F450915

General Info

Members Datasets Scaffolds Average Seq Length
472 230 944 191

Family's Representative Sequence

Representative Sequence 3300059493|Ga0587077_019158|Ga0587077_019158_440_1018
Length 192
Sequence MPMQYEYTAIPPEQVPRAANPLFQHLLDTYASETNKVVSLWRQFSADDMTFKSADRSSSVLDIMKHQLLSERRFFAEFIGLGGEPEAAALMPQELTPSAFCRRMEELSKPRLERMAGHDPAWWLEVVPFFDVERQRIWIFWRRVLHTAHHRTQLSVYLRLLGKPVPSSYGPTADVTWKGADPTRTVEAAGRK

Samples

Sample ID Description Type Environment
1 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 2.33
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 21.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587077_019158 3300059493 Unclassified 1188
2 Ga0065712_10088587 3300005290 Bacteria 2512
3 Ga0065707_10004825 3300005295 Bacteria 5819
4 Ga0070658_10125872 3300005327 Bacteria 2133
5 Ga0070683_100001514 3300005329 Bacteria 17952
6 Ga0070683_100017140 3300005329 Bacteria 6397
7 Ga0070683_100026500 3300005329 Bacteria 5221
8 Ga0070683_100058191 3300005329 Bacteria 3591
9 Ga0070683_100179877 3300005329 Unclassified 2007
10 Ga0070683_100238132 3300005329 Unclassified 1731
11 Ga0070670_100005263 3300005331 Bacteria 10897
12 Ga0070670_100008828 3300005331 Bacteria 8604
13 Ga0070677_10144543 3300005333 Bacteria 1101
14 Ga0070677_10470361 3300005333 Unclassified 676
15 Ga0070666_10611164 3300005335 Unclassified 796
16 Ga0070680_100000044 3300005336 Bacteria 64298
17 Ga0070680_100004652 3300005336 Bacteria 10319
18 Ga0070680_100008882 3300005336 Bacteria 7701
19 Ga0070680_100020802 3300005336 Bacteria 5207
20 Ga0070680_100337663 3300005336 Bacteria 1280
21 Ga0070682_100078562 3300005337 Bacteria 2129
22 Ga0070682_100243898 3300005337 Unclassified 1291
23 Ga0070682_100275863 3300005337 Unclassified 1223
24 Ga0068868_100047489 3300005338 Bacteria 3365
25 Ga0068868_100787458 3300005338 Unclassified 857
26 Ga0070660_100042274 3300005339 Bacteria 3478
27 Ga0070689_100188330 3300005340 Bacteria 1679
28 Ga0070691_10034651 3300005341 Bacteria 2377
29 Ga0070691_10059935 3300005341 Unclassified 1829
30 Ga0070692_10595451 3300005345 Unclassified 731
31 Ga0070675_100084880 3300005354 Bacteria 2644
32 Ga0070673_100392575 3300005364 Bacteria 1239
33 Ga0070659_100255250 3300005366 Bacteria 1454
34 Ga0070667_100106257 3300005367 Unclassified 2430
35 Ga0070667_100263694 3300005367 Bacteria 1543
36 Ga0070703_10005986 3300005406 Bacteria 3403
37 Ga0070714_100008240 3300005435 Bacteria 8124
38 Ga0070714_100050860 3300005435 Bacteria 3532
39 Ga0070714_100084145 3300005435 Bacteria 2775
40 Ga0070711_100074418 3300005439 Unclassified 2402
41 Ga0070705_100000905 3300005440 Bacteria 16561
42 Ga0070700_100000079 3300005441 Bacteria 64802
43 Ga0070700_100101915 3300005441 Bacteria 1893
44 Ga0070700_100565721 3300005441 Bacteria 885
45 Ga0070694_100000950 3300005444 Bacteria 16403
46 Ga0070694_100102726 3300005444 Bacteria 2024
47 Ga0070708_100140166 3300005445 Unclassified 2242
48 Ga0070663_100079612 3300005455 Unclassified 2405
49 Ga0070663_100590909 3300005455 Unclassified 933
50 Ga0070678_100260702 3300005456 Bacteria 1458
51 Ga0070678_100625169 3300005456 Bacteria 964
52 Ga0070678_100938361 3300005456 Bacteria 793
53 Ga0070662_100023747 3300005457 Unclassified 4216
54 Ga0070681_10000742 3300005458 Bacteria 27029
55 Ga0070681_10006264 3300005458 Bacteria 11575
56 Ga0070681_10030940 3300005458 Bacteria 5372
57 Ga0070681_10031801 3300005458 Bacteria 5297
58 Ga0070681_10048117 3300005458 Bacteria 4262
59 Ga0070681_10193952 3300005458 Bacteria 1950
60 Ga0070681_10259535 3300005458 Bacteria 1650
61 Ga0068867_100048752 3300005459 Bacteria 3117
62 Ga0070706_100190572 3300005467 Unclassified 1916
63 Ga0070706_100269086 3300005467 Bacteria 1590
64 Ga0070698_100071129 3300005471 Bacteria 3489
65 Ga0070699_100052879 3300005518 Unclassified 3514
66 Ga0070679_100001198 3300005530 Bacteria 22800
67 Ga0070679_100001800 3300005530 Bacteria 19333
68 Ga0070679_100057392 3300005530 Bacteria 3881
69 Ga0070679_100065382 3300005530 Bacteria 3625
70 Ga0070679_100371674 3300005530 Bacteria 1377
71 Ga0070684_100007598 3300005535 Bacteria 8448
72 Ga0070684_100018036 3300005535 Bacteria 5804
73 Ga0070684_100174186 3300005535 Bacteria 1955
74 Ga0070684_100272687 3300005535 Bacteria 1549
75 Ga0070684_100426639 3300005535 Unclassified 1224
76 Ga0070697_100081098 3300005536 Bacteria 2673
77 Ga0070697_100430601 3300005536 Bacteria 1147
78 Ga0068853_100013466 3300005539 Bacteria 6678
79 Ga0068853_100177354 3300005539 Bacteria 1931
80 Ga0070672_100011601 3300005543 Bacteria 6148
81 Ga0070686_101011918 3300005544 Unclassified 682
82 Ga0070695_100047460 3300005545 Bacteria 2743
83 Ga0070695_100068096 3300005545 Bacteria 2323
84 Ga0070695_100069982 3300005545 Bacteria 2294
85 Ga0070665_100003217 3300005548 Bacteria 17561
86 Ga0070665_100007522 3300005548 Bacteria 11076
87 Ga0070704_100208727 3300005549 Bacteria 1581
88 Ga0070704_100468586 3300005549 Bacteria 1088
89 Ga0068855_100000281 3300005563 Bacteria 62765
90 Ga0068855_100000783 3300005563 Bacteria 39276
91 Ga0068855_100039616 3300005563 Bacteria 5594
92 Ga0068855_100054213 3300005563 Bacteria 4713
93 Ga0070664_100012231 3300005564 Bacteria 6975
94 Ga0070664_100032621 3300005564 Bacteria 4356
95 Ga0070664_100032753 3300005564 Bacteria 4348
96 Ga0070664_100268609 3300005564 Unclassified 1536
97 Ga0070664_100379425 3300005564 Bacteria 1290
98 Ga0068857_100007230 3300005577 Bacteria 9562
99 Ga0068857_100331084 3300005577 Bacteria 1407
100 Ga0068854_100615114 3300005578 Bacteria 929
101 Ga0068854_100704820 3300005578 Unclassified 872
102 Ga0068856_100005153 3300005614 Bacteria 12902
103 Ga0068856_100022521 3300005614 Bacteria 6126
104 Ga0068856_100037785 3300005614 Bacteria 4738
105 Ga0068856_100285653 3300005614 Bacteria 1667
106 Ga0068856_100851306 3300005614 Bacteria 931
107 Ga0068856_101235354 3300005614 Unclassified 763
108 Ga0070702_100293043 3300005615 Bacteria 1122
109 Ga0070702_100340900 3300005615 Bacteria 1052
110 Ga0068852_100080182 3300005616 Bacteria 2893
111 Ga0068852_100138323 3300005616 Bacteria 2251
112 Ga0068852_101350580 3300005616 Bacteria 735
113 Ga0068859_100167194 3300005617 Bacteria 2279
114 Ga0068859_100581881 3300005617 Unclassified 1213
115 Ga0068859_101104545 3300005617 Unclassified 872
116 Ga0068864_100019215 3300005618 Bacteria 5711
117 Ga0068864_100079712 3300005618 Bacteria 2867
118 Ga0068864_100120874 3300005618 Unclassified 2342
119 Ga0068864_100187403 3300005618 Unclassified 1895
120 Ga0068864_100491027 3300005618 Bacteria 1180
121 Ga0068864_100755468 3300005618 Bacteria 953
122 Ga0068861_100127656 3300005719 Bacteria 2060
123 Ga0068851_10001141 3300005834 Bacteria 11502
124 Ga0068851_10052589 3300005834 Bacteria 2071
125 Ga0068851_10057285 3300005834 Bacteria 1989
126 Ga0068863_100135481 3300005841 Unclassified 2353
127 Ga0068863_100153726 3300005841 Bacteria 2202
128 Ga0068863_100707663 3300005841 Unclassified 1001
129 Ga0068863_101373398 3300005841 Unclassified 714
130 Ga0068858_100554407 3300005842 Bacteria 1113
131 Ga0068860_100193100 3300005843 Bacteria 1971
132 Ga0068860_100400754 3300005843 Unclassified 1357
133 Ga0068862_100657623 3300005844 Bacteria 1011
134 Ga0068862_100687349 3300005844 Bacteria 990
135 Ga0081539_10001725 3300005985 Bacteria 34954
136 Ga0070717_10190660 3300006028 Bacteria 1791
137 Ga0075368_10061282 3300006042 Bacteria 1506
138 Ga0075364_10090001 3300006051 Unclassified 2035
139 Ga0070716_100229065 3300006173 Bacteria 1253
140 Ga0070712_100726988 3300006175 Unclassified 848
141 Ga0075367_10004248 3300006178 Bacteria 6960
142 Ga0075367_10025597 3300006178 Unclassified 3338
143 Ga0075369_10109491 3300006186 Unclassified 1244
144 Ga0075366_10020594 3300006195 Bacteria 3829
145 Ga0097621_100000783 3300006237 Bacteria 22318
146 Ga0097621_100050385 3300006237 Bacteria 3386
147 Ga0097621_100070690 3300006237 Unclassified 2883
148 Ga0068871_100000132 3300006358 Bacteria 47573
149 Ga0068871_100037518 3300006358 Bacteria 3865
150 Ga0068871_100120364 3300006358 Bacteria 2217
151 Ga0075428_100114951 3300006844 Bacteria 2931
152 Ga0075428_100469179 3300006844 Bacteria 1348
153 Ga0075428_100656097 3300006844 Bacteria 1119
154 Ga0075430_100064557 3300006846 Unclassified 3076
155 Ga0075430_100808745 3300006846 Bacteria 772
156 Ga0075431_100029765 3300006847 Bacteria 5622
157 Ga0075431_100830997 3300006847 Bacteria 896
158 Ga0075434_100001375 3300006871 Bacteria 20407
159 Ga0075434_100001492 3300006871 Bacteria 19742
160 Ga0075434_100005453 3300006871 Bacteria 11590
161 Ga0075434_100024290 3300006871 Bacteria 5925
162 Ga0075434_100267626 3300006871 Bacteria 1728
163 Ga0075434_100862101 3300006871 Bacteria 921
164 Ga0075429_100042918 3300006880 Bacteria 3935
165 Ga0075436_100001848 3300006914 Bacteria 14530
166 Ga0075436_100005782 3300006914 Bacteria 8496
167 Ga0075436_100309727 3300006914 Bacteria 1133
168 Ga0097620_100012260 3300006931 Bacteria 8622
169 Ga0097620_100167195 3300006931 Bacteria 2279
170 Ga0097620_100581979 3300006931 Unclassified 1213
171 Ga0097620_101104424 3300006931 Unclassified 872
172 Ga0075435_100005603 3300007076 Bacteria 8791
173 Ga0075435_100011294 3300007076 Bacteria 6561
174 Ga0075435_100070059 3300007076 Bacteria 2861
175 Ga0075435_100088930 3300007076 Bacteria 2546
176 Ga0075435_100227590 3300007076 Bacteria 1584
177 Ga0105240_10004905 3300009093 Bacteria 20142
178 Ga0105240_10012417 3300009093 Bacteria 11760
179 Ga0105240_10015814 3300009093 Bacteria 10237
180 Ga0105240_10084823 3300009093 Bacteria 3883
181 Ga0105240_10295779 3300009093 Bacteria 1854
182 Ga0105240_10297115 3300009093 Bacteria 1849
183 Ga0105240_10654483 3300009093 Bacteria 1151
184 Ga0111539_10045659 3300009094 Bacteria 5244
185 Ga0105245_10034769 3300009098 Bacteria 4471
186 Ga0105245_10318553 3300009098 Unclassified 1531
187 Ga0105247_10084972 3300009101 Bacteria 2000
188 Ga0114129_10043785 3300009147 Bacteria 6299
189 Ga0114129_10259980 3300009147 Bacteria 2327
190 Ga0114129_11556513 3300009147 Unclassified 811
191 Ga0114129_12364683 3300009147 Unclassified 637
192 Ga0105243_10912551 3300009148 Unclassified 874
193 Ga0105241_10000255 3300009174 Bacteria 40062
194 Ga0105241_10018476 3300009174 Bacteria 5128
195 Ga0105241_10111873 3300009174 Bacteria 2187
196 Ga0105241_10123746 3300009174 Unclassified 2086
197 Ga0105241_10125752 3300009174 Bacteria 2070
198 Ga0105241_10244012 3300009174 Bacteria 1520
199 Ga0105241_11247570 3300009174 Unclassified 706
200 Ga0105242_10018944 3300009176 Bacteria 5390
201 Ga0105242_10406631 3300009176 Unclassified 1272
202 Ga0105248_10000847 3300009177 Bacteria 34381
203 Ga0105248_10003537 3300009177 Bacteria 17319
204 Ga0105248_10081917 3300009177 Bacteria 3628
205 Ga0105248_10740014 3300009177 Bacteria 1109
206 Ga0105237_10002898 3300009545 Bacteria 20810
207 Ga0105237_10055027 3300009545 Unclassified 3986
208 Ga0105237_10123029 3300009545 Unclassified 2589
209 Ga0105237_10235187 3300009545 Bacteria 1833
210 Ga0105237_10749235 3300009545 Unclassified 983
211 Ga0105238_10002796 3300009551 Bacteria 17420
212 Ga0105238_10008545 3300009551 Bacteria 10244
213 Ga0105238_10011972 3300009551 Bacteria 8739
214 Ga0105238_10058725 3300009551 Unclassified 3855
215 Ga0105238_10101289 3300009551 Bacteria 2863
216 Ga0105238_10107635 3300009551 Bacteria 2769
217 Ga0105238_10205671 3300009551 Bacteria 1944
218 Ga0105249_10108017 3300009553 Bacteria 2626
219 Ga0105239_10008084 3300010375 Bacteria 12007
220 Ga0105239_10212957 3300010375 Bacteria 2166
221 Ga0105239_10298067 3300010375 Bacteria 1815
222 Ga0105239_10424885 3300010375 Bacteria 1506
223 Ga0105246_10262557 3300011119 Unclassified 1376
224 Ga0157373_10069468 3300013100 Bacteria 2490
225 Ga0157373_10111409 3300013100 Bacteria 1924
226 Ga0157373_10186675 3300013100 Bacteria 1460
227 Ga0157371_10027236 3300013102 Bacteria 4147
228 Ga0157370_10033426 3300013104 Bacteria 5015
229 Ga0157370_10102457 3300013104 Bacteria 2680
230 Ga0157370_10150944 3300013104 Unclassified 2162
231 Ga0157369_10001237 3300013105 Bacteria 31846
232 Ga0157369_10002678 3300013105 Bacteria 21244
233 Ga0157369_10003219 3300013105 Bacteria 19462
234 Ga0157369_10005260 3300013105 Bacteria 15085
235 Ga0157369_10017865 3300013105 Bacteria 7961
236 Ga0157369_10020089 3300013105 Bacteria 7470
237 Ga0157369_10062208 3300013105 Bacteria 4023
238 Ga0157369_10192800 3300013105 Bacteria 2141
239 Ga0157374_10003648 3300013296 Bacteria 12954
240 Ga0157374_10011726 3300013296 Bacteria 7603
241 Ga0157374_10019352 3300013296 Bacteria 6025
242 Ga0157374_10036194 3300013296 Bacteria 4520
243 Ga0157374_10066196 3300013296 Unclassified 3396
244 Ga0157378_10000559 3300013297 Bacteria 35439
245 Ga0157378_10003149 3300013297 Bacteria 14664
246 Ga0157378_10055045 3300013297 Bacteria 3543
247 Ga0157378_11338003 3300013297 Unclassified 758
248 Ga0163162_10068836 3300013306 Bacteria 3591
249 Ga0163162_10194618 3300013306 Unclassified 2156
250 Ga0157372_10002335 3300013307 Bacteria 20543
251 Ga0157372_10009284 3300013307 Bacteria 10462
252 Ga0157372_10033697 3300013307 Bacteria 5627
253 Ga0157372_10035762 3300013307 Bacteria 5469
254 Ga0157372_10078094 3300013307 Unclassified 3740
255 Ga0157372_10097419 3300013307 Bacteria 3354
256 Ga0157372_10325328 3300013307 Bacteria 1790
257 Ga0157372_10715100 3300013307 Unclassified 1165
258 Ga0157372_10723943 3300013307 Bacteria 1157
259 Ga0157375_10257367 3300013308 Bacteria 1907
260 Ga0157375_10358794 3300013308 Unclassified 1624
261 Ga0157375_10422782 3300013308 Unclassified 1498
262 Ga0157375_12351293 3300013308 Unclassified 636
263 Ga0163163_10002925 3300014325 Bacteria 14448
264 Ga0157380_10250019 3300014326 Bacteria 1604
265 Ga0157380_10361529 3300014326 Bacteria 1362
266 Ga0157377_10234547 3300014745 Bacteria 1181
267 Ga0157379_10017988 3300014968 Bacteria 6229
268 Ga0157379_10057563 3300014968 Bacteria 3474
269 Ga0157376_10012083 3300014969 Bacteria 6393
270 Ga0157376_10029129 3300014969 Bacteria 4397
271 Ga0157376_10081389 3300014969 Unclassified 2780
272 Ga0157376_10168637 3300014969 Bacteria 1991
273 Ga0157376_10204662 3300014969 Bacteria 1819
274 Ga0182007_10042566 3300015262 Bacteria 1511
275 Ga0182007_10060683 3300015262 Bacteria 1239
276 Ga0207682_10096384 3300025893 Bacteria 1289
277 Ga0207705_10324215 3300025909 Unclassified 1184
278 Ga0207684_10000449 3300025910 Bacteria 54327
279 Ga0207684_10093788 3300025910 Unclassified 2560
280 Ga0207654_10048959 3300025911 Bacteria 2421
281 Ga0207654_10347043 3300025911 Unclassified 1021
282 Ga0207707_10004478 3300025912 Bacteria 12292
283 Ga0207707_10030351 3300025912 Bacteria 4729
284 Ga0207707_10031141 3300025912 Bacteria 4667
285 Ga0207707_10188944 3300025912 Bacteria 1797
286 Ga0207707_10699259 3300025912 Unclassified 851
287 Ga0207695_10016212 3300025913 Bacteria 8732
288 Ga0207695_10108114 3300025913 Bacteria 2766
289 Ga0207695_10225145 3300025913 Unclassified 1782
290 Ga0207695_10583722 3300025913 Unclassified 999
291 Ga0207671_10234218 3300025914 Bacteria 1441
292 Ga0207660_10000047 3300025917 Bacteria 60763
293 Ga0207660_10012709 3300025917 Bacteria 5514
294 Ga0207660_10015886 3300025917 Bacteria 4976
295 Ga0207660_10027712 3300025917 Unclassified 3870
296 Ga0207657_10003642 3300025919 Bacteria 16408
297 Ga0207649_10076766 3300025920 Bacteria 2151
298 Ga0207649_10094965 3300025920 Bacteria 1960
299 Ga0207652_10024523 3300025921 Bacteria 5005
300 Ga0207652_10037508 3300025921 Bacteria 4103
301 Ga0207652_10280837 3300025921 Bacteria 1502
302 Ga0207681_10685436 3300025923 Unclassified 851
303 Ga0207694_10004742 3300025924 Bacteria 10572
304 Ga0207694_10051542 3300025924 Bacteria 3189
305 Ga0207694_10184115 3300025924 Bacteria 1695
306 Ga0207694_10369070 3300025924 Unclassified 1190
307 Ga0207650_10012818 3300025925 Bacteria 5793
308 Ga0207650_10064268 3300025925 Bacteria 2746
309 Ga0207659_10091586 3300025926 Bacteria 2271
310 Ga0207687_10470541 3300025927 Unclassified 1045
311 Ga0207664_10111986 3300025929 Bacteria 2271
312 Ga0207690_10055030 3300025932 Bacteria 2678
313 Ga0207706_10041271 3300025933 Bacteria 4090
314 Ga0207686_10010923 3300025934 Bacteria 4954
315 Ga0207669_10397290 3300025937 Bacteria 1079
316 Ga0207691_10000645 3300025940 Bacteria 34491
317 Ga0207711_10192832 3300025941 Bacteria 1857
318 Ga0207711_10204247 3300025941 Bacteria 1804
319 Ga0207661_10001476 3300025944 Bacteria 15915
320 Ga0207661_10026587 3300025944 Bacteria 4412
321 Ga0207661_10035911 3300025944 Bacteria 3865
322 Ga0207661_10041341 3300025944 Bacteria 3629
323 Ga0207661_10231850 3300025944 Unclassified 1635
324 Ga0207661_10286179 3300025944 Unclassified 1474
325 Ga0207679_10038294 3300025945 Bacteria 3415
326 Ga0207679_10285730 3300025945 Unclassified 1416
327 Ga0207679_10599897 3300025945 Unclassified 992
328 Ga0207679_10658430 3300025945 Unclassified 948
329 Ga0207679_11562969 3300025945 Bacteria 605
330 Ga0207667_10000454 3300025949 Bacteria 54890
331 Ga0207667_10302538 3300025949 Unclassified 1634
332 Ga0207712_10000024 3300025961 Bacteria 275176
333 Ga0207712_10242527 3300025961 Bacteria 1452
334 Ga0207640_10033291 3300025981 Bacteria 3205
335 Ga0207677_10494736 3300026023 Bacteria 1056
336 Ga0207639_10139720 3300026041 Bacteria 2016
337 Ga0207678_10053620 3300026067 Bacteria 3475
338 Ga0207702_10000386 3300026078 Bacteria 50267
339 Ga0207641_10648971 3300026088 Unclassified 1036
340 Ga0207641_10708060 3300026088 Unclassified 992
341 Ga0207676_10090680 3300026095 Bacteria 2509
342 Ga0207676_10291852 3300026095 Bacteria 1485
343 Ga0207676_10612807 3300026095 Bacteria 1047
344 Ga0207676_10729568 3300026095 Unclassified 962
345 Ga0207674_10007454 3300026116 Bacteria 12753
346 Ga0207675_100010501 3300026118 Bacteria 8676
347 Ga0207675_100543848 3300026118 Unclassified 1160
348 Ga0207683_10057633 3300026121 Bacteria 3410
349 Ga0207698_10208673 3300026142 Bacteria 1756
350 Ga0207698_11258317 3300026142 Unclassified 754
351 Ga0207428_10040772 3300027907 Bacteria 3762
352 Ga0207428_10684362 3300027907 Bacteria 734
353 Ga0268266_10003606 3300028379 Bacteria 15311
354 Ga0268265_10095544 3300028380 Bacteria 2387
355 Ga0316182_1356899 3300030745 Unclassified 735
356 Ga0307411_10459398 3300032005 Bacteria 1067
357 Ga0373948_0001428 3300034817 Unclassified 3310
358 Ga0373958_0000328 3300034819 Bacteria 5734
359 Ga0373959_0048057 3300034820 Unclassified 914
360 Ga0373928_0000710 3300035084 Bacteria 6535
361 Ga0373940_0001183 3300035088 Bacteria 4592
362 Ga0373949_0001661 3300035090 Bacteria 6210
363 Ga0373951_0015166 3300035091 Unclassified 1734
364 Ga0373952_0017287 3300035092 Bacteria 1477
365 Ga0373932_0000105 3300035112 Bacteria 22910
366 Ga0373939_0000155 3300035114 Bacteria 19238
367 Ga0373941_0001447 3300035115 Bacteria 5014
368 Ga0373941_0170542 3300035115 Unclassified 811
369 Ga0373954_0017788 3300035118 Bacteria 3196
370 Ga0373956_0083002 3300035119 Bacteria 1472
371 Ga0373960_0004217 3300035121 Bacteria 3285
372 Ga0373942_0000246 3300035207 Bacteria 14335
373 Ga0373961_0000251 3300035241 Bacteria 24973
374 Ga0373962_0002298 3300035242 Unclassified 4564
375 Ga0373962_0165858 3300035242 Unclassified 731
376 Ga0373931_0012138 3300035691 Bacteria 4170
377 Ga0373935_0074617 3300035692 Bacteria 2193
378 Ga0373927_0000733 3300035695 Bacteria 25024
379 Ga0373927_0000918 3300035695 Bacteria 22374
380 Ga0373933_0280693 3300035724 Bacteria 1076
381 Ga0373937_0017037 3300036401 Bacteria 6463
382 Ga0373925_0542158 3300037068 Bacteria 956
383 Ga0395900_0856781 3300037418 Unclassified 834
384 Ga0395905_0088740 3300037471 Unclassified 2898
385 Ga0436364_1149820 3300037853 Bacteria 1959
386 Ga0436364_1158273 3300037853 Bacteria 1180
387 Ga0439455_0128366 3300042012 Bacteria 714
388 Ga0451576_0014552 3300045051 Bacteria 8747
389 Ga0451576_0200559 3300045051 Unclassified 2084
390 Ga0495651_0070923 3300046462 Bacteria 2650
391 Ga0495580_0002058 3300046472 Bacteria 17667
392 Ga0495669_0017696 3300046684 Bacteria 3060
393 Ga0495684_0221147 3300047471 Bacteria 1388
394 Ga0496102_0718843 3300048905 Unclassified 922
395 Ga0496104_0154199 3300048907 Bacteria 2205
396 Ga0496106_0348985 3300048909 Bacteria 1189
397 Ga0496106_0747292 3300048909 Bacteria 778
398 Ga0496107_0062598 3300048910 Unclassified 2696
399 Ga0496108_0469062 3300048911 Bacteria 1100
400 Ga0496112_0058406 3300048915 Unclassified 3799
401 Ga0496112_1367980 3300048915 Unclassified 623
402 Ga0496113_0215642 3300048916 Unclassified 1529
403 Ga0496114_0495829 3300048917 Bacteria 1080
404 Ga0496115_0018190 3300048918 Bacteria 5390
405 Ga0501032_0009328 3300049569 Bacteria 7107
406 Ga0501033_0004685 3300049570 Bacteria 10941
407 Ga0501034_0136827 3300049571 Bacteria 2430
408 Ga0501034_0182915 3300049571 Bacteria 2060
409 Ga0501036_0003560 3300049572 Bacteria 12453
410 Ga0501036_0062644 3300049572 Archaea 3150
411 Ga0501037_0248229 3300049573 Bacteria 1246
412 Ga0501038_0002143 3300049574 Bacteria 18325
413 Ga0501039_0004073 3300049575 Bacteria 10992
414 Ga0501039_0303833 3300049575 Bacteria 1254
415 Ga0501040_0147928 3300049576 Bacteria 1656
416 Ga0501041_0168271 3300049577 Bacteria 1371
417 Ga0501043_0001009 3300049579 Bacteria 24706
418 Ga0501043_0039734 3300049579 Unclassified 3698
419 Ga0501046_0003353 3300049580 Bacteria 14706
420 Ga0501046_0355357 3300049580 Bacteria 1063
421 Ga0501047_0010206 3300049581 Bacteria 8882
422 Ga0501047_0317035 3300049581 Bacteria 1399
423 Ga0501048_0033002 3300049582 Bacteria 3741
424 Ga0501048_0202844 3300049582 Bacteria 1406
425 Ga0501067_0007027 3300049583 Bacteria 6250
426 Ga0501067_0060948 3300049583 Bacteria 2088
427 Ga0501067_0392827 3300049583 Unclassified 773
428 Ga0501068_0001144 3300049584 Bacteria 14049
429 Ga0501068_0025912 3300049584 Bacteria 3451
430 Ga0501069_0000224 3300049585 Bacteria 25263
431 Ga0501069_0140086 3300049585 Bacteria 1387
432 Ga0501070_0041478 3300049586 Bacteria 3834
433 Ga0501071_0314459 3300049587 Bacteria 1188
434 Ga0501072_0000615 3300049588 Bacteria 25600
435 Ga0501073_0010747 3300049589 Bacteria 6702
436 Ga0501074_0012226 3300049590 Bacteria 6239
437 Ga0501076_0024999 3300049592 Bacteria 4619
438 Ga0501076_0030247 3300049592 Bacteria 4218
439 Ga0501225_0120624 3300049705 Bacteria 779
440 Ga0501079_0001949 3300049741 Bacteria 14779
441 Ga0501080_0004023 3300049742 Bacteria 13020
442 Ga0501080_0250924 3300049742 Bacteria 1613
443 Ga0501083_0001239 3300049744 Bacteria 17307
444 Ga0501083_0001244 3300049744 Bacteria 17296
445 Ga0501083_0293808 3300049744 Bacteria 1057
446 Ga0501035_0020904 3300049822 Bacteria 6014
447 Ga0501035_0431114 3300049822 Bacteria 1093
448 Ga0501044_0147327 3300049823 Bacteria 2338
449 Ga0501044_0274016 3300049823 Bacteria 1622
450 Ga0501045_0065561 3300049824 Bacteria 2666
451 nmdc:mga05p37_270131_c1 3300050507 Bacteria 2032
452 nmdc:mga05p37_333596_c1 3300050507 Unclassified 1790
453 nmdc:mga05p37_334606_c1 3300050507 Bacteria 1787
454 nmdc:mga09592_38962_c1 3300050508 Bacteria 3991
455 nmdc:mga0qj67_736051_c1 3300050509 Bacteria 783
456 nmdc:mga06r32_175182_c1 3300050510 Bacteria 2129
457 nmdc:mga06r32_23743_c1 3300050510 Bacteria 5679
458 nmdc:mga08y16_21737_c1 3300050511 Bacteria 6772
459 nmdc:mga08y16_9674_c1 3300050511 Bacteria 10120
460 nmdc:mga0n895_1289778_c1 3300050512 Bacteria 702
461 nmdc:mga0n895_58099_c1 3300050512 Bacteria 3814
462 nmdc:mga0rr50_180202_c1 3300050513 Unclassified 1093
463 nmdc:mga0rr50_227361_c1 3300050513 Bacteria 1543
464 nmdc:mga0rr50_61666_c1 3300050513 Bacteria 2826
465 nmdc:mga0a205_98006_c1 3300050515 Bacteria 2830
466 Ga0501084_0006680 3300054114 Bacteria 9486
467 Ga0501084_0074693 3300054114 Bacteria 2839
468 Ga0501082_0003459 3300060353 Bacteria 13776
469 Ga0501082_0008944 3300060353 Bacteria 8644
470 Ga0501082_0030070 3300060353 Bacteria 4680
471 Ga0501082_0204750 3300060353 Bacteria 1717
472 Ga0530510_0069895 3300061734 Bacteria 2548
473 Ga0587077_019158
474 Ga0065712_10088587
475 Ga0065707_10004825
476 Ga0070658_10125872
477 Ga0070683_100001514
478 Ga0070683_100017140
479 Ga0070683_100026500
480 Ga0070683_100058191
481 Ga0070683_100179877
482 Ga0070683_100238132
483 Ga0070670_100005263
484 Ga0070670_100008828
485 Ga0070677_10144543
486 Ga0070677_10470361
487 Ga0070666_10611164
488 Ga0070680_100000044
489 Ga0070680_100004652
490 Ga0070680_100008882
491 Ga0070680_100020802
492 Ga0070680_100337663
493 Ga0070682_100078562
494 Ga0070682_100243898
495 Ga0070682_100275863
496 Ga0068868_100047489
497 Ga0068868_100787458
498 Ga0070660_100042274
499 Ga0070689_100188330
500 Ga0070691_10034651
501 Ga0070691_10059935
502 Ga0070692_10595451
503 Ga0070675_100084880
504 Ga0070673_100392575
505 Ga0070659_100255250
506 Ga0070667_100106257
507 Ga0070667_100263694
508 Ga0070703_10005986
509 Ga0070714_100008240
510 Ga0070714_100050860
511 Ga0070714_100084145
512 Ga0070711_100074418
513 Ga0070705_100000905
514 Ga0070700_100000079
515 Ga0070700_100101915
516 Ga0070700_100565721
517 Ga0070694_100000950
518 Ga0070694_100102726
519 Ga0070708_100140166
520 Ga0070663_100079612
521 Ga0070663_100590909
522 Ga0070678_100260702
523 Ga0070678_100625169
524 Ga0070678_100938361
525 Ga0070662_100023747
526 Ga0070681_10000742
527 Ga0070681_10006264
528 Ga0070681_10030940
529 Ga0070681_10031801
530 Ga0070681_10048117
531 Ga0070681_10193952
532 Ga0070681_10259535
533 Ga0068867_100048752
534 Ga0070706_100190572
535 Ga0070706_100269086
536 Ga0070698_100071129
537 Ga0070699_100052879
538 Ga0070679_100001198
539 Ga0070679_100001800
540 Ga0070679_100057392
541 Ga0070679_100065382
542 Ga0070679_100371674
543 Ga0070684_100007598
544 Ga0070684_100018036
545 Ga0070684_100174186
546 Ga0070684_100272687
547 Ga0070684_100426639
548 Ga0070697_100081098
549 Ga0070697_100430601
550 Ga0068853_100013466
551 Ga0068853_100177354
552 Ga0070672_100011601
553 Ga0070686_101011918
554 Ga0070695_100047460
555 Ga0070695_100068096
556 Ga0070695_100069982
557 Ga0070665_100003217
558 Ga0070665_100007522
559 Ga0070704_100208727
560 Ga0070704_100468586
561 Ga0068855_100000281
562 Ga0068855_100000783
563 Ga0068855_100039616
564 Ga0068855_100054213
565 Ga0070664_100012231
566 Ga0070664_100032621
567 Ga0070664_100032753
568 Ga0070664_100268609
569 Ga0070664_100379425
570 Ga0068857_100007230
571 Ga0068857_100331084
572 Ga0068854_100615114
573 Ga0068854_100704820
574 Ga0068856_100005153
575 Ga0068856_100022521
576 Ga0068856_100037785
577 Ga0068856_100285653
578 Ga0068856_100851306
579 Ga0068856_101235354
580 Ga0070702_100293043
581 Ga0070702_100340900
582 Ga0068852_100080182
583 Ga0068852_100138323
584 Ga0068852_101350580
585 Ga0068859_100167194
586 Ga0068859_100581881
587 Ga0068859_101104545
588 Ga0068864_100019215
589 Ga0068864_100079712
590 Ga0068864_100120874
591 Ga0068864_100187403
592 Ga0068864_100491027
593 Ga0068864_100755468
594 Ga0068861_100127656
595 Ga0068851_10001141
596 Ga0068851_10052589
597 Ga0068851_10057285
598 Ga0068863_100135481
599 Ga0068863_100153726
600 Ga0068863_100707663
601 Ga0068863_101373398
602 Ga0068858_100554407
603 Ga0068860_100193100
604 Ga0068860_100400754
605 Ga0068862_100657623
606 Ga0068862_100687349
607 Ga0081539_10001725
608 Ga0070717_10190660
609 Ga0075368_10061282
610 Ga0075364_10090001
611 Ga0070716_100229065
612 Ga0070712_100726988
613 Ga0075367_10004248
614 Ga0075367_10025597
615 Ga0075369_10109491
616 Ga0075366_10020594
617 Ga0097621_100000783
618 Ga0097621_100050385
619 Ga0097621_100070690
620 Ga0068871_100000132
621 Ga0068871_100037518
622 Ga0068871_100120364
623 Ga0075428_100114951
624 Ga0075428_100469179
625 Ga0075428_100656097
626 Ga0075430_100064557
627 Ga0075430_100808745
628 Ga0075431_100029765
629 Ga0075431_100830997
630 Ga0075434_100001375
631 Ga0075434_100001492
632 Ga0075434_100005453
633 Ga0075434_100024290
634 Ga0075434_100267626
635 Ga0075434_100862101
636 Ga0075429_100042918
637 Ga0075436_100001848
638 Ga0075436_100005782
639 Ga0075436_100309727
640 Ga0097620_100012260
641 Ga0097620_100167195
642 Ga0097620_100581979
643 Ga0097620_101104424
644 Ga0075435_100005603
645 Ga0075435_100011294
646 Ga0075435_100070059
647 Ga0075435_100088930
648 Ga0075435_100227590
649 Ga0105240_10004905
650 Ga0105240_10012417
651 Ga0105240_10015814
652 Ga0105240_10084823
653 Ga0105240_10295779
654 Ga0105240_10297115
655 Ga0105240_10654483
656 Ga0111539_10045659
657 Ga0105245_10034769
658 Ga0105245_10318553
659 Ga0105247_10084972
660 Ga0114129_10043785
661 Ga0114129_10259980
662 Ga0114129_11556513
663 Ga0114129_12364683
664 Ga0105243_10912551
665 Ga0105241_10000255
666 Ga0105241_10018476
667 Ga0105241_10111873
668 Ga0105241_10123746
669 Ga0105241_10125752
670 Ga0105241_10244012
671 Ga0105241_11247570
672 Ga0105242_10018944
673 Ga0105242_10406631
674 Ga0105248_10000847
675 Ga0105248_10003537
676 Ga0105248_10081917
677 Ga0105248_10740014
678 Ga0105237_10002898
679 Ga0105237_10055027
680 Ga0105237_10123029
681 Ga0105237_10235187
682 Ga0105237_10749235
683 Ga0105238_10002796
684 Ga0105238_10008545
685 Ga0105238_10011972
686 Ga0105238_10058725
687 Ga0105238_10101289
688 Ga0105238_10107635
689 Ga0105238_10205671
690 Ga0105249_10108017
691 Ga0105239_10008084
692 Ga0105239_10212957
693 Ga0105239_10298067
694 Ga0105239_10424885
695 Ga0105246_10262557
696 Ga0157373_10069468
697 Ga0157373_10111409
698 Ga0157373_10186675
699 Ga0157371_10027236
700 Ga0157370_10033426
701 Ga0157370_10102457
702 Ga0157370_10150944
703 Ga0157369_10001237
704 Ga0157369_10002678
705 Ga0157369_10003219
706 Ga0157369_10005260
707 Ga0157369_10017865
708 Ga0157369_10020089
709 Ga0157369_10062208
710 Ga0157369_10192800
711 Ga0157374_10003648
712 Ga0157374_10011726
713 Ga0157374_10019352
714 Ga0157374_10036194
715 Ga0157374_10066196
716 Ga0157378_10000559
717 Ga0157378_10003149
718 Ga0157378_10055045
719 Ga0157378_11338003
720 Ga0163162_10068836
721 Ga0163162_10194618
722 Ga0157372_10002335
723 Ga0157372_10009284
724 Ga0157372_10033697
725 Ga0157372_10035762
726 Ga0157372_10078094
727 Ga0157372_10097419
728 Ga0157372_10325328
729 Ga0157372_10715100
730 Ga0157372_10723943
731 Ga0157375_10257367
732 Ga0157375_10358794
733 Ga0157375_10422782
734 Ga0157375_12351293
735 Ga0163163_10002925
736 Ga0157380_10250019
737 Ga0157380_10361529
738 Ga0157377_10234547
739 Ga0157379_10017988
740 Ga0157379_10057563
741 Ga0157376_10012083
742 Ga0157376_10029129
743 Ga0157376_10081389
744 Ga0157376_10168637
745 Ga0157376_10204662
746 Ga0182007_10042566
747 Ga0182007_10060683
748 Ga0207682_10096384
749 Ga0207705_10324215
750 Ga0207684_10000449
751 Ga0207684_10093788
752 Ga0207654_10048959
753 Ga0207654_10347043
754 Ga0207707_10004478
755 Ga0207707_10030351
756 Ga0207707_10031141
757 Ga0207707_10188944
758 Ga0207707_10699259
759 Ga0207695_10016212
760 Ga0207695_10108114
761 Ga0207695_10225145
762 Ga0207695_10583722
763 Ga0207671_10234218
764 Ga0207660_10000047
765 Ga0207660_10012709
766 Ga0207660_10015886
767 Ga0207660_10027712
768 Ga0207657_10003642
769 Ga0207649_10076766
770 Ga0207649_10094965
771 Ga0207652_10024523
772 Ga0207652_10037508
773 Ga0207652_10280837
774 Ga0207681_10685436
775 Ga0207694_10004742
776 Ga0207694_10051542
777 Ga0207694_10184115
778 Ga0207694_10369070
779 Ga0207650_10012818
780 Ga0207650_10064268
781 Ga0207659_10091586
782 Ga0207687_10470541
783 Ga0207664_10111986
784 Ga0207690_10055030
785 Ga0207706_10041271
786 Ga0207686_10010923
787 Ga0207669_10397290
788 Ga0207691_10000645
789 Ga0207711_10192832
790 Ga0207711_10204247
791 Ga0207661_10001476
792 Ga0207661_10026587
793 Ga0207661_10035911
794 Ga0207661_10041341
795 Ga0207661_10231850
796 Ga0207661_10286179
797 Ga0207679_10038294
798 Ga0207679_10285730
799 Ga0207679_10599897
800 Ga0207679_10658430
801 Ga0207679_11562969
802 Ga0207667_10000454
803 Ga0207667_10302538
804 Ga0207712_10000024
805 Ga0207712_10242527
806 Ga0207640_10033291
807 Ga0207677_10494736
808 Ga0207639_10139720
809 Ga0207678_10053620
810 Ga0207702_10000386
811 Ga0207641_10648971
812 Ga0207641_10708060
813 Ga0207676_10090680
814 Ga0207676_10291852
815 Ga0207676_10612807
816 Ga0207676_10729568
817 Ga0207674_10007454
818 Ga0207675_100010501
819 Ga0207675_100543848
820 Ga0207683_10057633
821 Ga0207698_10208673
822 Ga0207698_11258317
823 Ga0207428_10040772
824 Ga0207428_10684362
825 Ga0268266_10003606
826 Ga0268265_10095544
827 Ga0316182_1356899
828 Ga0307411_10459398
829 Ga0373948_0001428
830 Ga0373958_0000328
831 Ga0373959_0048057
832 Ga0373928_0000710
833 Ga0373940_0001183
834 Ga0373949_0001661
835 Ga0373951_0015166
836 Ga0373952_0017287
837 Ga0373932_0000105
838 Ga0373939_0000155
839 Ga0373941_0001447
840 Ga0373941_0170542
841 Ga0373954_0017788
842 Ga0373956_0083002
843 Ga0373960_0004217
844 Ga0373942_0000246
845 Ga0373961_0000251
846 Ga0373962_0002298
847 Ga0373962_0165858
848 Ga0373931_0012138
849 Ga0373935_0074617
850 Ga0373927_0000733
851 Ga0373927_0000918
852 Ga0373933_0280693
853 Ga0373937_0017037
854 Ga0373925_0542158
855 Ga0395900_0856781
856 Ga0395905_0088740
857 Ga0436364_1149820
858 Ga0436364_1158273
859 Ga0439455_0128366
860 Ga0451576_0014552
861 Ga0451576_0200559
862 Ga0495651_0070923
863 Ga0495580_0002058
864 Ga0495669_0017696
865 Ga0495684_0221147
866 Ga0496102_0718843
867 Ga0496104_0154199
868 Ga0496106_0348985
869 Ga0496106_0747292
870 Ga0496107_0062598
871 Ga0496108_0469062
872 Ga0496112_0058406
873 Ga0496112_1367980
874 Ga0496113_0215642
875 Ga0496114_0495829
876 Ga0496115_0018190
877 Ga0501032_0009328
878 Ga0501033_0004685
879 Ga0501034_0136827
880 Ga0501034_0182915
881 Ga0501036_0003560
882 Ga0501036_0062644
883 Ga0501037_0248229
884 Ga0501038_0002143
885 Ga0501039_0004073
886 Ga0501039_0303833
887 Ga0501040_0147928
888 Ga0501041_0168271
889 Ga0501043_0001009
890 Ga0501043_0039734
891 Ga0501046_0003353
892 Ga0501046_0355357
893 Ga0501047_0010206
894 Ga0501047_0317035
895 Ga0501048_0033002
896 Ga0501048_0202844
897 Ga0501067_0007027
898 Ga0501067_0060948
899 Ga0501067_0392827
900 Ga0501068_0001144
901 Ga0501068_0025912
902 Ga0501069_0000224
903 Ga0501069_0140086
904 Ga0501070_0041478
905 Ga0501071_0314459
906 Ga0501072_0000615
907 Ga0501073_0010747
908 Ga0501074_0012226
909 Ga0501076_0024999
910 Ga0501076_0030247
911 Ga0501225_0120624
912 Ga0501079_0001949
913 Ga0501080_0004023
914 Ga0501080_0250924
915 Ga0501083_0001239
916 Ga0501083_0001244
917 Ga0501083_0293808
918 Ga0501035_0020904
919 Ga0501035_0431114
920 Ga0501044_0147327
921 Ga0501044_0274016
922 Ga0501045_0065561
923 nmdc:mga05p37_270131_c1
924 nmdc:mga05p37_333596_c1
925 nmdc:mga05p37_334606_c1
926 nmdc:mga09592_38962_c1
927 nmdc:mga0qj67_736051_c1
928 nmdc:mga06r32_175182_c1
929 nmdc:mga06r32_23743_c1
930 nmdc:mga08y16_21737_c1
931 nmdc:mga08y16_9674_c1
932 nmdc:mga0n895_1289778_c1
933 nmdc:mga0n895_58099_c1
934 nmdc:mga0rr50_180202_c1
935 nmdc:mga0rr50_227361_c1
936 nmdc:mga0rr50_61666_c1
937 nmdc:mga0a205_98006_c1
938 Ga0501084_0006680
939 Ga0501084_0074693
940 Ga0501082_0003459
941 Ga0501082_0008944
942 Ga0501082_0030070
943 Ga0501082_0204750
944 Ga0530510_0069895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

17

179

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8404 26 168
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8131 25 161
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8081 24 159
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7994 26 168
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7916 24 158
ID Description Score Start End Superfamily
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8268 24 168 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8009 24 168 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7766 25 159 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7733 19 158 1.20.120.450
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7613 20 160 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7C5UV12-F1-model_v4 DinB-like domain-containing protein 0.9897 4 145
AF-A0A7C5UV12-F1-model_v4 DinB-like domain-containing protein 0.9693 4 145
AF-A0A321M0X4-F1-model_v4 Damage-inducible protein DinB 0.9581 5 191
AF-A0A7W1JRJ8-F1-model_v4 DinB family protein 0.955 5 147
AF-A0A3N5GXQ3-F1-model_v4 DinB family protein 0.9534 25 173

Map