F450939

General Info

Members Datasets Scaffolds Average Seq Length
473 378 946 444

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1005957|JGI25160J50197_10059573
Length 470
Sequence MPPMRVRIDLMWQRLSFRTQLFVPLGASFLVALILGGILLQLFATIQLAXESEPXRRLTRIVSAALNXTLSASDNPQKTLDAFVQLLDXSSDIQFXRVEEGPSPSPRDDXRNLKLVPRWFXNLMTIPDMDIASPVVIDGKHVGNLVFLPDLSADLFEKWIGFLALASLVAALMLLTGTIAYLFAGSALRPLQHLGNGLTRIRRGDYATPIPVGGPPEIRQSCEEANALAATLAQLSQDNRDLMHRLVSLQDDERRDLARELHDELGPLLFSIRAGTIALIDAASQAGNLGNSAEELLQSVEALQQSNRRILDRLRPLYIEELGLRTSVQTLLQNFRKQAPHIVLTDTIGSDLNGVDGPLAQTVYRVIQEALTNVLRHARASNADVQATITGEALVVDISDDGGGFPEGNAFGRGLTGMHERVRALSGSLSLLRVDGRTHVRCRLPVQPAREAPVSPSIISSENRPTRIER

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
50 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
51 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
52 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
53 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
82 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
83 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
184 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
185 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
186 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
194 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
195 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
200 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
201 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
202 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
203 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
204 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
205 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
206 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
207 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
208 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
209 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
210 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
211 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
212 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
213 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
214 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
215 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
216 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
217 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
218 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
219 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
220 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
221 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
222 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
223 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
224 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
225 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
226 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
227 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
228 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
229 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
230 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
231 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
232 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
233 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
234 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
235 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
236 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
237 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
238 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
239 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
240 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
241 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
242 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
243 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
244 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
245 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
246 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
247 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
248 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
249 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
250 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
251 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
252 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
253 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
254 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
255 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
256 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
257 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
258 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
259 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
260 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
261 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
262 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
263 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
264 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
265 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
266 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
267 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
268 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
269 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
270 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
271 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
272 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
273 2904699407
274 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
275 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
276 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
277 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
278 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
279 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
280 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
281 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
282 2922368715
283 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
284 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
285 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
286 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
287 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
288 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
289 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
290 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
291 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
292 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
293 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
294 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
295 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
296 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
297 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
298 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
299 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
300 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
301 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
302 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
303 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
304 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
305 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
306 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
307 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
308 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
309 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
310 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
311 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
312 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
313 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
314 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
315 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
316 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
317 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
318 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
319 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
320 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
321 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
322 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
323 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
324 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
325 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
326 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
327 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
328 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
329 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
330 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
331 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
332 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
333 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
334 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
335 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
336 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
337 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
338 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
339 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
340 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
341 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
342 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
343 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
344 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
345 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
346 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
347 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
348 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
349 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
350 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
351 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
352 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
353 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
354 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
355 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
356 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
357 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
358 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
359 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
360 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
361 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
362 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
363 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
364 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
365 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
366 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
367 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
368 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
369 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
370 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
371 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
372 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
373 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
374 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
375 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
376 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
377 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
378 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62
Metatranscriptomes 0
Isolates 38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.34
Nodule 30.66
Rhizoplane 5.5
Rhizosphere 30.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1005957 3300003354 Bacteria 5007
2 JGI25165J46597_1002673 3300003214 Bacteria 5352
3 JGI25153J46596_10003135 3300003215 Bacteria 9322
4 JGI25153J46596_10004880 3300003215 Bacteria 7133
5 JGI25153J46596_10008183 3300003215 Bacteria 5035
6 rootH2_10016777 3300003320 Bacteria 4721
7 rootL2_10135648 3300003322 Bacteria 1554
8 JGI25160J50197_1004486 3300003354 Bacteria 6023
9 JGI25404J52841_10006056 3300003659 Bacteria 2516
10 Ga0055542_1009387 3300003762 Bacteria 1848
11 Ga0055543_1006925 3300004625 Bacteria 2678
12 Ga0065165_1002824 3300005262 Bacteria 13591
13 Ga0065165_1002911 3300005262 Bacteria 13109
14 Ga0065165_1014697 3300005262 Bacteria 3027
15 Ga0070658_10051809 3300005327 Bacteria 3327
16 Ga0070661_100080832 3300005344 Bacteria 2399
17 Ga0070668_100010537 3300005347 Bacteria 6874
18 Ga0070671_100033437 3300005355 Bacteria 4252
19 Ga0070667_100074139 3300005367 Bacteria 2903
20 Ga0070709_10025940 3300005434 Bacteria 3468
21 Ga0070710_10011949 3300005437 Bacteria 4302
22 Ga0070711_100011637 3300005439 Bacteria 5467
23 Ga0070662_100036665 3300005457 Bacteria 3471
24 Ga0068855_100272275 3300005563 Bacteria 1883
25 Ga0068857_100141101 3300005577 Bacteria 2178
26 Ga0068856_100036797 3300005614 Bacteria 4799
27 Ga0068856_100108730 3300005614 Bacteria 2769
28 Ga0068852_100004110 3300005616 Bacteria 10240
29 Ga0068852_100102215 3300005616 Bacteria 2590
30 Ga0068864_100176664 3300005618 Bacteria 1950
31 Ga0068858_100220329 3300005842 Bacteria 1797
32 Ga0081540_1006791 3300005983 Bacteria 8269
33 Ga0081540_1026447 3300005983 Bacteria 3311
34 Ga0081540_1029036 3300005983 Bacteria 3090
35 Ga0075365_10012271 3300006038 Bacteria 5080
36 Ga0075365_10038526 3300006038 Bacteria 3108
37 Ga0075365_10077589 3300006038 Bacteria 2244
38 Ga0075368_10002392 3300006042 Bacteria 6111
39 Ga0070716_100018109 3300006173 Bacteria 3664
40 Ga0070712_100003458 3300006175 Bacteria 9721
41 Ga0075367_10024378 3300006178 Bacteria 3411
42 Ga0075369_10045658 3300006186 Bacteria 1884
43 Ga0075369_10048712 3300006186 Bacteria 1829
44 Ga0075366_10049122 3300006195 Bacteria 2503
45 Ga0075370_10024127 3300006353 Bacteria 3356
46 Ga0099823_1013505 3300006944 Bacteria 8211
47 Ga0099794_10001082 3300007265 Bacteria 9313
48 Ga0099795_10005721 3300007788 Bacteria 3333
49 Ga0099795_10030457 3300007788 Bacteria 1852
50 Ga0105240_10009687 3300009093 Bacteria 13613
51 Ga0105245_10094828 3300009098 Bacteria 2751
52 Ga0105243_10184615 3300009148 Bacteria 1816
53 Ga0105241_10004117 3300009174 Bacteria 10735
54 Ga0105241_10037814 3300009174 Bacteria 3637
55 Ga0105241_10043880 3300009174 Bacteria 3387
56 Ga0105248_10210715 3300009177 Bacteria 2189
57 Ga0105237_10009463 3300009545 Bacteria 10436
58 Ga0105238_10208266 3300009551 Bacteria 1931
59 Ga0099796_10012866 3300010159 Bacteria 2375
60 Ga0105239_10052237 3300010375 Bacteria 4481
61 Ga0105239_10080836 3300010375 Bacteria 3576
62 Ga0105239_10191096 3300010375 Bacteria 2292
63 Ga0163162_10367564 3300013306 Bacteria 1571
64 Ga0157375_10053686 3300013308 Bacteria 3967
65 Ga0163163_10052554 3300014325 Bacteria 4020
66 Ga0214544_1000003 3300021320 Bacteria 643752
67 Ga0214542_1000003 3300021321 Bacteria 435700
68 Ga0214545_1000004 3300021324 Bacteria 453352
69 Ga0214543_1000007 3300021327 Bacteria 414744
70 Ga0209677_100214 3300025253 Bacteria 42726
71 Ga0209677_104614 3300025253 Bacteria 3898
72 Ga0209148_1000270 3300025254 Bacteria 81508
73 Ga0209233_1001841 3300025261 Bacteria 8142
74 Ga0209233_1001983 3300025261 Bacteria 7755
75 Ga0209233_1010872 3300025261 Bacteria 2702
76 Ga0209233_1013079 3300025261 Bacteria 2381
77 Ga0209455_1003183 3300025272 Bacteria 5953
78 Ga0209564_1003506 3300025295 Bacteria 10627
79 Ga0209564_1004167 3300025295 Bacteria 9034
80 Ga0209564_1012065 3300025295 Bacteria 3803
81 Ga0209758_1000030 3300025297 Bacteria 509217
82 Ga0209758_1000458 3300025297 Bacteria 67627
83 Ga0209758_1002102 3300025297 Bacteria 21144
84 Ga0209758_1002543 3300025297 Bacteria 18391
85 Ga0209758_1004248 3300025297 Bacteria 12116
86 Ga0209758_1025279 3300025297 Bacteria 2611
87 Ga0207426_1000905 3300025302 Bacteria 29814
88 Ga0207426_1001164 3300025302 Bacteria 23548
89 Ga0207426_1008285 3300025302 Bacteria 4223
90 Ga0209257_1004471 3300025304 Bacteria 10808
91 Ga0207647_10010147 3300025904 Bacteria 6659
92 Ga0207699_10012299 3300025906 Bacteria 4351
93 Ga0207705_10016977 3300025909 Bacteria 5213
94 Ga0207654_10019621 3300025911 Bacteria 3572
95 Ga0207695_10000059 3300025913 Bacteria 363920
96 Ga0207671_10047491 3300025914 Bacteria 3178
97 Ga0207693_10005573 3300025915 Bacteria 10477
98 Ga0207649_10021788 3300025920 Bacteria 3696
99 Ga0207650_10137068 3300025925 Bacteria 1921
100 Ga0207687_10043678 3300025927 Bacteria 3089
101 Ga0207644_10015500 3300025931 Bacteria 5118
102 Ga0207706_10061169 3300025933 Bacteria 3316
103 Ga0207665_10045784 3300025939 Bacteria 2930
104 Ga0207689_10145513 3300025942 Bacteria 1952
105 Ga0207668_10049018 3300025972 Bacteria 2901
106 Ga0207658_10056195 3300025986 Bacteria 2920
107 Ga0207678_10004779 3300026067 Bacteria 12159
108 Ga0207678_10014825 3300026067 Bacteria 6858
109 Ga0207678_10022333 3300026067 Bacteria 5543
110 Ga0207678_10029194 3300026067 Bacteria 4813
111 Ga0207702_10094100 3300026078 Bacteria 2630
112 Ga0207641_10132751 3300026088 Bacteria 2238
113 Ga0207698_10007456 3300026142 Bacteria 6850
114 Ga0207698_10061338 3300026142 Bacteria 2930
115 Ga0209389_1000012 3300027296 Bacteria 213243
116 Ga0209389_1000165 3300027296 Bacteria 54591
117 Ga0209489_100019 3300027361 Bacteria 213243
118 Ga0209700_100018 3300027363 Bacteria 238200
119 Ga0209179_1006155 3300027512 Bacteria 1918
120 Ga0209588_1012220 3300027671 Bacteria 2604
121 Ga0307515_10235057 3300028794 Bacteria 1616
122 Ga0307510_10047654 3300033180 Bacteria 4588
123 Ga0395905_0046300 3300037471 Bacteria 4078
124 Ga0395905_0053185 3300037471 Bacteria 3790
125 Ga0395901_0220665 3300038443 Bacteria 1982
126 Ga0436365_0994683 3300039437 Bacteria 2312
127 Ga0466972_0000298 3300044658 Bacteria 30035
128 Ga0466972_0011125 3300044658 Bacteria 4516
129 Ga0466972_0045688 3300044658 Bacteria 2122
130 Ga0466965_0040427 3300044683 Bacteria 2295
131 Ga0466966_0001503 3300044684 Bacteria 14969
132 Ga0466961_0000042 3300044693 Bacteria 78589
133 Ga0466963_0014194 3300044694 Bacteria 4908
134 Ga0466964_0016476 3300044706 Bacteria 2823
135 Ga0466964_0027760 3300044706 Bacteria 2224
136 Ga0466970_0062679 3300044765 Bacteria 1993
137 Ga0466957_0019193 3300044842 Bacteria 4021
138 Ga0466959_0009573 3300045049 Bacteria 6893
139 Ga0466967_0052984 3300045976 Bacteria 3565
140 Ga0495592_0015531 3300046454 Bacteria 5777
141 Ga0495629_0001631 3300046459 Bacteria 17638
142 Ga0495651_0006312 3300046462 Bacteria 9069
143 Ga0495651_0167393 3300046462 Bacteria 1568
144 Ga0495653_0075867 3300046463 Bacteria 2501
145 Ga0495650_0049819 3300046471 Bacteria 1737
146 Ga0495607_0011050 3300046501 Bacteria 6030
147 Ga0495606_0051178 3300046507 Bacteria 2696
148 Ga0495606_0072109 3300046507 Bacteria 2171
149 Ga0495608_0049461 3300046511 Bacteria 2791
150 Ga0495610_0029803 3300046512 Bacteria 2867
151 Ga0495616_0033196 3300046513 Bacteria 2691
152 Ga0495628_0053739 3300046516 Bacteria 3177
153 Ga0495631_0005305 3300046518 Bacteria 6769
154 Ga0495643_0011794 3300046522 Bacteria 5301
155 Ga0495643_0044545 3300046522 Bacteria 2411
156 Ga0495648_0022822 3300046524 Bacteria 4297
157 Ga0495648_0038270 3300046524 Bacteria 3070
158 Ga0495652_0051489 3300046529 Bacteria 3516
159 Ga0495609_0078701 3300046538 Bacteria 1443
160 Ga0495597_0022868 3300046542 Bacteria 2896
161 Ga0495645_0011436 3300046543 Bacteria 6246
162 Ga0495622_0036751 3300046557 Bacteria 2282
163 Ga0495622_0073051 3300046557 Bacteria 1582
164 Ga0495667_0008814 3300046559 Bacteria 6859
165 Ga0495668_0037513 3300046616 Bacteria 2711
166 Ga0495668_0043578 3300046616 Bacteria 2495
167 Ga0495611_0033219 3300046648 Bacteria 2277
168 Ga0495625_0016840 3300046660 Bacteria 5739
169 Ga0495635_0001852 3300046663 Bacteria 14329
170 Ga0495588_0025154 3300046674 Bacteria 2964
171 Ga0495599_0019890 3300046678 Bacteria 4182
172 Ga0495623_0006403 3300046679 Bacteria 7656
173 Ga0495646_0063824 3300046680 Bacteria 2185
174 Ga0495613_0005023 3300046689 Bacteria 9934
175 Ga0495624_0024462 3300046690 Bacteria 3973
176 Ga0495624_0028375 3300046690 Bacteria 3658
177 Ga0495671_0030877 3300046692 Bacteria 2741
178 Ga0495649_0021843 3300046694 Bacteria 3585
179 Ga0495600_0005122 3300046809 Bacteria 7877
180 Ga0495600_0046314 3300046809 Bacteria 2838
181 Ga0495660_0014388 3300046810 Bacteria 4579
182 Ga0495581_0031065 3300047315 Bacteria 3094
183 Ga0495604_0002280 3300047317 Bacteria 15361
184 Ga0495604_0003538 3300047317 Bacteria 12454
185 Ga0495676_0004095 3300047321 Bacteria 13287
186 Ga0495676_0120573 3300047321 Bacteria 1908
187 Ga0495680_0008251 3300047322 Bacteria 9487
188 Ga0495683_0033990 3300047323 Bacteria 2594
189 Ga0495687_011255 3300047443 Bacteria 4822
190 Ga0495686_0003266 3300047472 Bacteria 14202
191 Ga0495686_0055603 3300047472 Bacteria 2474
192 Ga0495686_0058357 3300047472 Bacteria 2406
193 Ga0495593_0028963 3300047673 Bacteria 3040
194 Ga0495602_0009041 3300048088 Bacteria 10376
195 Ga0496100_0053884 3300048903 Bacteria 2621
196 Ga0496102_0026582 3300048905 Bacteria 5164
197 Ga0496103_0009827 3300048906 Bacteria 5665
198 Ga0496104_0003583 3300048907 Bacteria 13412
199 Ga0496104_0004107 3300048907 Bacteria 12638
200 Ga0496104_0032778 3300048907 Bacteria 4836
201 Ga0496104_0216386 3300048907 Bacteria 1827
202 Ga0496105_0001348 3300048908 Bacteria 17233
203 Ga0496105_0022234 3300048908 Bacteria 5136
204 Ga0496105_0099009 3300048908 Bacteria 2408
205 Ga0496106_0015830 3300048909 Bacteria 5578
206 Ga0496107_0020499 3300048910 Bacteria 4670
207 Ga0496108_0000392 3300048911 Bacteria 36249
208 Ga0496108_0089604 3300048911 Bacteria 2614
209 Ga0496109_0000509 3300048912 Bacteria 33001
210 Ga0496109_0019613 3300048912 Bacteria 5966
211 Ga0496109_0079198 3300048912 Bacteria 3027
212 Ga0496110_0002823 3300048913 Bacteria 13112
213 Ga0496110_0316502 3300048913 Bacteria 1421
214 Ga0496112_0034561 3300048915 Bacteria 4920
215 Ga0496112_0074438 3300048915 Bacteria 3358
216 Ga0496112_0291025 3300048915 Bacteria 1579
217 Ga0496114_0014723 3300048917 Bacteria 6286
218 Ga0496115_0017940 3300048918 Bacteria 5422
219 Ga0496116_0078622 3300048919 Bacteria 2056
220 Ga0496117_0028316 3300048920 Bacteria 4342
221 Ga0496117_0074694 3300048920 Bacteria 2255
222 Ga0496118_0058975 3300048921 Bacteria 2863
223 Ga0496119_0002595 3300048922 Bacteria 19627
224 Ga0496119_0016276 3300048922 Bacteria 5668
225 Ga0496119_0022092 3300048922 Bacteria 4570
226 Ga0496119_0022452 3300048922 Bacteria 4517
227 Ga0496119_0032089 3300048922 Bacteria 3507
228 Ga0496120_0013033 3300048923 Bacteria 5622
229 Ga0496120_0035857 3300048923 Bacteria 2958
230 Ga0496120_0039555 3300048923 Bacteria 2780
231 Ga0496121_0004475 3300048924 Bacteria 18761
232 Ga0496121_0011703 3300048924 Bacteria 9687
233 Ga0496121_0019013 3300048924 Bacteria 6891
234 Ga0496121_0120241 3300048924 Bacteria 1985
235 Ga0496122_0033041 3300048925 Bacteria 4263
236 Ga0496123_0007903 3300048926 Bacteria 9883
237 Ga0496124_0034471 3300048927 Bacteria 4442
238 Ga0496124_0057894 3300048927 Bacteria 3263
239 Ga0496125_0000910 3300048928 Bacteria 46750
240 Ga0496125_0044038 3300048928 Bacteria 3780
241 Ga0496125_0045270 3300048928 Bacteria 3707
242 Ga0496125_0053521 3300048928 Bacteria 3307
243 Ga0496126_0010271 3300048929 Bacteria 9833
244 Ga0496126_0012373 3300048929 Bacteria 8749
245 Ga0496126_0015202 3300048929 Bacteria 7750
246 Ga0496126_0035360 3300048929 Bacteria 4684
247 Ga0496126_0044297 3300048929 Bacteria 4099
248 Ga0496126_0050880 3300048929 Bacteria 3774
249 Ga0496126_0119066 3300048929 Bacteria 2292
250 Ga0495682_0011533 3300049460 Bacteria 3400
251 nmdc:mga00v17_23542_c1 3300050491 Bacteria 3562
252 nmdc:mga0yw44_24486_c1 3300050492 Bacteria 3417
253 nmdc:mga0yw44_3867_c1 3300050492 Bacteria 6740
254 nmdc:mga0yw44_41387_c1 3300050492 Bacteria 2743
255 nmdc:mga0k408_44895_c1 3300050493 Bacteria 2549
256 nmdc:mga0k408_9960_c1 3300050493 Bacteria 5132
257 nmdc:mga06z11_8867_c1 3300050494 Bacteria 4215
258 nmdc:mga06z11_92662_c1 3300050494 Bacteria 1643
259 nmdc:mga07m45_10473_c1 3300050496 Bacteria 4846
260 nmdc:mga0sz30_19336_c1 3300050516 Bacteria 2191
261 Ga0495595_0027243 3300053084 Bacteria 2545
262 Ga0500578_0068960 3300053086 Bacteria 2254
263 Ga0500643_001084 3300053087 Bacteria 16390
264 Ga0500644_0002966 3300053088 Bacteria 4209
265 Ga0500566_0001673 3300053094 Bacteria 13026
266 Ga0500641_0004250 3300053096 Bacteria 5054
267 Ga0500641_0025008 3300053096 Bacteria 2307
268 Ga0500555_000997 3300053103 Bacteria 9683
269 Ga0500556_0006688 3300053104 Bacteria 3278
270 Ga0500557_000091 3300053105 Bacteria 30639
271 Ga0500562_002711 3300053108 Bacteria 4404
272 Ga0500562_002907 3300053108 Bacteria 4274
273 Ga0500569_004158 3300053109 Bacteria 3021
274 Ga0500592_000105 3300053116 Bacteria 18131
275 Ga0500642_0000584 3300053130 Bacteria 10902
276 Ga0500642_0010578 3300053130 Bacteria 3260
277 Ga0500652_000325 3300053131 Bacteria 17129
278 Ga0500568_0000115 3300053139 Bacteria 72862
279 Ga0500568_0024042 3300053139 Bacteria 2583
280 Ga0500577_0041236 3300053142 Bacteria 1683
281 Ga0500616_0000057 3300053153 Bacteria 278571
282 Ga0500622_0000791 3300053156 Bacteria 27348
283 Ga0500622_0015290 3300053156 Bacteria 4111
284 Ga0500633_0019292 3300053160 Bacteria 2037
285 Ga0500634_0026297 3300053161 Bacteria 3170
286 Ga0500638_013873 3300053162 Bacteria 3660
287 Ga0500636_0006173 3300053177 Bacteria 6881
288 Ga0500625_018138 3300053729 Bacteria 3292
289 Ga0500645_009415 3300053730 Bacteria 3282
290 Ga0500599_001105 3300053736 Bacteria 3050
291 Ga0500601_000458 3300053737 Bacteria 6593
292 Ga0500661_004080 3300055283 Bacteria 2730
293 2507505764 2507262055 Bacteria 8048963
294 2508539958 2508501009 Bacteria 7784016
295 2508696024 2508501042 Bacteria 8719808
296 2511398885 2511231028 Bacteria 8046582
297 2513625658 2513237092 Bacteria 8341956
298 2513641744 2513237094 Bacteria 8789602
299 2513649425 2513237095 Bacteria 8976980
300 2513701270 2513237102 Bacteria 7703324
301 2513861919 2513237137 Bacteria 9558895
302 2513874071 2513237139 Bacteria 8737671
303 2514010157 2513237161 Bacteria 8871253
304 2515627713 2515154112 Bacteria 8294334
305 2517107041 2517093001 Bacteria 9002274
306 2517891921 2517572143 Bacteria 9484767
307 2524435569 2524023205 Bacteria 8918781
308 2524534219 2524023228 Bacteria 10118060
309 2603861626 2602042107 Bacteria 6226103
310 2617350200 2617270735 Bacteria 9163226
311 2617374284 2617270741 Bacteria 8201522
312 2671123902 2667528175 Bacteria 7532676
313 2745079824 2744054633 Bacteria 8678936
314 2793059194 2791355196 Bacteria 7323613
315 2805920428 2802429603 Bacteria 8777136
316 2824618706 2824617872 Bacteria 8814715
317 2824628812 2824626560 Bacteria 8813858
318 2824638117 2824635225 Bacteria 8785348
319 2824651947 2824644064 Bacteria 8743947
320 2824669623 2824661429 Bacteria 9877870
321 2824674512 2824671348 Bacteria 8369588
322 2824682121 2824679649 Bacteria 8248951
323 2824691136 2824687955 Bacteria 8360029
324 2824698594 2824696289 Bacteria 8335049
325 2824709303 2824704595 Bacteria 9667483
326 2824717881 2824714736 Bacteria 8717648
327 2824726174 2824723954 Bacteria 8758240
328 2824754882 2824753945 Bacteria 9787441
329 2824765264 2824763712 Bacteria 9792355
330 2824778106 2824773399 Bacteria 8360218
331 2841942676 2841941048 Bacteria 8688029
332 2841952973 2841949485 Bacteria 8680857
333 2841962979 2841957949 Bacteria 8652217
334 2841971000 2841966195 Bacteria 8673214
335 2841977742 2841974524 Bacteria 8931498
336 2841984696 2841983080 Bacteria 8395090
337 2842041580 2842038055 Bacteria 8002051
338 2842049622 2842045827 Bacteria 8006841
339 2844321632 2844315083 Bacteria 8138177
340 2847939616 2847930680 Bacteria 9342022
341 2847943106 2847939898 Bacteria 8606328
342 2849076852 2849076700 Bacteria 7039503
343 2857530797 2857524615 Bacteria 6615449
344 2874593798 2874590934 Bacteria 8299676
345 2874620487 2874612657 Bacteria 8252029
346 2874629365 2874628541 Bacteria 8630250
347 2874648037 2874645413 Bacteria 8214782
348 2876762348 2876761206 Bacteria 10111113
349 2876772023 2876771140 Bacteria 8287509
350 2876826382 2876818435 Bacteria 8274608
351 2879077585 2879074833 Bacteria 8279565
352 2879091387 2879083081 Bacteria 8587928
353 2879105463 2879099564 Bacteria 10442239
354 2879134334 2879127579 Bacteria 8294491
355 2879147291 2879142872 Bacteria 8267021
356 2881364516 2881364244 Bacteria 7710352
357 2881666129 2881665667 Bacteria 8175609
358 2885369106 2885366525 Bacteria 8326213
359 2885418681 2885409591 Bacteria 9235467
360 2888380187 2888378607 Bacteria 9652610
361 2888390107 2888388044 Bacteria 7304136
362 2893071016 2893066018 Bacteria 6158120
363 2903727793 2903727486 Bacteria 8281579
364 2904702260
365 2904714452 2904711408 Bacteria 9771557
366 2906602722 2906602504 Bacteria 8295279
367 2906634731 2906626472 Bacteria 8826946
368 2906637212 2906635258 Bacteria 8601019
369 2906644547 2906643746 Bacteria 8722424
370 2906662318 2906660503 Bacteria 8595048
371 2908745268 2908739725 Bacteria 8628932
372 2919075223 2919073203 Bacteria 6531949
373 2922377675
374 2922400204 2922393267 Bacteria 8285685
375 2929623355 2929615660 Bacteria 9193770
376 2929632553 2929624759 Bacteria 9339455
377 2932788172 2932784394 Bacteria 9704911
378 2932794865 2932794094 Bacteria 7915132
379 2932805342 2932801729 Bacteria 7987968
380 2932813543 2932809354 Bacteria 9135765
381 2932820240 2932818245 Bacteria 9955613
382 2932832693 2932828146 Bacteria 9745859
383 2933585259 2933577622 Bacteria 9116884
384 2935614814 2935608549 Bacteria 8203142
385 2935617948 2935616580 Bacteria 9032984
386 2935620183 2935616580 Bacteria 9032984
387 2935640502 2935638405 Bacteria 10015038
388 2935649213 2935648319 Bacteria 8801166
389 2935658015 2935656913 Bacteria 8965014
390 2935668695 2935665750 Bacteria 9571747
391 2935681997 2935675223 Bacteria 9928132
392 2935687003 2935684952 Bacteria 9590419
393 2935697027 2935694250 Bacteria 9291695
394 2935709795 2935703347 Bacteria 10242284
395 2935716691 2935713505 Bacteria 9608509
396 2935723184 2935722832 Bacteria 9608746
397 2935734741 2935732158 Bacteria 9706831
398 2935744468 2935741537 Bacteria 9707219
399 2935752969 2935750917 Bacteria 9590372
400 2935766867 2935760218 Bacteria 9817913
401 2935775620 2935769743 Bacteria 7878163
402 2935777928 2935777560 Bacteria 8077691
403 2935791327 2935785616 Bacteria 7962367
404 2935799639 2935793552 Bacteria 8012592
405 2935804615 2935801545 Bacteria 9301974
406 2935815768 2935810662 Bacteria 9401221
407 2935826146 2935819856 Bacteria 8261050
408 2935832008 2935827899 Bacteria 10038562
409 2935841161 2935837841 Bacteria 9454360
410 2935853642 2935847175 Bacteria 8228321
411 2935856553 2935855204 Bacteria 9035059
412 2935859069 2935855204 Bacteria 9035059
413 2935864250 2935864058 Bacteria 9784707
414 2935875398 2935873716 Bacteria 9632195
415 2935887576 2935883170 Bacteria 7964738
416 2935910863 2935908558 Bacteria 8568796
417 2935922045 2935916978 Bacteria 9113783
418 2935929818 2935926038 Bacteria 8601059
419 2935937486 2935934488 Bacteria 8602579
420 2935948115 2935942939 Bacteria 8599779
421 2935957664 2935951376 Bacteria 8602333
422 2935964318 2935959822 Bacteria 7869783
423 2935971057 2935967501 Bacteria 8603075
424 2935978378 2935975950 Bacteria 8347125
425 2935985491 2935984226 Bacteria 8302647
426 2935995624 2935992306 Bacteria 9802711
427 2936008043 2936002035 Bacteria 9362176
428 2936012234 2936011229 Bacteria 8801034
429 2936020685 2936019824 Bacteria 8804134
430 2936029527 2936028420 Bacteria 8965941
431 2936041670 2936037263 Bacteria 9446081
432 2936048149 2936046547 Bacteria 8903709
433 2936056740 2936055302 Bacteria 8785755
434 2940558882 2940556831 Bacteria 9590747
435 2941532196 2941531003 Bacteria 7653939
436 2941543387 2941538514 Bacteria 9402094
437 3005490937 3005483717 Bacteria 7877331
438 3005506468 3005506211 Bacteria 6943378
439 3005602009 3005594810 Bacteria 8716512
440 3005724789 3005718088 Bacteria 8283608
441 8006940305 8006933436 Bacteria 10410654
442 8006980083 8006973647 Bacteria 10679141
443 8016517537 8016511872 Bacteria 9921665
444 8016526777 8016522445 Bacteria 8156687
445 8016531868 8016530956 Bacteria 8155261
446 8016565357 8016557553 Bacteria 8154380
447 8016570144 8016566248 Bacteria 8158151
448 8016582712 8016575299 Bacteria 8154085
449 8016585607 8016583857 Bacteria 10421953
450 8016602996 8016595262 Bacteria 8149947
451 8016605890 8016603502 Bacteria 8731218
452 8016608135 8016603502 Bacteria 8731218
453 8016616740 8016613128 Bacteria 8794220
454 8016617785 8016613128 Bacteria 8794220
455 8016635069 8016630954 Bacteria 9217207
456 8017059081 8017057580 Bacteria 10023680
457 8019531690 8019530166 Bacteria 8155624
458 8019539843 8019538911 Bacteria 7872763
459 8019550810 8019547302 Bacteria 7996444
460 8019570264 8019565922 Bacteria 9639779
461 8019576556 8019576017 Bacteria 10049540
462 8019607131 8019597564 Bacteria 10041141
463 8019611377 8019608314 Bacteria 10042931
464 8019631176 8019629233 Bacteria 8687553
465 8019639442 8019638758 Bacteria 9062356
466 8019651871 8019648815 Bacteria 10014479
467 8019667984 8019659431 Bacteria 8577854
468 8019677404 8019668869 Bacteria 8791617
469 8019687548 8019678201 Bacteria 8863603
470 8019695639 8019687851 Bacteria 8712826
471 8055743298 8055742211 Bacteria 9226248
472 8056694193 8056689827 Bacteria 6712655
473 8056975510 8056967851 Bacteria 9038162
474 JGI25160J50197_1005957
475 JGI25165J46597_1002673
476 JGI25153J46596_10003135
477 JGI25153J46596_10004880
478 JGI25153J46596_10008183
479 rootH2_10016777
480 rootL2_10135648
481 JGI25160J50197_1004486
482 JGI25404J52841_10006056
483 Ga0055542_1009387
484 Ga0055543_1006925
485 Ga0065165_1002824
486 Ga0065165_1002911
487 Ga0065165_1014697
488 Ga0070658_10051809
489 Ga0070661_100080832
490 Ga0070668_100010537
491 Ga0070671_100033437
492 Ga0070667_100074139
493 Ga0070709_10025940
494 Ga0070710_10011949
495 Ga0070711_100011637
496 Ga0070662_100036665
497 Ga0068855_100272275
498 Ga0068857_100141101
499 Ga0068856_100036797
500 Ga0068856_100108730
501 Ga0068852_100004110
502 Ga0068852_100102215
503 Ga0068864_100176664
504 Ga0068858_100220329
505 Ga0081540_1006791
506 Ga0081540_1026447
507 Ga0081540_1029036
508 Ga0075365_10012271
509 Ga0075365_10038526
510 Ga0075365_10077589
511 Ga0075368_10002392
512 Ga0070716_100018109
513 Ga0070712_100003458
514 Ga0075367_10024378
515 Ga0075369_10045658
516 Ga0075369_10048712
517 Ga0075366_10049122
518 Ga0075370_10024127
519 Ga0099823_1013505
520 Ga0099794_10001082
521 Ga0099795_10005721
522 Ga0099795_10030457
523 Ga0105240_10009687
524 Ga0105245_10094828
525 Ga0105243_10184615
526 Ga0105241_10004117
527 Ga0105241_10037814
528 Ga0105241_10043880
529 Ga0105248_10210715
530 Ga0105237_10009463
531 Ga0105238_10208266
532 Ga0099796_10012866
533 Ga0105239_10052237
534 Ga0105239_10080836
535 Ga0105239_10191096
536 Ga0163162_10367564
537 Ga0157375_10053686
538 Ga0163163_10052554
539 Ga0214544_1000003
540 Ga0214542_1000003
541 Ga0214545_1000004
542 Ga0214543_1000007
543 Ga0209677_100214
544 Ga0209677_104614
545 Ga0209148_1000270
546 Ga0209233_1001841
547 Ga0209233_1001983
548 Ga0209233_1010872
549 Ga0209233_1013079
550 Ga0209455_1003183
551 Ga0209564_1003506
552 Ga0209564_1004167
553 Ga0209564_1012065
554 Ga0209758_1000030
555 Ga0209758_1000458
556 Ga0209758_1002102
557 Ga0209758_1002543
558 Ga0209758_1004248
559 Ga0209758_1025279
560 Ga0207426_1000905
561 Ga0207426_1001164
562 Ga0207426_1008285
563 Ga0209257_1004471
564 Ga0207647_10010147
565 Ga0207699_10012299
566 Ga0207705_10016977
567 Ga0207654_10019621
568 Ga0207695_10000059
569 Ga0207671_10047491
570 Ga0207693_10005573
571 Ga0207649_10021788
572 Ga0207650_10137068
573 Ga0207687_10043678
574 Ga0207644_10015500
575 Ga0207706_10061169
576 Ga0207665_10045784
577 Ga0207689_10145513
578 Ga0207668_10049018
579 Ga0207658_10056195
580 Ga0207678_10004779
581 Ga0207678_10014825
582 Ga0207678_10022333
583 Ga0207678_10029194
584 Ga0207702_10094100
585 Ga0207641_10132751
586 Ga0207698_10007456
587 Ga0207698_10061338
588 Ga0209389_1000012
589 Ga0209389_1000165
590 Ga0209489_100019
591 Ga0209700_100018
592 Ga0209179_1006155
593 Ga0209588_1012220
594 Ga0307515_10235057
595 Ga0307510_10047654
596 Ga0395905_0046300
597 Ga0395905_0053185
598 Ga0395901_0220665
599 Ga0436365_0994683
600 Ga0466972_0000298
601 Ga0466972_0011125
602 Ga0466972_0045688
603 Ga0466965_0040427
604 Ga0466966_0001503
605 Ga0466961_0000042
606 Ga0466963_0014194
607 Ga0466964_0016476
608 Ga0466964_0027760
609 Ga0466970_0062679
610 Ga0466957_0019193
611 Ga0466959_0009573
612 Ga0466967_0052984
613 Ga0495592_0015531
614 Ga0495629_0001631
615 Ga0495651_0006312
616 Ga0495651_0167393
617 Ga0495653_0075867
618 Ga0495650_0049819
619 Ga0495607_0011050
620 Ga0495606_0051178
621 Ga0495606_0072109
622 Ga0495608_0049461
623 Ga0495610_0029803
624 Ga0495616_0033196
625 Ga0495628_0053739
626 Ga0495631_0005305
627 Ga0495643_0011794
628 Ga0495643_0044545
629 Ga0495648_0022822
630 Ga0495648_0038270
631 Ga0495652_0051489
632 Ga0495609_0078701
633 Ga0495597_0022868
634 Ga0495645_0011436
635 Ga0495622_0036751
636 Ga0495622_0073051
637 Ga0495667_0008814
638 Ga0495668_0037513
639 Ga0495668_0043578
640 Ga0495611_0033219
641 Ga0495625_0016840
642 Ga0495635_0001852
643 Ga0495588_0025154
644 Ga0495599_0019890
645 Ga0495623_0006403
646 Ga0495646_0063824
647 Ga0495613_0005023
648 Ga0495624_0024462
649 Ga0495624_0028375
650 Ga0495671_0030877
651 Ga0495649_0021843
652 Ga0495600_0005122
653 Ga0495600_0046314
654 Ga0495660_0014388
655 Ga0495581_0031065
656 Ga0495604_0002280
657 Ga0495604_0003538
658 Ga0495676_0004095
659 Ga0495676_0120573
660 Ga0495680_0008251
661 Ga0495683_0033990
662 Ga0495687_011255
663 Ga0495686_0003266
664 Ga0495686_0055603
665 Ga0495686_0058357
666 Ga0495593_0028963
667 Ga0495602_0009041
668 Ga0496100_0053884
669 Ga0496102_0026582
670 Ga0496103_0009827
671 Ga0496104_0003583
672 Ga0496104_0004107
673 Ga0496104_0032778
674 Ga0496104_0216386
675 Ga0496105_0001348
676 Ga0496105_0022234
677 Ga0496105_0099009
678 Ga0496106_0015830
679 Ga0496107_0020499
680 Ga0496108_0000392
681 Ga0496108_0089604
682 Ga0496109_0000509
683 Ga0496109_0019613
684 Ga0496109_0079198
685 Ga0496110_0002823
686 Ga0496110_0316502
687 Ga0496112_0034561
688 Ga0496112_0074438
689 Ga0496112_0291025
690 Ga0496114_0014723
691 Ga0496115_0017940
692 Ga0496116_0078622
693 Ga0496117_0028316
694 Ga0496117_0074694
695 Ga0496118_0058975
696 Ga0496119_0002595
697 Ga0496119_0016276
698 Ga0496119_0022092
699 Ga0496119_0022452
700 Ga0496119_0032089
701 Ga0496120_0013033
702 Ga0496120_0035857
703 Ga0496120_0039555
704 Ga0496121_0004475
705 Ga0496121_0011703
706 Ga0496121_0019013
707 Ga0496121_0120241
708 Ga0496122_0033041
709 Ga0496123_0007903
710 Ga0496124_0034471
711 Ga0496124_0057894
712 Ga0496125_0000910
713 Ga0496125_0044038
714 Ga0496125_0045270
715 Ga0496125_0053521
716 Ga0496126_0010271
717 Ga0496126_0012373
718 Ga0496126_0015202
719 Ga0496126_0035360
720 Ga0496126_0044297
721 Ga0496126_0050880
722 Ga0496126_0119066
723 Ga0495682_0011533
724 nmdc:mga00v17_23542_c1
725 nmdc:mga0yw44_24486_c1
726 nmdc:mga0yw44_3867_c1
727 nmdc:mga0yw44_41387_c1
728 nmdc:mga0k408_44895_c1
729 nmdc:mga0k408_9960_c1
730 nmdc:mga06z11_8867_c1
731 nmdc:mga06z11_92662_c1
732 nmdc:mga07m45_10473_c1
733 nmdc:mga0sz30_19336_c1
734 Ga0495595_0027243
735 Ga0500578_0068960
736 Ga0500643_001084
737 Ga0500644_0002966
738 Ga0500566_0001673
739 Ga0500641_0004250
740 Ga0500641_0025008
741 Ga0500555_000997
742 Ga0500556_0006688
743 Ga0500557_000091
744 Ga0500562_002711
745 Ga0500562_002907
746 Ga0500569_004158
747 Ga0500592_000105
748 Ga0500642_0000584
749 Ga0500642_0010578
750 Ga0500652_000325
751 Ga0500568_0000115
752 Ga0500568_0024042
753 Ga0500577_0041236
754 Ga0500616_0000057
755 Ga0500622_0000791
756 Ga0500622_0015290
757 Ga0500633_0019292
758 Ga0500634_0026297
759 Ga0500638_013873
760 Ga0500636_0006173
761 Ga0500625_018138
762 Ga0500645_009415
763 Ga0500599_001105
764 Ga0500601_000458
765 Ga0500661_004080
766 2507505764
767 2508539958
768 2508696024
769 2511398885
770 2513625658
771 2513641744
772 2513649425
773 2513701270
774 2513861919
775 2513874071
776 2514010157
777 2515627713
778 2517107041
779 2517891921
780 2524435569
781 2524534219
782 2603861626
783 2617350200
784 2617374284
785 2671123902
786 2745079824
787 2793059194
788 2805920428
789 2824618706
790 2824628812
791 2824638117
792 2824651947
793 2824669623
794 2824674512
795 2824682121
796 2824691136
797 2824698594
798 2824709303
799 2824717881
800 2824726174
801 2824754882
802 2824765264
803 2824778106
804 2841942676
805 2841952973
806 2841962979
807 2841971000
808 2841977742
809 2841984696
810 2842041580
811 2842049622
812 2844321632
813 2847939616
814 2847943106
815 2849076852
816 2857530797
817 2874593798
818 2874620487
819 2874629365
820 2874648037
821 2876762348
822 2876772023
823 2876826382
824 2879077585
825 2879091387
826 2879105463
827 2879134334
828 2879147291
829 2881364516
830 2881666129
831 2885369106
832 2885418681
833 2888380187
834 2888390107
835 2893071016
836 2903727793
837 2904702260
838 2904714452
839 2906602722
840 2906634731
841 2906637212
842 2906644547
843 2906662318
844 2908745268
845 2919075223
846 2922377675
847 2922400204
848 2929623355
849 2929632553
850 2932788172
851 2932794865
852 2932805342
853 2932813543
854 2932820240
855 2932832693
856 2933585259
857 2935614814
858 2935617948
859 2935620183
860 2935640502
861 2935649213
862 2935658015
863 2935668695
864 2935681997
865 2935687003
866 2935697027
867 2935709795
868 2935716691
869 2935723184
870 2935734741
871 2935744468
872 2935752969
873 2935766867
874 2935775620
875 2935777928
876 2935791327
877 2935799639
878 2935804615
879 2935815768
880 2935826146
881 2935832008
882 2935841161
883 2935853642
884 2935856553
885 2935859069
886 2935864250
887 2935875398
888 2935887576
889 2935910863
890 2935922045
891 2935929818
892 2935937486
893 2935948115
894 2935957664
895 2935964318
896 2935971057
897 2935978378
898 2935985491
899 2935995624
900 2936008043
901 2936012234
902 2936020685
903 2936029527
904 2936041670
905 2936048149
906 2936056740
907 2940558882
908 2941532196
909 2941543387
910 3005490937
911 3005506468
912 3005602009
913 3005724789
914 8006940305
915 8006980083
916 8016517537
917 8016526777
918 8016531868
919 8016565357
920 8016570144
921 8016582712
922 8016585607
923 8016602996
924 8016605890
925 8016608135
926 8016616740
927 8016617785
928 8016635069
929 8017059081
930 8019531690
931 8019539843
932 8019550810
933 8019570264
934 8019576556
935 8019607131
936 8019611377
937 8019631176
938 8019639442
939 8019651871
940 8019667984
941 8019677404
942 8019687548
943 8019695639
944 8055743298
945 8056694193
946 8056975510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00672

HAMP

HAMP domain

182

220

0.96

PF07730

HisKA_3

Histidine kinase

253

318

0.95

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

359

448

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gt8-assembly1.cif.gz_A crystal structure of the catalytic and atp-binding domain from vras in complex with adp 0.8813 320 444
3ehg-assembly1.cif.gz_A crystal structure of the atp-binding domain of desk in complex with atp 0.8613 324 441
4gt8-assembly1.cif.gz_A crystal structure of the catalytic and atp-binding domain from vras in complex with adp 0.8259 320 444
8sbm-assembly1.cif.gz_A crystal structure of the wild-type catalytic atp-binding domain of mtb doss 0.8253 320 444
3zxo-assembly1.cif.gz_A crystal structure of the mutant atp-binding domain of mycobacterium tuberculosis doss 0.8153 320 444
ID Description Score Start End Superfamily
af_P09835_373_498_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.919 318 441 3.30.565.10
af_P09835_373_498_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8983 318 441 3.30.565.10
4gt8A00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8813 320 444 3.30.565.10
af_O53857_291_425_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8715 313 443 3.30.565.10
af_P0AFA2_454_587_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8613 318 444 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A2A6RKK5-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9092 320 442 GO:0000160
GO:0016020
GO:0016301
AF-A0A747M9M6-F1-model_v4 Signal transduction histidine-protein kinase/phosphatase UhpB (EC 2.7.13.3) 0.8884 214 441 GO:0000155
GO:0005886
GO:0046983
AF-A0A735RA16-F1-model_v4 Signal transduction histidine-protein kinase/phosphatase UhpB (EC 2.7.13.3) 0.888 214 441 GO:0000155
GO:0005886
GO:0046983
AF-A0A7C5D303-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8864 311 443 GO:0000160
GO:0016301
AF-A0A5U2P7Z6-F1-model_v4 Signal transduction histidine-protein kinase/phosphatase UhpB (EC 2.7.13.3) 0.8839 214 441 GO:0000155
GO:0005886
GO:0046983

Map