga0265327_10000288 3300031251 Bacteria 99230
340 Ga0265327_10013816 3300031251 Bacteria 5333
341 Ga0307509_10117107 3300031507 Bacteria 2652
342 Ga0307509_10128572 3300031507 Bacteria 2494
343 Ga0307509_10145898 3300031507 Bacteria 2293
344 Ga0307508_10000990 3300031616 Bacteria 33005
345 Ga0307410_10251265 3300031852 Unclassified 1375
346 Ga0307410_10485911 3300031852 Bacteria 1014
347 Ga0307414_10375797 3300032004 Bacteria 1227
348 Ga0395905_0011690 3300037471 Bacteria 8475
349 Ga0395905_0128061 3300037471 Unclassified 2388
350 Ga0400483_075486 3300039062 Bacteria 32456
351 Ga0400483_218182 3300039062 Bacteria 28649
352 Ga0436365_0021822 3300039437 Bacteria 10004
353 Ga0436365_1684945 3300039437 Bacteria 47686
354 Ga0439439_0005085 3300041406 Bacteria 2991
355 Ga0451795_1010182 3300041456 Unclassified 769
356 Ga0451849_0930889 3300041505 Bacteria 1269
357 Ga0451853_3891532 3300041512 Bacteria 3816
358 Ga0439433_0023797 3300041999 Bacteria 1379
359 Ga0439449_0019777 3300042007 Bacteria 2524
360 Ga0439449_0062122 3300042007 Bacteria 1378
361 Ga0439457_000442 3300042014 Bacteria 11954
362 Ga0466972_0000009 3300044658 Bacteria 256374
363 Ga0453683_0373403 3300044673 Unclassified 917
364 Ga0453684_0103768 3300044712 Bacteria 3473
365 Ga0453684_0732375 3300044712 Bacteria 1072
366 Ga0466957_0043024 3300044842 Bacteria 2733
367 Ga0466957_0103958 3300044842 Bacteria 1794
368 Ga0495650_0033874 3300046471 Bacteria 2267
369 Ga0495668_0004630 3300046616 Bacteria 9663
370 Ga0495625_0110805 3300046660 Bacteria 1876
371 Ga0495670_0305542 3300046691 Unclassified 853
372 Ga0496126_0063750 3300048929 Bacteria 3303
373 Ga0501290_010117 3300049513 Bacteria 1203
374 Ga0501293_003295 3300049516 Bacteria 1245
375 Ga0501296_020192 3300049519 Bacteria 848
376 Ga0501298_001309 3300049521 Bacteria 3645
377 Ga0501031_0005967 3300049568 Bacteria 7947
378 Ga0501031_0455809 3300049568 Bacteria 826
379 Ga0501032_0002685 3300049569 Bacteria 13871
380 Ga0501032_0023207 3300049569 Bacteria 4293
381 Ga0501033_0192463 3300049570 Bacteria 1459
382 Ga0501034_0017359 3300049571 Bacteria 7381
383 Ga0501034_0023796 3300049571 Bacteria 6237
384 Ga0501034_0191790 3300049571 Bacteria 2005
385 Ga0501034_0672501 3300049571 Bacteria 935
386 Ga0501034_0796438 3300049571 Bacteria 838
387 Ga0501034_0914870 3300049571 Unclassified 764
388 Ga0501036_0001672 3300049572 Bacteria 17196
389 Ga0501036_0163644 3300049572 Bacteria 1875
390 Ga0501037_0003447 3300049573 Bacteria 11491
391 Ga0501037_0006925 3300049573 Bacteria 8279
392 Ga0501037_0111920 3300049573 Bacteria 1966
393 Ga0501038_0024880 3300049574 Bacteria 5336
394 Ga0501038_0087090 3300049574 Bacteria 2623
395 Ga0501039_0032809 3300049575 Bacteria 4005
396 Ga0501039_0170243 3300049575 Bacteria 1712
397 Ga0501043_0029665 3300049579 Bacteria 4298
398 Ga0501043_0031114 3300049579 Bacteria 4196
399 Ga0501043_0428298 3300049579 Bacteria 997
400 Ga0501046_0068687 3300049580 Bacteria 2757
401 Ga0501046_0121678 3300049580 Bacteria 1985
402 Ga0501047_0081917 3300049581 Bacteria 3102
403 Ga0501047_0083548 3300049581 Bacteria 3069
404 Ga0501047_0116074 3300049581 Bacteria 2559
405 Ga0501047_0125453 3300049581 Bacteria 2447
406 Ga0501047_0136438 3300049581 Bacteria 2334
407 Ga0501047_0352782 3300049581 Unclassified 1307
408 Ga0501048_0275425 3300049582 Bacteria 1196
409 Ga0501067_0064715 3300049583 Bacteria 2024
410 Ga0501070_0080335 3300049586 Bacteria 2698
411 Ga0501073_0008525 3300049589 Bacteria 7599
412 Ga0501074_0004127 3300049590 Bacteria 10369
413 Ga0501077_0038341 3300049593 Bacteria 3051
414 Ga0501198_002369 3300049649 Bacteria 2535
415 Ga0501202_035887 3300049652 Bacteria 1053
416 Ga0501207_002992 3300049654 Bacteria 2214
417 Ga0501217_000418 3300049661 Bacteria 6898
418 Ga0501224_005074 3300049664 Bacteria 1878
419 Ga0501228_023088 3300049666 Unclassified 717
420 Ga0501235_010541 3300049669 Bacteria 2019
421 Ga0501242_005501 3300049674 Bacteria 1428
422 Ga0501261_002689 3300049690 Bacteria 2184
423 Ga0501219_000135 3300049703 Bacteria 13063
424 Ga0501225_0012133 3300049705 Bacteria 2420
425 Ga0501225_0046986 3300049705 Bacteria 1197
426 Ga0501234_012202 3300049707 Bacteria 1345
427 Ga0501079_0268374 3300049741 Bacteria 1334
428 Ga0501080_0077577 3300049742 Bacteria 3090
429 Ga0501080_0181919 3300049742 Bacteria 1934
430 Ga0501080_0242268 3300049742 Bacteria 1646
431 Ga0501083_0004011 3300049744 Bacteria 10346
432 Ga0501083_0163227 3300049744 Bacteria 1457
433 Ga0501035_0006854 3300049822 Bacteria 10640
434 Ga0501044_0001914 3300049823 Bacteria 24093
435 Ga0501044_0051244 3300049823 Bacteria 4256
436 Ga0501044_0063531 3300049823 Bacteria 3771
437 Ga0501044_0067787 3300049823 Bacteria 3635
438 Ga0501044_0127817 3300049823 Bacteria 2538
439 Ga0501044_0598156 3300049823 Bacteria 996
440 Ga0501044_0639589 3300049823 Bacteria 953
441 Ga0501284_00001 3300050005 Bacteria 261916
442 nmdc:mga0k408_11749_c1 3300050493 Bacteria 4776
443 nmdc:mga0k408_22621_c1 3300050493 Bacteria 3540
444 nmdc:mga0k408_3446_c2 3300050493 Bacteria 6350
445 nmdc:mga05p37_1394_c1 3300050507 Bacteria 28114
446 nmdc:mga09592_281809_c1 3300050508 Bacteria 1441
447 nmdc:mga08y16_18928_c1 3300050511 Bacteria 7251
448 Ga0500578_0000920 3300053086 Bacteria 33032
449 Ga0500578_0210032 3300053086 Bacteria 1188
450 Ga0500583_0000019 3300053092 Bacteria 130534
451 Ga0500562_000012 3300053108 Bacteria 168210
452 Ga0500594_0029824 3300053118 Unclassified 1429
453 Ga0500642_0235116 3300053130 Bacteria 845
454 Ga0500652_029680 3300053131 Unclassified 2134
455 Ga0500568_0047655 3300053139 Unclassified 1697
456 Ga0500588_0006763 3300053146 Unclassified 2616
457 Ga0500603_060827 3300053150 Bacteria 1056
458 Ga0500604_0000475 3300053151 Bacteria 11057
459 Ga0500616_0002857 3300053153 Bacteria 13857
460 Ga0500616_0033389 3300053153 Bacteria 2809
461 Ga0500622_0000404 3300053156 Bacteria 41279
462 Ga0500636_0131328 3300053177 Bacteria 1395
463 Ga0500584_174203 3300053726 Unclassified 764
464 Ga0500645_006175 3300053730 Bacteria 4304
465 Ga0500645_019546 3300053730 Bacteria 2106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049666 Ga0501228_023088 Ga0501228_023088_116_679 182
2 3300049654 Ga0501207_002992 Ga0501207_002992_11_607 186
3 3300026067 Ga0207678_11082635 Ga0207678_110826351 188
4 3300049581 Ga0501047_0352782 Ga0501047_0352782_149_721 189
5 3300049823 Ga0501044_0598156 Ga0501044_0598156_17_589 189
6 3300003215 JGI25153J46596_10027577 JGI25153J46596_100275773 193
7 3300021384 Ga0213876_10005890 Ga0213876_100058906 197
8 3300049741 Ga0501079_0268374 Ga0501079_0268374_45_659 197
9 3300013105 Ga0157369_10191464 Ga0157369_101914642 203
10 3300005289 Ga0065704_10181233 Ga0065704_101812331 209
11 3300044842 Ga0466957_0103958 Ga0466957_0103958_283_921 210
12 3300049581 Ga0501047_0136438 Ga0501047_0136438_752_1402 210
13 3300049823 Ga0501044_0127817 Ga0501044_0127817_1082_1732 210
14 3300003320 rootH2_10168463 rootH2_101684632 211
15 3300025901 Ga0207688_10065865 Ga0207688_100658652 211
16 3300025907 Ga0207645_10140222 Ga0207645_101402221 211
17 3300025918 Ga0207662_10005415 Ga0207662_100054152 211
18 3300025937 Ga0207669_10098196 Ga0207669_100981962 211
19 3300026075 Ga0207708_10048621 Ga0207708_100486212 211
20 3300005366 Ga0070659_100188757 Ga0070659_1001887572 212
21 3300044712 Ga0453684_0732375 Ga0453684_0732375_290_955 212
22 iso_pu_bacteria 2910245624 2910250226 212
23 3300005843 Ga0068860_100699801 Ga0068860_1006998012 213
24 3300028381 Ga0268264_10177634 Ga0268264_101776343 213
25 iso_pu_bacteria 2738541278 2738725080 213
26 iso_pu_bacteria 2929154850 2929158917 213
27 iso_pu_bacteria 8036736890 8036738018 213
28 3300003322 rootL2_10168080 rootL2_101680801 214
29 3300039062 Ga0400483_075486 Ga0400483_075486_10184_10852 214
30 3300039062 Ga0400483_218182 Ga0400483_218182_24832_25500 214
31 3300041456 Ga0451795_1010182 Ga0451795_1010182_40_711 214
32 3300046616 Ga0495668_0004630 Ga0495668_0004630_8817_9497 214
33 3300053092 Ga0500583_0000019 Ga0500583_0000019_13516_14190 214
34 3300053151 Ga0500604_0000475 Ga0500604_0000475_6160_6825 214
35 3300053153 Ga0500616_0002857 Ga0500616_0002857_719_1411 214
36 3300001989 JGI24739J22299_10124070 JGI24739J22299_101240701 215
37 3300003203 JGI25406J46586_10002742 JGI25406J46586_1000274211 215
38 3300003316 rootH1_10179425 rootH1_101794251 215
39 3300003794 Ga0055531_10000284 Ga0055531_1000028428 215
40 3300005329 Ga0070683_100188632 Ga0070683_1001886322 215
41 3300005330 Ga0070690_100149390 Ga0070690_1001493901 215
42 3300005335 Ga0070666_10422133 Ga0070666_104221332 215
43 3300005336 Ga0070680_100052387 Ga0070680_1000523872 215
44 3300005337 Ga0070682_100037602 Ga0070682_1000376022 215
45 3300005338 Ga0068868_100038803 Ga0068868_1000388032 215
46 3300005344 Ga0070661_100010672 Ga0070661_1000106726 215
47 3300005353 Ga0070669_100291224 Ga0070669_1002912241 215
48 3300005354 Ga0070675_100046216 Ga0070675_1000462161 215
49 3300005354 Ga0070675_100252942 Ga0070675_1002529422 215
50 3300005355 Ga0070671_100094207 Ga0070671_1000942072 215
51 3300005364 Ga0070673_100082188 Ga0070673_1000821884 215
52 3300005366 Ga0070659_100032283 Ga0070659_1000322834 215
53 3300005367 Ga0070667_100441170 Ga0070667_1004411702 215
54 3300005458 Ga0070681_10308842 Ga0070681_103088423 215
55 3300005459 Ga0068867_100193392 Ga0068867_1001933922 215
56 3300005530 Ga0070679_100166221 Ga0070679_1001662212 215
57 3300005539 Ga0068853_100115586 Ga0068853_1001155862 215
58 3300005563 Ga0068855_100081596 Ga0068855_1000815965 215
59 3300005564 Ga0070664_100449055 Ga0070664_1004490551 215
60 3300005614 Ga0068856_100089448 Ga0068856_1000894482 215
61 3300005616 Ga0068852_100109367 Ga0068852_1001093673 215
62 3300005618 Ga0068864_100438104 Ga0068864_1004381042 215
63 3300005618 Ga0068864_100936538 Ga0068864_1009365381 215
64 3300005719 Ga0068861_100239746 Ga0068861_1002397461 215
65 3300005719 Ga0068861_100750230 Ga0068861_1007502301 215
66 3300005834 Ga0068851_10069805 Ga0068851_100698052 215
67 3300005985 Ga0081539_10000534 Ga0081539_1000053438 215
68 3300006237 Ga0097621_100053270 Ga0097621_1000532703 215
69 3300006358 Ga0068871_100034178 Ga0068871_1000341786 215
70 3300013100 Ga0157373_10003011 Ga0157373_1000301111 215
71 3300013102 Ga0157371_10020010 Ga0157371_100200101 215
72 3300013102 Ga0157371_10233830 Ga0157371_102338301 215
73 3300013104 Ga0157370_10027313 Ga0157370_100273136 215
74 3300013105 Ga0157369_10027453 Ga0157369_100274536 215
75 3300013296 Ga0157374_10125111 Ga0157374_101251112 215
76 3300013297 Ga0157378_10037259 Ga0157378_100372591 215
77 3300013306 Ga0163162_10160749 Ga0163162_101607492 215
78 3300013307 Ga0157372_10115338 Ga0157372_101153382 215
79 3300013308 Ga0157375_10821630 Ga0157375_108216302 215
80 3300014745 Ga0157377_10086706 Ga0157377_100867062 215
81 3300014969 Ga0157376_10423532 Ga0157376_104235321 215
82 3300017792 Ga0163161_10078593 Ga0163161_100785934 215
83 3300025304 Ga0209257_1000071 Ga0209257_100007163 215
84 3300025315 Ga0207697_10226096 Ga0207697_102260962 215
85 3300025904 Ga0207647_10154446 Ga0207647_101544462 215
86 3300025912 Ga0207707_10397642 Ga0207707_103976421 215
87 3300025921 Ga0207652_10092172 Ga0207652_100921722 215
88 3300025926 Ga0207659_10148949 Ga0207659_101489494 215
89 3300025931 Ga0207644_10207232 Ga0207644_102072322 215
90 3300025932 Ga0207690_10619704 Ga0207690_106197042 215
91 3300025933 Ga0207706_10003276 Ga0207706_100032763 215
92 3300026023 Ga0207677_10029575 Ga0207677_100295752 215
93 3300026041 Ga0207639_10158314 Ga0207639_101583142 215
94 3300026089 Ga0207648_10160407 Ga0207648_101604073 215
95 3300026116 Ga0207674_10169057 Ga0207674_101690573 215
96 3300026118 Ga0207675_100116280 Ga0207675_1001162803 215
97 3300026142 Ga0207698_10096879 Ga0207698_100968793 215
98 3300026142 Ga0207698_10198156 Ga0207698_101981563 215
99 3300037471 Ga0395905_0128061 Ga0395905_0128061_1583_2272 215
100 3300039437 Ga0436365_1684945 Ga0436365_1684945_3369_4028 215
101 3300048929 Ga0496126_0063750 Ga0496126_0063750_1779_2450 215
102 3300003316 rootH1_10060194 rootH1_100601942 216
103 3300003322 rootL2_10014974 rootL2_1001497415 216
104 3300003322 rootL2_10086591 rootL2_100865913 216
105 3300003322 rootL2_10253065 rootL2_102530652 216
106 3300003323 rootH1_10044480 rootH1_100444802 216
107 3300005329 Ga0070683_100045346 Ga0070683_1000453462 216
108 3300005331 Ga0070670_100047379 Ga0070670_1000473792 216
109 3300005338 Ga0068868_100249040 Ga0068868_1002490402 216
110 3300005344 Ga0070661_100191444 Ga0070661_1001914441 216
111 3300005535 Ga0070684_100004375 Ga0070684_1000043756 216
112 3300005539 Ga0068853_100671786 Ga0068853_1006717861 216
113 3300005564 Ga0070664_100002301 Ga0070664_1000023016 216
114 3300005616 Ga0068852_100195423 Ga0068852_1001954232 216
115 3300005616 Ga0068852_100673015 Ga0068852_1006730152 216
116 3300006173 Ga0070716_100365301 Ga0070716_1003653012 216
117 3300006195 Ga0075366_10004372 Ga0075366_100043725 216
118 3300006195 Ga0075366_10319450 Ga0075366_103194501 216
119 3300006358 Ga0068871_100291446 Ga0068871_1002914462 216
120 3300013104 Ga0157370_10177001 Ga0157370_101770012 216
121 3300013296 Ga0157374_10423591 Ga0157374_104235911 216
122 3300013296 Ga0157374_10482674 Ga0157374_104826741 216
123 3300013307 Ga0157372_10025595 Ga0157372_100255957 216
124 3300013307 Ga0157372_10198244 Ga0157372_101982443 216
125 3300014745 Ga0157377_10014770 Ga0157377_100147702 216
126 3300025925 Ga0207650_10044610 Ga0207650_100446104 216
127 3300025931 Ga0207644_10298433 Ga0207644_102984332 216
128 3300025932 Ga0207690_10164236 Ga0207690_101642362 216
129 3300025939 Ga0207665_10170487 Ga0207665_101704873 216
130 3300025944 Ga0207661_10167183 Ga0207661_101671832 216
131 3300025960 Ga0207651_10036799 Ga0207651_100367994 216
132 3300026023 Ga0207677_10110919 Ga0207677_101109192 216
133 3300026041 Ga0207639_10130848 Ga0207639_101308481 216
134 3300026118 Ga0207675_100022457 Ga0207675_1000224572 216
135 3300031251 Ga0265327_10000288 Ga0265327_1000028836 216
136 3300031852 Ga0307410_10485911 Ga0307410_104859111 216
137 3300041512 Ga0451853_3891532 Ga0451853_3891532_3100_3774 216
138 3300049513 Ga0501290_010117 Ga0501290_010117_352_1038 216
139 3300049516 Ga0501293_003295 Ga0501293_003295_64_750 216
140 3300049519 Ga0501296_020192 Ga0501296_020192_132_818 216
141 3300049521 Ga0501298_001309 Ga0501298_001309_2893_3579 216
142 3300049568 Ga0501031_0455809 Ga0501031_0455809_47_718 216
143 3300049569 Ga0501032_0002685 Ga0501032_0002685_12584_13255 216
144 3300049571 Ga0501034_0023796 Ga0501034_0023796_2284_2955 216
145 3300049572 Ga0501036_0001672 Ga0501036_0001672_3129_3800 216
146 3300049573 Ga0501037_0003447 Ga0501037_0003447_520_1191 216
147 3300049574 Ga0501038_0087090 Ga0501038_0087090_384_1055 216
148 3300049575 Ga0501039_0032809 Ga0501039_0032809_334_1005 216
149 3300049579 Ga0501043_0031114 Ga0501043_0031114_3134_3805 216
150 3300049580 Ga0501046_0068687 Ga0501046_0068687_1695_2366 216
151 3300049581 Ga0501047_0125453 Ga0501047_0125453_825_1496 216
152 3300049582 Ga0501048_0275425 Ga0501048_0275425_197_868 216
153 3300049583 Ga0501067_0064715 Ga0501067_0064715_708_1379 216
154 3300049586 Ga0501070_0080335 Ga0501070_0080335_536_1207 216
155 3300049589 Ga0501073_0008525 Ga0501073_0008525_6342_7013 216
156 3300049590 Ga0501074_0004127 Ga0501074_0004127_3155_3826 216
157 3300049593 Ga0501077_0038341 Ga0501077_0038341_1986_2657 216
158 3300049649 Ga0501198_002369 Ga0501198_002369_195_881 216
159 3300049652 Ga0501202_035887 Ga0501202_035887_166_852 216
160 3300049661 Ga0501217_000418 Ga0501217_000418_5926_6612 216
161 3300049664 Ga0501224_005074 Ga0501224_005074_139_825 216
162 3300049669 Ga0501235_010541 Ga0501235_010541_127_813 216
163 3300049674 Ga0501242_005501 Ga0501242_005501_627_1313 216
164 3300049690 Ga0501261_002689 Ga0501261_002689_1383_2069 216
165 3300049705 Ga0501225_0012133 Ga0501225_0012133_859_1545 216
166 3300049707 Ga0501234_012202 Ga0501234_012202_176_862 216
167 3300049744 Ga0501083_0004011 Ga0501083_0004011_8864_9535 216
168 3300049744 Ga0501083_0163227 Ga0501083_0163227_63_746 216
169 3300049822 Ga0501035_0006854 Ga0501035_0006854_8393_9064 216
170 3300049823 Ga0501044_0063531 Ga0501044_0063531_2712_3383 216
171 3300050493 nmdc:mga0k408_22621_c1 nmdc:mga0k408_22621_c1_2469_3143 216
172 3300050493 nmdc:mga0k408_3446_c2 nmdc:mga0k408_3446_c2_4196_4921 216
173 3300053153 Ga0500616_0033389 Ga0500616_0033389_525_1211 216
174 3300053730 Ga0500645_019546 Ga0500645_019546_712_1383 216
175 iso_pu_bacteria 2911138879 2911139859 216
176 3300002077 JGI24744J21845_10022158 JGI24744J21845_100221581 217
177 3300003320 rootH2_10314643 rootH2_103146431 217
178 3300003322 rootL2_10020852 rootL2_100208521 217
179 3300003322 rootL2_10113318 rootL2_101133182 217
180 3300003323 rootH1_10020501 rootH1_100205014 217
181 3300005288 Ga0065714_10094168 Ga0065714_100941682 217
182 3300005290 Ga0065712_10075441 Ga0065712_100754412 217
183 3300005329 Ga0070683_100009092 Ga0070683_1000090928 217
184 3300005329 Ga0070683_100565705 Ga0070683_1005657052 217
185 3300005330 Ga0070690_100185000 Ga0070690_1001850002 217
186 3300005331 Ga0070670_100171677 Ga0070670_1001716773 217
187 3300005333 Ga0070677_10055701 Ga0070677_100557012 217
188 3300005334 Ga0068869_100005758 Ga0068869_1000057583 217
189 3300005334 Ga0068869_100013589 Ga0068869_1000135896 217
190 3300005334 Ga0068869_100048044 Ga0068869_1000480444 217
191 3300005334 Ga0068869_100377233 Ga0068869_1003772331 217
192 3300005335 Ga0070666_10000064 Ga0070666_1000006466 217
193 3300005335 Ga0070666_10035817 Ga0070666_100358174 217
194 3300005338 Ga0068868_100666110 Ga0068868_1006661101 217
195 3300005343 Ga0070687_100275836 Ga0070687_1002758362 217
196 3300005347 Ga0070668_100037275 Ga0070668_1000372753 217
197 3300005353 Ga0070669_100011558 Ga0070669_1000115582 217
198 3300005354 Ga0070675_100002115 Ga0070675_10000211512 217
199 3300005354 Ga0070675_100602361 Ga0070675_1006023611 217
200 3300005355 Ga0070671_100014145 Ga0070671_1000141457 217
201 3300005356 Ga0070674_100016973 Ga0070674_1000169732 217
202 3300005356 Ga0070674_100031799 Ga0070674_1000317993 217
203 3300005356 Ga0070674_100073072 Ga0070674_1000730722 217
204 3300005364 Ga0070673_100001051 Ga0070673_1000010513 217
205 3300005364 Ga0070673_100860164 Ga0070673_1008601641 217
206 3300005367 Ga0070667_100010938 Ga0070667_1000109389 217
207 3300005367 Ga0070667_100060084 Ga0070667_1000600842 217
208 3300005367 Ga0070667_100273153 Ga0070667_1002731532 217
209 3300005436 Ga0070713_100372052 Ga0070713_1003720522 217
210 3300005441 Ga0070700_100043955 Ga0070700_1000439551 217
211 3300005441 Ga0070700_100253065 Ga0070700_1002530652 217
212 3300005456 Ga0070678_100075808 Ga0070678_1000758083 217
213 3300005456 Ga0070678_100382264 Ga0070678_1003822641 217
214 3300005459 Ga0068867_100315401 Ga0068867_1003154012 217
215 3300005466 Ga0070685_10032591 Ga0070685_100325912 217
216 3300005466 Ga0070685_10559713 Ga0070685_105597131 217
217 3300005535 Ga0070684_100041221 Ga0070684_1000412213 217
218 3300005544 Ga0070686_100083930 Ga0070686_1000839302 217
219 3300005548 Ga0070665_100182033 Ga0070665_1001820333 217
220 3300005578 Ga0068854_100092580 Ga0068854_1000925801 217
221 3300005616 Ga0068852_100004036 Ga0068852_1000040364 217
222 3300005616 Ga0068852_100075299 Ga0068852_1000752991 217
223 3300005617 Ga0068859_100000003 Ga0068859_100000003151 217
224 3300005617 Ga0068859_100090517 Ga0068859_1000905172 217
225 3300005618 Ga0068864_100006628 Ga0068864_1000066286 217
226 3300005618 Ga0068864_100065234 Ga0068864_1000652342 217
227 3300005618 Ga0068864_100295274 Ga0068864_1002952742 217
228 3300005718 Ga0068866_10211648 Ga0068866_102116482 217
229 3300005840 Ga0068870_10009295 Ga0068870_100092953 217
230 3300005841 Ga0068863_100003550 Ga0068863_1000035502 217
231 3300005842 Ga0068858_100002928 Ga0068858_10000292811 217
232 3300005842 Ga0068858_100710683 Ga0068858_1007106831 217
233 3300005843 Ga0068860_100004200 Ga0068860_10000420011 217
234 3300005843 Ga0068860_100415839 Ga0068860_1004158392 217
235 3300006237 Ga0097621_100050152 Ga0097621_1000501522 217
236 3300006237 Ga0097621_100768281 Ga0097621_1007682811 217
237 3300006358 Ga0068871_100235221 Ga0068871_1002352212 217
238 3300006881 Ga0068865_100007946 Ga0068865_1000079464 217
239 3300006931 Ga0097620_100000003 Ga0097620_100000003151 217
240 3300006931 Ga0097620_100090518 Ga0097620_1000905182 217
241 3300009098 Ga0105245_10052557 Ga0105245_100525572 217
242 3300009098 Ga0105245_11136244 Ga0105245_111362441 217
243 3300009147 Ga0114129_10001630 Ga0114129_1000163014 217
244 3300009174 Ga0105241_10002666 Ga0105241_1000266610 217
245 3300009174 Ga0105241_10528225 Ga0105241_105282252 217
246 3300009174 Ga0105241_10570020 Ga0105241_105700201 217
247 3300009176 Ga0105242_10223040 Ga0105242_102230402 217
248 3300009553 Ga0105249_10028477 Ga0105249_100284775 217
249 3300010375 Ga0105239_10021156 Ga0105239_100211564 217
250 3300011119 Ga0105246_10008490 Ga0105246_100084904 217
251 3300011119 Ga0105246_10014719 Ga0105246_100147193 217
252 3300011119 Ga0105246_10031070 Ga0105246_100310703 217
253 3300013296 Ga0157374_10047672 Ga0157374_100476722 217
254 3300013296 Ga0157374_10136688 Ga0157374_101366883 217
255 3300013297 Ga0157378_10009905 Ga0157378_100099052 217
256 3300013297 Ga0157378_10024818 Ga0157378_100248184 217
257 3300013306 Ga0163162_10004389 Ga0163162_100043893 217
258 3300013306 Ga0163162_10140403 Ga0163162_101404033 217
259 3300013306 Ga0163162_10608583 Ga0163162_106085832 217
260 3300013308 Ga0157375_10070183 Ga0157375_100701833 217
261 3300013308 Ga0157375_10515628 Ga0157375_105156281 217
262 3300014325 Ga0163163_10288116 Ga0163163_102881162 217
263 3300014325 Ga0163163_10412084 Ga0163163_104120842 217
264 3300014326 Ga0157380_10003158 Ga0157380_100031582 217
265 3300014968 Ga0157379_10114811 Ga0157379_101148111 217
266 3300014968 Ga0157379_10855506 Ga0157379_108555061 217
267 3300014969 Ga0157376_10737255 Ga0157376_107372553 217
268 3300017792 Ga0163161_10579385 Ga0163161_105793851 217
269 3300017792 Ga0163161_10619256 Ga0163161_106192561 217
270 3300021384 Ga0213876_10022204 Ga0213876_100222042 217
271 3300025315 Ga0207697_10064175 Ga0207697_100641752 217
272 3300025893 Ga0207682_10226370 Ga0207682_102263701 217
273 3300025903 Ga0207680_10000388 Ga0207680_1000038814 217
274 3300025903 Ga0207680_10066259 Ga0207680_100662593 217
275 3300025903 Ga0207680_10229614 Ga0207680_102296142 217
276 3300025904 Ga0207647_10048630 Ga0207647_100486302 217
277 3300025907 Ga0207645_10001118 Ga0207645_1000111817 217
278 3300025908 Ga0207643_10017131 Ga0207643_100171313 217
279 3300025911 Ga0207654_10001481 Ga0207654_100014814 217
280 3300025914 Ga0207671_10001848 Ga0207671_1000184812 217
281 3300025923 Ga0207681_10257745 Ga0207681_102577451 217
282 3300025925 Ga0207650_10161326 Ga0207650_101613263 217
283 3300025934 Ga0207686_10028592 Ga0207686_100285922 217
284 3300025937 Ga0207669_10098820 Ga0207669_100988202 217
285 3300025942 Ga0207689_10001731 Ga0207689_1000173112 217
286 3300025942 Ga0207689_10002903 Ga0207689_1000290314 217
287 3300025944 Ga0207661_10061020 Ga0207661_100610202 217
288 3300025945 Ga0207679_10220338 Ga0207679_102203382 217
289 3300025960 Ga0207651_10110418 Ga0207651_101104182 217
290 3300025960 Ga0207651_10128377 Ga0207651_101283772 217
291 3300025961 Ga0207712_10014560 Ga0207712_100145605 217
292 3300025986 Ga0207658_10036299 Ga0207658_100362993 217
293 3300025986 Ga0207658_10255034 Ga0207658_102550342 217
294 3300026023 Ga0207677_10042459 Ga0207677_100424592 217
295 3300026023 Ga0207677_10770882 Ga0207677_107708822 217
296 3300026035 Ga0207703_10006525 Ga0207703_100065258 217
297 3300026075 Ga0207708_10275637 Ga0207708_102756372 217
298 3300026088 Ga0207641_10000026 Ga0207641_10000026135 217
299 3300026089 Ga0207648_10003325 Ga0207648_1000332511 217
300 3300026095 Ga0207676_10003977 Ga0207676_100039778 217
301 3300026095 Ga0207676_10237502 Ga0207676_102375022 217
302 3300026118 Ga0207675_100020719 Ga0207675_1000207194 217
303 3300026121 Ga0207683_10004506 Ga0207683_1000450611 217
304 3300026121 Ga0207683_10450839 Ga0207683_104508392 217
305 3300026142 Ga0207698_10001999 Ga0207698_100019994 217
306 3300026142 Ga0207698_10164294 Ga0207698_101642942 217
307 3300028381 Ga0268264_10001142 Ga0268264_1000114228 217
308 3300028794 Ga0307515_10000031 Ga0307515_1000003125 217
309 3300031251 Ga0265327_10013816 Ga0265327_100138167 217
310 3300031507 Ga0307509_10128572 Ga0307509_101285722 217
311 3300032004 Ga0307414_10375797 Ga0307414_103757972 217
312 3300037471 Ga0395905_0011690 Ga0395905_0011690_7094_7765 217
313 3300039437 Ga0436365_0021822 Ga0436365_0021822_4197_4883 217
314 3300041406 Ga0439439_0005085 Ga0439439_0005085_1061_1741 217
315 3300041999 Ga0439433_0023797 Ga0439433_0023797_74_757 217
316 3300042007 Ga0439449_0019777 Ga0439449_0019777_546_1226 217
317 3300042007 Ga0439449_0062122 Ga0439449_0062122_512_1195 217
318 3300042014 Ga0439457_000442 Ga0439457_000442_9238_9918 217
319 3300044658 Ga0466972_0000009 Ga0466972_0000009_228675_229355 217
320 3300044673 Ga0453683_0373403 Ga0453683_0373403_172_843 217
321 3300044712 Ga0453684_0103768 Ga0453684_0103768_2101_2775 217
322 3300044842 Ga0466957_0043024 Ga0466957_0043024_1821_2603 217
323 3300046471 Ga0495650_0033874 Ga0495650_0033874_18_695 217
324 3300046691 Ga0495670_0305542 Ga0495670_0305542_26_700 217
325 3300049568 Ga0501031_0005967 Ga0501031_0005967_2553_3245 217
326 3300049569 Ga0501032_0023207 Ga0501032_0023207_3083_3775 217
327 3300049570 Ga0501033_0192463 Ga0501033_0192463_360_1034 217
328 3300049571 Ga0501034_0017359 Ga0501034_0017359_4479_5153 217
329 3300049571 Ga0501034_0191790 Ga0501034_0191790_152_826 217
330 3300049571 Ga0501034_0672501 Ga0501034_0672501_153_845 217
331 3300049571 Ga0501034_0796438 Ga0501034_0796438_80_772 217
332 3300049571 Ga0501034_0914870 Ga0501034_0914870_46_720 217
333 3300049572 Ga0501036_0163644 Ga0501036_0163644_75_767 217
334 3300049573 Ga0501037_0006925 Ga0501037_0006925_2804_3496 217
335 3300049573 Ga0501037_0111920 Ga0501037_0111920_1259_1951 217
336 3300049574 Ga0501038_0024880 Ga0501038_0024880_1870_2562 217
337 3300049575 Ga0501039_0170243 Ga0501039_0170243_577_1269 217
338 3300049579 Ga0501043_0029665 Ga0501043_0029665_3414_4106 217
339 3300049579 Ga0501043_0428298 Ga0501043_0428298_16_702 217
340 3300049580 Ga0501046_0121678 Ga0501046_0121678_359_1051 217
341 3300049581 Ga0501047_0081917 Ga0501047_0081917_1833_2519 217
342 3300049581 Ga0501047_0083548 Ga0501047_0083548_2126_2818 217
343 3300049581 Ga0501047_0116074 Ga0501047_0116074_312_1004 217
344 3300049703 Ga0501219_000135 Ga0501219_000135_4693_5370 217
345 3300049705 Ga0501225_0046986 Ga0501225_0046986_155_832 217
346 3300049742 Ga0501080_0077577 Ga0501080_0077577_989_1681 217
347 3300049742 Ga0501080_0181919 Ga0501080_0181919_654_1346 217
348 3300049742 Ga0501080_0242268 Ga0501080_0242268_882_1556 217
349 3300049823 Ga0501044_0001914 Ga0501044_0001914_12225_12917 217
350 3300049823 Ga0501044_0051244 Ga0501044_0051244_2776_3468 217
351 3300049823 Ga0501044_0067787 Ga0501044_0067787_2450_3124 217
352 3300049823 Ga0501044_0639589 Ga0501044_0639589_88_762 217
353 3300050005 Ga0501284_00001 Ga0501284_00001_52070_52747 217
354 3300050507 nmdc:mga05p37_1394_c1 nmdc:mga05p37_1394_c1_13028_13705 217
355 3300053086 Ga0500578_0000920 Ga0500578_0000920_13136_13825 217
356 3300053086 Ga0500578_0210032 Ga0500578_0210032_430_1107 217
357 3300053108 Ga0500562_000012 Ga0500562_000012_56945_57634 217
358 3300053118 Ga0500594_0029824 Ga0500594_0029824_632_1408 217
359 3300053130 Ga0500642_0235116 Ga0500642_0235116_103_780 217
360 3300053150 Ga0500603_060827 Ga0500603_060827_321_998 217
361 3300053156 Ga0500622_0000404 Ga0500622_0000404_21591_22289 217
362 3300053177 Ga0500636_0131328 Ga0500636_0131328_537_1220 217
363 3300053726 Ga0500584_174203 Ga0500584_174203_25_711 217
364 3300053730 Ga0500645_006175 Ga0500645_006175_2377_3066 217
365 iso_pu_bacteria 2818991444 2819586166 217
366 3300001979 JGI24740J21852_10033948 JGI24740J21852_100339483 218
367 3300003320 rootH2_10135145 rootH2_101351452 218
368 3300003322 rootL2_10051034 rootL2_100510344 218
369 3300005290 Ga0065712_10247499 Ga0065712_102474991 218
370 3300005295 Ga0065707_10110999 Ga0065707_101109992 218
371 3300005331 Ga0070670_100024005 Ga0070670_1000240054 218
372 3300005340 Ga0070689_100084778 Ga0070689_1000847784 218
373 3300005343 Ga0070687_100084964 Ga0070687_1000849642 218
374 3300005347 Ga0070668_100100088 Ga0070668_1001000882 218
375 3300005354 Ga0070675_100037225 Ga0070675_1000372255 218
376 3300005364 Ga0070673_100001247 Ga0070673_10000124717 218
377 3300005438 Ga0070701_10004865 Ga0070701_100048651 218
378 3300005441 Ga0070700_100076697 Ga0070700_1000766972 218
379 3300005457 Ga0070662_100083564 Ga0070662_1000835642 218
380 3300005578 Ga0068854_100214856 Ga0068854_1002148562 218
381 3300005617 Ga0068859_100004846 Ga0068859_1000048466 218
382 3300005719 Ga0068861_100005751 Ga0068861_1000057516 218
383 3300005844 Ga0068862_100016622 Ga0068862_1000166225 218
384 3300006880 Ga0075429_100181744 Ga0075429_1001817443 218
385 3300006931 Ga0097620_100004846 Ga0097620_1000048466 218
386 3300009094 Ga0111539_10002241 Ga0111539_1000224113 218
387 3300009174 Ga0105241_10165420 Ga0105241_101654202 218
388 3300009545 Ga0105237_10001055 Ga0105237_1000105532 218
389 3300009553 Ga0105249_10022049 Ga0105249_100220492 218
390 3300010375 Ga0105239_10010713 Ga0105239_100107135 218
391 3300013306 Ga0163162_10075592 Ga0163162_100755922 218
392 3300013308 Ga0157375_10011400 Ga0157375_100114002 218
393 3300014326 Ga0157380_10004013 Ga0157380_100040137 218
394 3300014745 Ga0157377_10002055 Ga0157377_100020555 218
395 3300025904 Ga0207647_10041306 Ga0207647_100413062 218
396 3300025907 Ga0207645_10236836 Ga0207645_102368362 218
397 3300025911 Ga0207654_10144828 Ga0207654_101448281 218
398 3300025914 Ga0207671_10031686 Ga0207671_100316864 218
399 3300025918 Ga0207662_10091806 Ga0207662_100918063 218
400 3300025923 Ga0207681_10002654 Ga0207681_100026548 218
401 3300025926 Ga0207659_10099600 Ga0207659_100996002 218
402 3300025933 Ga0207706_10026010 Ga0207706_100260103 218
403 3300025936 Ga0207670_10009853 Ga0207670_100098537 218
404 3300025940 Ga0207691_10029880 Ga0207691_100298803 218
405 3300025960 Ga0207651_10346594 Ga0207651_103465942 218
406 3300025972 Ga0207668_10105362 Ga0207668_101053623 218
407 3300026075 Ga0207708_10114288 Ga0207708_101142882 218
408 3300026089 Ga0207648_10160732 Ga0207648_101607322 218
409 3300026116 Ga0207674_10022101 Ga0207674_100221016 218
410 3300026118 Ga0207675_100000144 Ga0207675_10000014413 218
411 3300027907 Ga0207428_10193369 Ga0207428_101933692 218
412 3300028380 Ga0268265_10006981 Ga0268265_100069815 218
413 3300050493 nmdc:mga0k408_11749_c1 nmdc:mga0k408_11749_c1_1941_2648 218
414 3300050508 nmdc:mga09592_281809_c1 nmdc:mga09592_281809_c1_192_911 218
415 3300050511 nmdc:mga08y16_18928_c1 nmdc:mga08y16_18928_c1_6060_6779 218
416 3300003320 rootH2_10198254 rootH2_101982542 219
417 3300003322 rootL2_10201946 rootL2_102019462 219
418 3300003354 JGI25160J50197_1003604 JGI25160J50197_10036045 219
419 3300003771 Ga0055526_1011118 Ga0055526_10111183 219
420 3300003771 Ga0055526_1023425 Ga0055526_10234252 219
421 3300003790 Ga0055528_1000153 Ga0055528_10001532 219
422 3300003791 Ga0055530_10000805 Ga0055530_1000080522 219
423 3300003794 Ga0055531_10020731 Ga0055531_100207311 219
424 3300005262 Ga0065165_1000159 Ga0065165_100015950 219
425 3300005328 Ga0070676_10126559 Ga0070676_101265591 219
426 3300005334 Ga0068869_100108289 Ga0068869_1001082892 219
427 3300005459 Ga0068867_100039399 Ga0068867_1000393992 219
428 3300005718 Ga0068866_10022853 Ga0068866_100228533 219
429 3300005719 Ga0068861_100111406 Ga0068861_1001114061 219
430 3300005844 Ga0068862_100137800 Ga0068862_1001378001 219
431 3300006195 Ga0075366_10205199 Ga0075366_102051992 219
432 3300006881 Ga0068865_100026788 Ga0068865_1000267881 219
433 3300009176 Ga0105242_10059536 Ga0105242_100595363 219
434 3300025273 Ga0209673_1000016 Ga0209673_1000016276 219
435 3300025273 Ga0209673_1049566 Ga0209673_10495661 219
436 3300025295 Ga0209564_1005601 Ga0209564_10056016 219
437 3300025295 Ga0209564_1022792 Ga0209564_10227922 219
438 3300025295 Ga0209564_1036395 Ga0209564_10363951 219
439 3300025297 Ga0209758_1006726 Ga0209758_10067266 219
440 3300025297 Ga0209758_1030840 Ga0209758_10308402 219
441 3300025298 Ga0209050_1000608 Ga0209050_100060833 219
442 3300025302 Ga0207426_1000658 Ga0207426_10006587 219
443 3300025303 Ga0209051_1025501 Ga0209051_10255012 219
444 3300025304 Ga0209257_1000831 Ga0209257_100083132 219
445 3300025899 Ga0207642_10042205 Ga0207642_100422052 219
446 3300025907 Ga0207645_10050151 Ga0207645_100501513 219
447 3300025938 Ga0207704_10048200 Ga0207704_100482001 219
448 3300025942 Ga0207689_10132645 Ga0207689_101326452 219
449 3300026089 Ga0207648_10015205 Ga0207648_100152053 219
450 3300026118 Ga0207675_100050055 Ga0207675_1000500553 219
451 3300028380 Ga0268265_10244669 Ga0268265_102446692 219
452 3300031507 Ga0307509_10117107 Ga0307509_101171072 219
453 3300031507 Ga0307509_10145898 Ga0307509_101458982 219
454 3300031616 Ga0307508_10000990 Ga0307508_1000099027 219
455 3300031852 Ga0307410_10251265 Ga0307410_102512652 219
456 3300041505 Ga0451849_0930889 Ga0451849_0930889_242_946 219
457 3300046660 Ga0495625_0110805 Ga0495625_0110805_179_877 219
458 3300053146 Ga0500588_0006763 Ga0500588_0006763_1697_2413 219
459 iso_pu_bacteria 2929921140 2929924308 219
460 iso_pu_bacteria 8003151029 8003155588 219
461 3300003316 rootH1_10190589 rootH1_101905892 221
462 3300001979 JGI24740J21852_10004905 JGI24740J21852_100049053 223
463 3300002738 JGI25154J39366_1000012 JGI25154J39366_1000012176 223
464 3300003320 rootH2_10115022 rootH2_101150221 223
465 3300003354 JGI25160J50197_1021931 JGI25160J50197_10219312 223
466 3300010375 Ga0105239_10437487 Ga0105239_104374871 223
467 3300025246 Ga0209646_1000009 Ga0209646_100000998 223
468 3300025250 Ga0209026_1000209 Ga0209026_100020925 223
469 3300025297 Ga0209758_1007907 Ga0209758_10079076 223
470 3300025302 Ga0207426_1000834 Ga0207426_100083418 223
471 3300025302 Ga0207426_1039666 Ga0207426_10396662 223
472 3300053131 Ga0500652_029680 Ga0500652_029680_30_701 223
473 3300053139 Ga0500568_0047655 Ga0500568_0047655_736_1407 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05430

Methyltransf_30

S-adenosyl-L-methionine-dependent methyltransferase

144

260

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sgl-assembly1.cif.gz_A the crystal structure of mnmc from yersinia pestis bound with fad and sam 0.8503 31 221
2qy6-assembly1.cif.gz_A crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7 0.8308 3 223
2qy6-assembly1.cif.gz_A crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7 0.8208 3 223
3awi-assembly2.cif.gz_B bifunctional trna modification enzyme mnmc from escherichia coli 0.8196 32 221
3ps9-assembly1.cif.gz_A crystal structure of mnmc from e. coli 0.8116 14 221
ID Description Score Start End Superfamily
3sglA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8289 31 223 3.40.50.150
2qy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8288 4 223 3.40.50.150
2qy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8154 4 223 3.40.50.150
af_A0A1D6K4H3_75_167_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7566 145 222 3.40.50.150
3sglA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7479 31 223 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E4VEP4-F1-model_v4 MnmC-like methyltransferase domain-containing protein 0.9747 146 222 GO:0016645
AF-A0A4Q3RK67-F1-model_v4 SAM-dependent methyltransferase 0.9709 52 222 GO:0004808
GO:0016645
GO:0032259
AF-A0A444WG57-F1-model_v4 deleted 0.9698 20 222
AF-A0A3C2C7P6-F1-model_v4 deleted 0.9632 113 223
AF-A0A3M1UPC8-F1-model_v4 SAM-dependent methyltransferase 0.9623 146 223 GO:0008168
GO:0016645
GO:0032259

Feature Viewer

pLDDT pTM Quality
86.58 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map