F450910

General Info

Members Datasets Scaffolds Average Seq Length
472 227 944 226

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_4431_c1|nmdc:mga00v17_4431_c1_3862_4605
Length 247
Sequence MTEKYKRAAGGDAAAGADRCAVLFSAGLDSAVLAADALRRGRVYPIYVGVGFAWEDEERAMAARLLAAAPFAGRAETLAALSFDMRDIFPPTHWAVRGEPPAFDTPDEDVYIHGRNVILASKAAVHLSRIVRAGDASPGDPARLLMGTLAGNPFPDATPEFFSSMSRALSLGLDTAIAVDAPFAALHKSDVIRKGVELGVPLELTLSCMQPKDGLHCGQCSKCRERRDAFRDAGVSDPTKYRRTPVR

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
159 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
160 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
161 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.81
Nodule 0
Rhizoplane 2.33
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 23.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_4431_c1 3300050491 Bacteria 7308
2 MRS1b_contig_1466471 2162886011 Bacteria 817
3 MBSR1b_contig_9829774 2162886012 Bacteria 916
4 Ga0065712_10075982 3300005290 Bacteria 3752
5 Ga0065712_10080914 3300005290 Bacteria 3058
6 Ga0065712_10086258 3300005290 Bacteria 2646
7 Ga0065715_10003874 3300005293 Bacteria 7068
8 Ga0065715_10017156 3300005293 Bacteria 2258
9 Ga0065715_10097690 3300005293 Bacteria 3664
10 Ga0065715_10105055 3300005293 Bacteria 2918
11 Ga0065707_10096888 3300005295 Bacteria 3224
12 Ga0065707_10228185 3300005295 Unclassified 1198
13 Ga0070676_10014044 3300005328 Bacteria 4394
14 Ga0070676_10039226 3300005328 Unclassified 2738
15 Ga0070683_100000395 3300005329 Bacteria 30161
16 Ga0070683_100017752 3300005329 Bacteria 6287
17 Ga0070690_100068024 3300005330 Bacteria 2309
18 Ga0070690_100153579 3300005330 Bacteria 1572
19 Ga0070690_100176100 3300005330 Unclassified 1475
20 Ga0070670_100110851 3300005331 Unclassified 2364
21 Ga0070670_100279702 3300005331 Bacteria 1457
22 Ga0070677_10015861 3300005333 Unclassified 2674
23 Ga0070677_10061529 3300005333 Bacteria 1550
24 Ga0070677_10200771 3300005333 Unclassified 962
25 Ga0068869_100060129 3300005334 Bacteria 2784
26 Ga0068869_100078758 3300005334 Bacteria 2455
27 Ga0068869_100230281 3300005334 Bacteria 1472
28 Ga0068869_100284154 3300005334 Bacteria 1331
29 Ga0070666_10028129 3300005335 Unclassified 3687
30 Ga0070666_10227508 3300005335 Unclassified 1317
31 Ga0070666_10490491 3300005335 Unclassified 890
32 Ga0070680_100411143 3300005336 Unclassified 1154
33 Ga0068868_100103671 3300005338 Unclassified 2304
34 Ga0068868_100279410 3300005338 Bacteria 1413
35 Ga0070689_100302589 3300005340 Bacteria 1331
36 Ga0070691_10040503 3300005341 Unclassified 2202
37 Ga0070691_10182902 3300005341 Bacteria 1092
38 Ga0070661_100312828 3300005344 Unclassified 1225
39 Ga0070692_10238141 3300005345 Bacteria 1083
40 Ga0070668_100062255 3300005347 Unclassified 2890
41 Ga0070669_100002308 3300005353 Bacteria 13809
42 Ga0070669_100014791 3300005353 Bacteria 5556
43 Ga0070669_100121831 3300005353 Bacteria 1991
44 Ga0070669_100143185 3300005353 Bacteria 1845
45 Ga0070669_100143895 3300005353 Bacteria 1840
46 Ga0070675_100015303 3300005354 Bacteria 6062
47 Ga0070675_100018059 3300005354 Bacteria 5614
48 Ga0070675_100035997 3300005354 Bacteria 4026
49 Ga0070675_100064513 3300005354 Unclassified 3028
50 Ga0070671_100021679 3300005355 Bacteria 5247
51 Ga0070671_100038945 3300005355 Bacteria 3945
52 Ga0070671_100114587 3300005355 Unclassified 2266
53 Ga0070674_100000507 3300005356 Bacteria 19580
54 Ga0070674_100183992 3300005356 Bacteria 1602
55 Ga0070674_100211136 3300005356 Bacteria 1504
56 Ga0070673_100010372 3300005364 Bacteria 6306
57 Ga0070673_100231064 3300005364 Bacteria 1604
58 Ga0070673_100361646 3300005364 Unclassified 1290
59 Ga0070688_100017592 3300005365 Bacteria 4105
60 Ga0070659_100194764 3300005366 Bacteria 1667
61 Ga0070667_100069767 3300005367 Bacteria 2991
62 Ga0070667_100335436 3300005367 Bacteria 1367
63 Ga0070667_100398094 3300005367 Unclassified 1253
64 Ga0070701_10005534 3300005438 Bacteria 5226
65 Ga0070701_10158035 3300005438 Bacteria 1311
66 Ga0070705_100004223 3300005440 Bacteria 7013
67 Ga0070700_100004667 3300005441 Bacteria 7180
68 Ga0070694_100101562 3300005444 Unclassified 2035
69 Ga0070694_100134723 3300005444 Bacteria 1789
70 Ga0070694_100246446 3300005444 Unclassified 1350
71 Ga0070694_100625862 3300005444 Bacteria 869
72 Ga0070678_100045235 3300005456 Archaea 3148
73 Ga0070678_100087307 3300005456 Bacteria 2382
74 Ga0070678_100110102 3300005456 Unclassified 2153
75 Ga0070662_100016546 3300005457 Unclassified 4953
76 Ga0070662_100030899 3300005457 Bacteria 3753
77 Ga0070662_100087789 3300005457 Bacteria 2329
78 Ga0070681_10117990 3300005458 Bacteria 2590
79 Ga0070681_10308734 3300005458 Bacteria 1491
80 Ga0068867_100007288 3300005459 Bacteria 7826
81 Ga0068867_100572864 3300005459 Unclassified 981
82 Ga0070698_100042393 3300005471 Bacteria 4668
83 Ga0070699_100457064 3300005518 Bacteria 1158
84 Ga0070684_100000197 3300005535 Bacteria 42219
85 Ga0070684_100151110 3300005535 Bacteria 2104
86 Ga0070672_100021193 3300005543 Bacteria 4751
87 Ga0070686_100006076 3300005544 Bacteria 6701
88 Ga0070686_100157450 3300005544 Bacteria 1596
89 Ga0070686_100436587 3300005544 Bacteria 1003
90 Ga0070665_100009004 3300005548 Bacteria 10108
91 Ga0070665_101018745 3300005548 Unclassified 840
92 Ga0070704_100112708 3300005549 Unclassified 2073
93 Ga0068855_100390674 3300005563 Bacteria 1526
94 Ga0068855_100877701 3300005563 Bacteria 949
95 Ga0070664_100001737 3300005564 Bacteria 17434
96 Ga0070664_100014724 3300005564 Bacteria 6387
97 Ga0070664_100774809 3300005564 Bacteria 896
98 Ga0068857_100067025 3300005577 Unclassified 3194
99 Ga0068857_100283575 3300005577 Bacteria 1524
100 Ga0068854_100083755 3300005578 Bacteria 2358
101 Ga0068856_100250004 3300005614 Bacteria 1788
102 Ga0070702_100031806 3300005615 Bacteria 2890
103 Ga0070702_100173369 3300005615 Bacteria 1405
104 Ga0068852_100269311 3300005616 Unclassified 1638
105 Ga0068852_100353761 3300005616 Bacteria 1435
106 Ga0068859_100021479 3300005617 Bacteria 6480
107 Ga0068859_100067504 3300005617 Bacteria 3610
108 Ga0068859_100584261 3300005617 Bacteria 1211
109 Ga0068864_100186755 3300005618 Bacteria 1898
110 Ga0068864_100190885 3300005618 Bacteria 1878
111 Ga0068866_10243388 3300005718 Bacteria 1097
112 Ga0068861_100001696 3300005719 Bacteria 14142
113 Ga0068861_100068019 3300005719 Unclassified 2751
114 Ga0068861_100785163 3300005719 Bacteria 892
115 Ga0068870_10000982 3300005840 Bacteria 11253
116 Ga0068863_100138932 3300005841 Unclassified 2322
117 Ga0068863_100690004 3300005841 Unclassified 1014
118 Ga0068863_100738592 3300005841 Unclassified 980
119 Ga0068860_100020837 3300005843 Archaea 6351
120 Ga0068860_100128572 3300005843 Unclassified 2429
121 Ga0068860_100296913 3300005843 Unclassified 1582
122 Ga0068862_100013478 3300005844 Bacteria 6768
123 Ga0068862_100031034 3300005844 Bacteria 4507
124 Ga0068862_100138279 3300005844 Unclassified 2160
125 Ga0068862_100149247 3300005844 Bacteria 2080
126 Ga0075365_10001292 3300006038 Bacteria 11157
127 Ga0075368_10053118 3300006042 Bacteria 1612
128 Ga0075364_10031462 3300006051 Bacteria 3409
129 Ga0075364_10054053 3300006051 Bacteria 2625
130 Ga0075364_10134985 3300006051 Bacteria 1657
131 Ga0075432_10023448 3300006058 Unclassified 2114
132 Ga0075366_10004783 3300006195 Bacteria 7301
133 Ga0075366_10030120 3300006195 Bacteria 3189
134 Ga0097621_100386460 3300006237 Bacteria 1251
135 Ga0075370_10005334 3300006353 Bacteria 6374
136 Ga0068871_100231272 3300006358 Archaea 1604
137 Ga0075428_100001181 3300006844 Bacteria 27942
138 Ga0075428_100022556 3300006844 Bacteria 6969
139 Ga0075428_100026652 3300006844 Bacteria 6399
140 Ga0075428_100048883 3300006844 Unclassified 4641
141 Ga0075428_100258352 3300006844 Unclassified 1876
142 Ga0075428_100462901 3300006844 Bacteria 1358
143 Ga0075428_100500413 3300006844 Bacteria 1300
144 Ga0075428_100717916 3300006844 Bacteria 1064
145 Ga0075428_100936291 3300006844 Unclassified 918
146 Ga0075428_101034123 3300006844 Unclassified 869
147 Ga0075430_100001472 3300006846 Bacteria 19177
148 Ga0075430_100007631 3300006846 Bacteria 9138
149 Ga0075430_100062277 3300006846 Bacteria 3134
150 Ga0075430_100091917 3300006846 Bacteria 2537
151 Ga0075430_100238273 3300006846 Bacteria 1508
152 Ga0075430_100298668 3300006846 Bacteria 1332
153 Ga0075431_100000025 3300006847 Bacteria 79014
154 Ga0075431_100016073 3300006847 Bacteria 7595
155 Ga0075431_100045601 3300006847 Bacteria 4520
156 Ga0075431_100235481 3300006847 Bacteria 1864
157 Ga0075431_100843742 3300006847 Bacteria 888
158 Ga0075433_10026638 3300006852 Bacteria 4898
159 Ga0075433_10118398 3300006852 Bacteria 2351
160 Ga0075434_100000296 3300006871 Bacteria 35351
161 Ga0075434_100292880 3300006871 Bacteria 1648
162 Ga0075434_100300857 3300006871 Unclassified 1625
163 Ga0075429_100003176 3300006880 Bacteria 13965
164 Ga0075429_100038360 3300006880 Bacteria 4170
165 Ga0075429_100041221 3300006880 Bacteria 4021
166 Ga0075429_100046967 3300006880 Unclassified 3757
167 Ga0075429_100066141 3300006880 Unclassified 3147
168 Ga0075429_100187460 3300006880 Unclassified 1813
169 Ga0075429_100302170 3300006880 Bacteria 1401
170 Ga0097620_100021478 3300006931 Bacteria 6480
171 Ga0097620_100067506 3300006931 Bacteria 3610
172 Ga0097620_100584305 3300006931 Bacteria 1211
173 Ga0075435_100007712 3300007076 Bacteria 7694
174 Ga0075435_100024830 3300007076 Bacteria 4658
175 Ga0105240_10044771 3300009093 Bacteria 5619
176 Ga0105240_10187194 3300009093 Bacteria 2437
177 Ga0105240_10849850 3300009093 Bacteria 985
178 Ga0111539_10002921 3300009094 Bacteria 22662
179 Ga0111539_10003361 3300009094 Bacteria 21115
180 Ga0111539_10004354 3300009094 Bacteria 18543
181 Ga0111539_10009038 3300009094 Bacteria 12610
182 Ga0111539_10009686 3300009094 Bacteria 12159
183 Ga0111539_10015788 3300009094 Bacteria 9381
184 Ga0111539_10573154 3300009094 Unclassified 1315
185 Ga0111539_10922755 3300009094 Bacteria 1015
186 Ga0105245_10031695 3300009098 Bacteria 4679
187 Ga0105245_10426027 3300009098 Bacteria 1331
188 Ga0105247_10006975 3300009101 Bacteria 6953
189 Ga0105247_10135535 3300009101 Bacteria 1608
190 Ga0114129_10000400 3300009147 Bacteria 50737
191 Ga0114129_10009548 3300009147 Bacteria 13840
192 Ga0114129_10013816 3300009147 Bacteria 11504
193 Ga0114129_10025118 3300009147 Bacteria 8445
194 Ga0114129_10057037 3300009147 Bacteria 5468
195 Ga0114129_10111712 3300009147 Bacteria 3770
196 Ga0114129_10275178 3300009147 Bacteria 2251
197 Ga0114129_10502206 3300009147 Viruses 1584
198 Ga0114129_10934449 3300009147 Bacteria 1097
199 Ga0105243_10771181 3300009148 Bacteria 945
200 Ga0105243_11008635 3300009148 Bacteria 835
201 Ga0105241_10123146 3300009174 Bacteria 2091
202 Ga0105242_10019305 3300009176 Bacteria 5340
203 Ga0105248_10016637 3300009177 Bacteria 8095
204 Ga0105248_10130254 3300009177 Unclassified 2838
205 Ga0105248_10229303 3300009177 Bacteria 2091
206 Ga0105249_10001419 3300009553 Bacteria 20973
207 Ga0105249_10037938 3300009553 Unclassified 4372
208 Ga0105249_10422032 3300009553 Bacteria 1368
209 Ga0105249_10602267 3300009553 Bacteria 1153
210 Ga0157370_10286226 3300013104 Bacteria 1523
211 Ga0157374_10039780 3300013296 Unclassified 4328
212 Ga0163162_10037307 3300013306 Bacteria 4849
213 Ga0157372_10383967 3300013307 Bacteria 1636
214 Ga0157375_10134489 3300013308 Unclassified 2594
215 Ga0157375_10861929 3300013308 Bacteria 1052
216 Ga0163163_10059746 3300014325 Bacteria 3772
217 Ga0157380_10025239 3300014326 Unclassified 4505
218 Ga0157380_10057728 3300014326 Bacteria 3092
219 Ga0157380_10062795 3300014326 Bacteria 2977
220 Ga0157377_10009715 3300014745 Bacteria 4734
221 Ga0157377_10017764 3300014745 Bacteria 3686
222 Ga0157377_10261680 3300014745 Bacteria 1126
223 Ga0157379_10003949 3300014968 Bacteria 12646
224 Ga0157379_10018828 3300014968 Bacteria 6090
225 Ga0157379_10056777 3300014968 Bacteria 3498
226 Ga0157376_10234730 3300014969 Bacteria 1705
227 Ga0157376_10351607 3300014969 Bacteria 1410
228 Ga0163161_10019094 3300017792 Unclassified 4805
229 Ga0163161_10513286 3300017792 Bacteria 978
230 Ga0207697_10001052 3300025315 Bacteria 15230
231 Ga0207697_10035654 3300025315 Bacteria 2037
232 Ga0207682_10000114 3300025893 Bacteria 37193
233 Ga0207682_10004533 3300025893 Bacteria 5790
234 Ga0207682_10006191 3300025893 Bacteria 4835
235 Ga0207710_10018656 3300025900 Bacteria 2953
236 Ga0207688_10000023 3300025901 Bacteria 49264
237 Ga0207680_10078436 3300025903 Unclassified 2068
238 Ga0207645_10001465 3300025907 Bacteria 19281
239 Ga0207645_10006528 3300025907 Bacteria 8355
240 Ga0207643_10000592 3300025908 Bacteria 22990
241 Ga0207654_10224065 3300025911 Bacteria 1249
242 Ga0207695_10118735 3300025913 Bacteria 2615
243 Ga0207662_10003205 3300025918 Bacteria 8372
244 Ga0207662_10038317 3300025918 Unclassified 2808
245 Ga0207657_10732592 3300025919 Unclassified 767
246 Ga0207649_10004649 3300025920 Bacteria 7431
247 Ga0207681_10003552 3300025923 Bacteria 9710
248 Ga0207681_10024319 3300025923 Bacteria 3887
249 Ga0207681_10264276 3300025923 Bacteria 1348
250 Ga0207694_10841448 3300025924 Bacteria 775
251 Ga0207650_10021305 3300025925 Unclassified 4580
252 Ga0207650_10106326 3300025925 Unclassified 2167
253 Ga0207650_10216479 3300025925 Bacteria 1540
254 Ga0207659_10023074 3300025926 Bacteria 4149
255 Ga0207659_10043847 3300025926 Bacteria 3145
256 Ga0207659_10044143 3300025926 Unclassified 3135
257 Ga0207659_10079852 3300025926 Unclassified 2415
258 Ga0207659_10089829 3300025926 Bacteria 2291
259 Ga0207659_10314873 3300025926 Bacteria 1289
260 Ga0207644_10026123 3300025931 Bacteria 4022
261 Ga0207644_10091354 3300025931 Unclassified 2270
262 Ga0207690_10112797 3300025932 Bacteria 1961
263 Ga0207706_10001356 3300025933 Bacteria 24456
264 Ga0207706_10021390 3300025933 Bacteria 5810
265 Ga0207706_10060098 3300025933 Bacteria 3347
266 Ga0207706_10068718 3300025933 Bacteria 3117
267 Ga0207686_10016147 3300025934 Bacteria 4185
268 Ga0207670_10031554 3300025936 Archaea 3397
269 Ga0207670_10060329 3300025936 Unclassified 2584
270 Ga0207669_10005806 3300025937 Bacteria 5579
271 Ga0207669_10105242 3300025937 Bacteria 1876
272 Ga0207669_10170752 3300025937 Bacteria 1547
273 Ga0207669_10217824 3300025937 Bacteria 1399
274 Ga0207691_10001105 3300025940 Bacteria 26841
275 Ga0207691_10024876 3300025940 Bacteria 5627
276 Ga0207711_10018377 3300025941 Archaea 5812
277 Ga0207711_10115425 3300025941 Bacteria 2393
278 Ga0207689_10000546 3300025942 Bacteria 35815
279 Ga0207689_10013466 3300025942 Bacteria 6984
280 Ga0207689_10018996 3300025942 Bacteria 5797
281 Ga0207689_10189251 3300025942 Bacteria 1698
282 Ga0207689_10428707 3300025942 Unclassified 1104
283 Ga0207661_10001796 3300025944 Bacteria 14663
284 Ga0207661_10006920 3300025944 Bacteria 8042
285 Ga0207679_10048014 3300025945 Bacteria 3105
286 Ga0207679_10101548 3300025945 Unclassified 2250
287 Ga0207679_10735673 3300025945 Bacteria 897
288 Ga0207651_10003844 3300025960 Bacteria 7449
289 Ga0207651_10010645 3300025960 Bacteria 5107
290 Ga0207712_10003730 3300025961 Bacteria 9615
291 Ga0207712_10032731 3300025961 Unclassified 3511
292 Ga0207712_10272308 3300025961 Unclassified 1378
293 Ga0207668_10032455 3300025972 Archaea 3450
294 Ga0207658_10536960 3300025986 Bacteria 1045
295 Ga0207677_10352669 3300026023 Bacteria 1233
296 Ga0207703_10020298 3300026035 Bacteria 5195
297 Ga0207703_10136889 3300026035 Bacteria 2121
298 Ga0207639_10525514 3300026041 Bacteria 1084
299 Ga0207678_10045667 3300026067 Unclassified 3787
300 Ga0207708_10003569 3300026075 Bacteria 11476
301 Ga0207708_10134465 3300026075 Unclassified 1936
302 Ga0207708_10162024 3300026075 Unclassified 1767
303 Ga0207641_10015018 3300026088 Bacteria 6347
304 Ga0207641_10282738 3300026088 Bacteria 1561
305 Ga0207648_10002789 3300026089 Bacteria 18531
306 Ga0207648_10250944 3300026089 Bacteria 1577
307 Ga0207648_10332562 3300026089 Bacteria 1367
308 Ga0207648_10585109 3300026089 Bacteria 1028
309 Ga0207676_10145334 3300026095 Bacteria 2036
310 Ga0207676_10330749 3300026095 Bacteria 1402
311 Ga0207674_10151234 3300026116 Bacteria 2278
312 Ga0207674_10353769 3300026116 Archaea 1420
313 Ga0207675_100008677 3300026118 Bacteria 9555
314 Ga0207675_100102740 3300026118 Unclassified 2693
315 Ga0207675_100119252 3300026118 Bacteria 2495
316 Ga0207675_100916927 3300026118 Bacteria 893
317 Ga0207683_10029685 3300026121 Bacteria 4736
318 Ga0207683_10139523 3300026121 Archaea 2184
319 Ga0207683_10191330 3300026121 Bacteria 1858
320 Ga0207683_10716231 3300026121 Bacteria 928
321 Ga0207428_10000494 3300027907 Bacteria 47124
322 Ga0207428_10006726 3300027907 Bacteria 10555
323 Ga0207428_10016594 3300027907 Bacteria 6331
324 Ga0207428_10063036 3300027907 Bacteria 2929
325 Ga0207428_10070323 3300027907 Unclassified 2751
326 Ga0207428_10199322 3300027907 Bacteria 1506
327 Ga0207428_10322446 3300027907 Bacteria 1141
328 Ga0268266_10102377 3300028379 Archaea 2526
329 Ga0268265_10120408 3300028380 Unclassified 2161
330 Ga0268265_10238475 3300028380 Bacteria 1603
331 Ga0268265_10340143 3300028380 Bacteria 1366
332 Ga0268265_10417563 3300028380 Bacteria 1245
333 Ga0268264_10017943 3300028381 Bacteria 5789
334 Ga0268264_10085001 3300028381 Bacteria 2714
335 Ga0307408_100153977 3300031548 Bacteria 1818
336 Ga0307408_100554352 3300031548 Bacteria 1015
337 Ga0307405_10212947 3300031731 Bacteria 1412
338 Ga0307413_10157342 3300031824 Unclassified 1592
339 Ga0307409_100163155 3300031995 Unclassified 1952
340 Ga0307416_100078445 3300032002 Unclassified 2779
341 Ga0307411_10364905 3300032005 Unclassified 1182
342 Ga0307415_100636687 3300032126 Bacteria 954
343 Ga0373940_0031010 3300035088 Unclassified 1425
344 Ga0373924_0183253 3300035410 Unclassified 922
345 Ga0373925_0083071 3300037068 Bacteria 2439
346 Ga0395905_0241486 3300037471 Bacteria 1688
347 Ga0436365_0037302 3300039437 Bacteria 5329
348 Ga0439453_0016898 3300041408 Unclassified 1276
349 Ga0439461_0018787 3300041410 Unclassified 1356
350 Ga0439445_0025091 3300042004 Unclassified 1519
351 Ga0439450_000724 3300042008 Unclassified 4456
352 Ga0450897_001728 3300042128 Bacteria 1532
353 Ga0450894_002108 3300042131 Bacteria 2722
354 Ga0450895_000760 3300042132 Bacteria 2018
355 Ga0450898_040869 3300042134 Bacteria 877
356 Ga0439434_0046095 3300042435 Unclassified 1346
357 Ga0439435_0001312 3300042436 Bacteria 4532
358 Ga0439460_0028330 3300042461 Bacteria 1580
359 Ga0451576_0327296 3300045051 Bacteria 1604
360 Ga0466967_0248372 3300045976 Bacteria 1699
361 Ga0495639_0316690 3300046475 Unclassified 780
362 Ga0495640_0277990 3300046533 Unclassified 1043
363 Ga0495598_0013215 3300046537 Bacteria 2042
364 Ga0495621_0004270 3300046539 Bacteria 4002
365 Ga0495656_0088030 3300046615 Bacteria 1415
366 Ga0495635_0109022 3300046663 Bacteria 1891
367 Ga0495659_0023951 3300046664 Unclassified 2078
368 Ga0495669_0102089 3300046684 Bacteria 1333
369 Ga0496104_0012768 3300048907 Bacteria 7566
370 Ga0496104_0510263 3300048907 Bacteria 1114
371 Ga0496105_0004105 3300048908 Bacteria 10917
372 Ga0496106_0208618 3300048909 Bacteria 1556
373 Ga0496107_0445459 3300048910 Unclassified 962
374 Ga0496108_0043652 3300048911 Unclassified 3744
375 Ga0496109_0000421 3300048912 Bacteria 37279
376 Ga0496110_0016779 3300048913 Bacteria 6118
377 Ga0496111_0001922 3300048914 Bacteria 12282
378 Ga0496112_0000526 3300048915 Bacteria 26132
379 Ga0496114_0332194 3300048917 Bacteria 1344
380 Ga0501299_006071 3300049522 Bacteria 1883
381 Ga0501033_0089499 3300049570 Bacteria 2252
382 Ga0501034_0003973 3300049571 Bacteria 16616
383 Ga0501036_0071922 3300049572 Bacteria 2924
384 Ga0501036_0746397 3300049572 Unclassified 807
385 Ga0501039_0055936 3300049575 Bacteria 3056
386 Ga0501039_0221277 3300049575 Bacteria 1488
387 Ga0501039_0387076 3300049575 Bacteria 1098
388 Ga0501040_0034920 3300049576 Bacteria 3408
389 Ga0501040_0126804 3300049576 Bacteria 1793
390 Ga0501041_0092564 3300049577 Unclassified 1867
391 Ga0501041_0096751 3300049577 Unclassified 1825
392 Ga0501042_0002722 3300049578 Bacteria 10899
393 Ga0501042_0003000 3300049578 Bacteria 10502
394 Ga0501048_0348109 3300049582 Bacteria 1057
395 Ga0501067_0027089 3300049583 Unclassified 3176
396 Ga0501067_0031510 3300049583 Bacteria 2942
397 Ga0501069_0127260 3300049585 Unclassified 1457
398 Ga0501071_0066010 3300049587 Bacteria 2629
399 Ga0501071_0172278 3300049587 Bacteria 1620
400 Ga0501072_0032146 3300049588 Unclassified 4109
401 Ga0501072_0043351 3300049588 Bacteria 3536
402 Ga0501072_0078142 3300049588 Bacteria 2620
403 Ga0501075_0011166 3300049591 Bacteria 6347
404 Ga0501075_0270584 3300049591 Unclassified 1295
405 Ga0501076_0007846 3300049592 Bacteria 7779
406 Ga0501076_0105653 3300049592 Bacteria 2272
407 Ga0501077_0188855 3300049593 Unclassified 1309
408 Ga0501079_0028835 3300049741 Unclassified 4261
409 Ga0501080_0187794 3300049742 Unclassified 1900
410 Ga0501081_0028418 3300049743 Bacteria 3774
411 Ga0501081_0135664 3300049743 Bacteria 1761
412 Ga0501081_0191483 3300049743 Bacteria 1481
413 Ga0501045_0077455 3300049824 Bacteria 2450
414 Ga0501045_0313374 3300049824 Bacteria 1167
415 Ga0501045_0383806 3300049824 Bacteria 1046
416 nmdc:mga00v17_26303_c1 3300050491 Bacteria 3390
417 nmdc:mga00v17_406410_c1 3300050491 Bacteria 885
418 nmdc:mga0yw44_1297_c1 3300050492 Bacteria 9870
419 nmdc:mga0yw44_90267_c1 3300050492 Unclassified 1935
420 nmdc:mga0k408_31367_c1 3300050493 Bacteria 3034
421 nmdc:mga06z11_14172_c1 3300050494 Bacteria 3525
422 nmdc:mga04h51_31508_c1 3300050495 Bacteria 1676
423 nmdc:mga05p37_3607_c1 3300050507 Bacteria 18082
424 nmdc:mga05p37_474_c1 3300050507 Bacteria 43786
425 nmdc:mga05p37_49973_c2 3300050507 Unclassified 4002
426 nmdc:mga05p37_763186_c1 3300050507 Bacteria 1064
427 nmdc:mga09592_103645_c1 3300050508 Unclassified 2438
428 nmdc:mga09592_127915_c1 3300050508 Unclassified 2184
429 nmdc:mga09592_41992_c1 3300050508 Bacteria 3847
430 nmdc:mga09592_68507_c1 3300050508 Unclassified 3010
431 nmdc:mga0qj67_14982_c1 3300050509 Bacteria 5866
432 nmdc:mga0qj67_17494_c1 3300050509 Bacteria 5451
433 nmdc:mga0qj67_206_c1 3300050509 Bacteria 39998
434 nmdc:mga0qj67_234940_c1 3300050509 Bacteria 1487
435 nmdc:mga0qj67_255730_c1 3300050509 Bacteria 1421
436 nmdc:mga0qj67_424566_c1 3300050509 Bacteria 1072
437 nmdc:mga06r32_101040_c1 3300050510 Bacteria 2830
438 nmdc:mga06r32_157430_c1 3300050510 Bacteria 2253
439 nmdc:mga06r32_2143_c1 3300050510 Bacteria 17641
440 nmdc:mga06r32_352230_c1 3300050510 Bacteria 1457
441 nmdc:mga06r32_524209_c1 3300050510 Bacteria 1160
442 nmdc:mga08y16_15347_c1 3300050511 Bacteria 8056
443 nmdc:mga08y16_2212_c1 3300050511 Bacteria 19948
444 nmdc:mga08y16_486765_c1 3300050511 Bacteria 1255
445 nmdc:mga08y16_5476_c1 3300050511 Bacteria 13274
446 nmdc:mga08y16_636029_c1 3300050511 Bacteria 1072
447 nmdc:mga08y16_68185_c1 3300050511 Bacteria 3709
448 nmdc:mga08y16_782561_c1 3300050511 Unclassified 948
449 nmdc:mga08y16_8750_c1 3300050511 Bacteria 10621
450 nmdc:mga0n895_114890_c1 3300050512 Unclassified 2710
451 nmdc:mga0n895_227322_c1 3300050512 Bacteria 1894
452 nmdc:mga0n895_297877_c1 3300050512 Unclassified 1635
453 nmdc:mga0rr50_10131_c1 3300050513 Bacteria 5966
454 nmdc:mga0rr50_383247_c1 3300050513 Unclassified 1186
455 nmdc:mga08x19_706551_c1 3300050514 Unclassified 715
456 nmdc:mga0a205_203837_c1 3300050515 Unclassified 1868
457 nmdc:mga0a205_256306_c1 3300050515 Bacteria 1628
458 nmdc:mga0a205_3889_c1 3300050515 Bacteria 13373
459 nmdc:mga0a205_57646_c1 3300050515 Bacteria 3750
460 Ga0495619_0038909 3300053085 Bacteria 3104
461 Ga0495619_0132965 3300053085 Bacteria 1710
462 Ga0500641_0001496 3300053096 Bacteria 8343
463 Ga0500616_0005994 3300053153 Bacteria 8091
464 Ga0501084_0200616 3300054114 Unclassified 1683
465 Ga0590071_002717 3300059421 Bacteria 4434
466 Ga0590071_036052 3300059421 Unclassified 1185
467 Ga0590074_002318 3300059423 Unclassified 3121
468 Ga0590075_000523 3300059424 Bacteria 10391
469 Ga0590077_000003 3300059426 Bacteria 50145
470 Ga0590077_016961 3300059426 Unclassified 1530
471 Ga0501082_0206211 3300060353 Unclassified 1710
472 Ga0530510_0005346 3300061734 Bacteria 8881
473 nmdc:mga00v17_4431_c1
474 MRS1b_contig_1466471
475 MBSR1b_contig_9829774
476 Ga0065712_10075982
477 Ga0065712_10080914
478 Ga0065712_10086258
479 Ga0065715_10003874
480 Ga0065715_10017156
481 Ga0065715_10097690
482 Ga0065715_10105055
483 Ga0065707_10096888
484 Ga0065707_10228185
485 Ga0070676_10014044
486 Ga0070676_10039226
487 Ga0070683_100000395
488 Ga0070683_100017752
489 Ga0070690_100068024
490 Ga0070690_100153579
491 Ga0070690_100176100
492 Ga0070670_100110851
493 Ga0070670_100279702
494 Ga0070677_10015861
495 Ga0070677_10061529
496 Ga0070677_10200771
497 Ga0068869_100060129
498 Ga0068869_100078758
499 Ga0068869_100230281
500 Ga0068869_100284154
501 Ga0070666_10028129
502 Ga0070666_10227508
503 Ga0070666_10490491
504 Ga0070680_100411143
505 Ga0068868_100103671
506 Ga0068868_100279410
507 Ga0070689_100302589
508 Ga0070691_10040503
509 Ga0070691_10182902
510 Ga0070661_100312828
511 Ga0070692_10238141
512 Ga0070668_100062255
513 Ga0070669_100002308
514 Ga0070669_100014791
515 Ga0070669_100121831
516 Ga0070669_100143185
517 Ga0070669_100143895
518 Ga0070675_100015303
519 Ga0070675_100018059
520 Ga0070675_100035997
521 Ga0070675_100064513
522 Ga0070671_100021679
523 Ga0070671_100038945
524 Ga0070671_100114587
525 Ga0070674_100000507
526 Ga0070674_100183992
527 Ga0070674_100211136
528 Ga0070673_100010372
529 Ga0070673_100231064
530 Ga0070673_100361646
531 Ga0070688_100017592
532 Ga0070659_100194764
533 Ga0070667_100069767
534 Ga0070667_100335436
535 Ga0070667_100398094
536 Ga0070701_10005534
537 Ga0070701_10158035
538 Ga0070705_100004223
539 Ga0070700_100004667
540 Ga0070694_100101562
541 Ga0070694_100134723
542 Ga0070694_100246446
543 Ga0070694_100625862
544 Ga0070678_100045235
545 Ga0070678_100087307
546 Ga0070678_100110102
547 Ga0070662_100016546
548 Ga0070662_100030899
549 Ga0070662_100087789
550 Ga0070681_10117990
551 Ga0070681_10308734
552 Ga0068867_100007288
553 Ga0068867_100572864
554 Ga0070698_100042393
555 Ga0070699_100457064
556 Ga0070684_100000197
557 Ga0070684_100151110
558 Ga0070672_100021193
559 Ga0070686_100006076
560 Ga0070686_100157450
561 Ga0070686_100436587
562 Ga0070665_100009004
563 Ga0070665_101018745
564 Ga0070704_100112708
565 Ga0068855_100390674
566 Ga0068855_100877701
567 Ga0070664_100001737
568 Ga0070664_100014724
569 Ga0070664_100774809
570 Ga0068857_100067025
571 Ga0068857_100283575
572 Ga0068854_100083755
573 Ga0068856_100250004
574 Ga0070702_100031806
575 Ga0070702_100173369
576 Ga0068852_100269311
577 Ga0068852_100353761
578 Ga0068859_100021479
579 Ga0068859_100067504
580 Ga0068859_100584261
581 Ga0068864_100186755
582 Ga0068864_100190885
583 Ga0068866_10243388
584 Ga0068861_100001696
585 Ga0068861_100068019
586 Ga0068861_100785163
587 Ga0068870_10000982
588 Ga0068863_100138932
589 Ga0068863_100690004
590 Ga0068863_100738592
591 Ga0068860_100020837
592 Ga0068860_100128572
593 Ga0068860_100296913
594 Ga0068862_100013478
595 Ga0068862_100031034
596 Ga0068862_100138279
597 Ga0068862_100149247
598 Ga0075365_10001292
599 Ga0075368_10053118
600 Ga0075364_10031462
601 Ga0075364_10054053
602 Ga0075364_10134985
603 Ga0075432_10023448
604 Ga0075366_10004783
605 Ga0075366_10030120
606 Ga0097621_100386460
607 Ga0075370_10005334
608 Ga0068871_100231272
609 Ga0075428_100001181
610 Ga0075428_100022556
611 Ga0075428_100026652
612 Ga0075428_100048883
613 Ga0075428_100258352
614 Ga0075428_100462901
615 Ga0075428_100500413
616 Ga0075428_100717916
617 Ga0075428_100936291
618 Ga0075428_101034123
619 Ga0075430_100001472
620 Ga0075430_100007631
621 Ga0075430_100062277
622 Ga0075430_100091917
623 Ga0075430_100238273
624 Ga0075430_100298668
625 Ga0075431_100000025
626 Ga0075431_100016073
627 Ga0075431_100045601
628 Ga0075431_100235481
629 Ga0075431_100843742
630 Ga0075433_10026638
631 Ga0075433_10118398
632 Ga0075434_100000296
633 Ga0075434_100292880
634 Ga0075434_100300857
635 Ga0075429_100003176
636 Ga0075429_100038360
637 Ga0075429_100041221
638 Ga0075429_100046967
639 Ga0075429_100066141
640 Ga0075429_100187460
641 Ga0075429_100302170
642 Ga0097620_100021478
643 Ga0097620_100067506
644 Ga0097620_100584305
645 Ga0075435_100007712
646 Ga0075435_100024830
647 Ga0105240_10044771
648 Ga0105240_10187194
649 Ga0105240_10849850
650 Ga0111539_10002921
651 Ga0111539_10003361
652 Ga0111539_10004354
653 Ga0111539_10009038
654 Ga0111539_10009686
655 Ga0111539_10015788
656 Ga0111539_10573154
657 Ga0111539_10922755
658 Ga0105245_10031695
659 Ga0105245_10426027
660 Ga0105247_10006975
661 Ga0105247_10135535
662 Ga0114129_10000400
663 Ga0114129_10009548
664 Ga0114129_10013816
665 Ga0114129_10025118
666 Ga0114129_10057037
667 Ga0114129_10111712
668 Ga0114129_10275178
669 Ga0114129_10502206
670 Ga0114129_10934449
671 Ga0105243_10771181
672 Ga0105243_11008635
673 Ga0105241_10123146
674 Ga0105242_10019305
675 Ga0105248_10016637
676 Ga0105248_10130254
677 Ga0105248_10229303
678 Ga0105249_10001419
679 Ga0105249_10037938
680 Ga0105249_10422032
681 Ga0105249_10602267
682 Ga0157370_10286226
683 Ga0157374_10039780
684 Ga0163162_10037307
685 Ga0157372_10383967
686 Ga0157375_10134489
687 Ga0157375_10861929
688 Ga0163163_10059746
689 Ga0157380_10025239
690 Ga0157380_10057728
691 Ga0157380_10062795
692 Ga0157377_10009715
693 Ga0157377_10017764
694 Ga0157377_10261680
695 Ga0157379_10003949
696 Ga0157379_10018828
697 Ga0157379_10056777
698 Ga0157376_10234730
699 Ga0157376_10351607
700 Ga0163161_10019094
701 Ga0163161_10513286
702 Ga0207697_10001052
703 Ga0207697_10035654
704 Ga0207682_10000114
705 Ga0207682_10004533
706 Ga0207682_10006191
707 Ga0207710_10018656
708 Ga0207688_10000023
709 Ga0207680_10078436
710 Ga0207645_10001465
711 Ga0207645_10006528
712 Ga0207643_10000592
713 Ga0207654_10224065
714 Ga0207695_10118735
715 Ga0207662_10003205
716 Ga0207662_10038317
717 Ga0207657_10732592
718 Ga0207649_10004649
719 Ga0207681_10003552
720 Ga0207681_10024319
721 Ga0207681_10264276
722 Ga0207694_10841448
723 Ga0207650_10021305
724 Ga0207650_10106326
725 Ga0207650_10216479
726 Ga0207659_10023074
727 Ga0207659_10043847
728 Ga0207659_10044143
729 Ga0207659_10079852
730 Ga0207659_10089829
731 Ga0207659_10314873
732 Ga0207644_10026123
733 Ga0207644_10091354
734 Ga0207690_10112797
735 Ga0207706_10001356
736 Ga0207706_10021390
737 Ga0207706_10060098
738 Ga0207706_10068718
739 Ga0207686_10016147
740 Ga0207670_10031554
741 Ga0207670_10060329
742 Ga0207669_10005806
743 Ga0207669_10105242
744 Ga0207669_10170752
745 Ga0207669_10217824
746 Ga0207691_10001105
747 Ga0207691_10024876
748 Ga0207711_10018377
749 Ga0207711_10115425
750 Ga0207689_10000546
751 Ga0207689_10013466
752 Ga0207689_10018996
753 Ga0207689_10189251
754 Ga0207689_10428707
755 Ga0207661_10001796
756 Ga0207661_10006920
757 Ga0207679_10048014
758 Ga0207679_10101548
759 Ga0207679_10735673
760 Ga0207651_10003844
761 Ga0207651_10010645
762 Ga0207712_10003730
763 Ga0207712_10032731
764 Ga0207712_10272308
765 Ga0207668_10032455
766 Ga0207658_10536960
767 Ga0207677_10352669
768 Ga0207703_10020298
769 Ga0207703_10136889
770 Ga0207639_10525514
771 Ga0207678_10045667
772 Ga0207708_10003569
773 Ga0207708_10134465
774 Ga0207708_10162024
775 Ga0207641_10015018
776 Ga0207641_10282738
777 Ga0207648_10002789
778 Ga0207648_10250944
779 Ga0207648_10332562
780 Ga0207648_10585109
781 Ga0207676_10145334
782 Ga0207676_10330749
783 Ga0207674_10151234
784 Ga0207674_10353769
785 Ga0207675_100008677
786 Ga0207675_100102740
787 Ga0207675_100119252
788 Ga0207675_100916927
789 Ga0207683_10029685
790 Ga0207683_10139523
791 Ga0207683_10191330
792 Ga0207683_10716231
793 Ga0207428_10000494
794 Ga0207428_10006726
795 Ga0207428_10016594
796 Ga0207428_10063036
797 Ga0207428_10070323
798 Ga0207428_10199322
799 Ga0207428_10322446
800 Ga0268266_10102377
801 Ga0268265_10120408
802 Ga0268265_10238475
803 Ga0268265_10340143
804 Ga0268265_10417563
805 Ga0268264_10017943
806 Ga0268264_10085001
807 Ga0307408_100153977
808 Ga0307408_100554352
809 Ga0307405_10212947
810 Ga0307413_10157342
811 Ga0307409_100163155
812 Ga0307416_100078445
813 Ga0307411_10364905
814 Ga0307415_100636687
815 Ga0373940_0031010
816 Ga0373924_0183253
817 Ga0373925_0083071
818 Ga0395905_0241486
819 Ga0436365_0037302
820 Ga0439453_0016898
821 Ga0439461_0018787
822 Ga0439445_0025091
823 Ga0439450_000724
824 Ga0450897_001728
825 Ga0450894_002108
826 Ga0450895_000760
827 Ga0450898_040869
828 Ga0439434_0046095
829 Ga0439435_0001312
830 Ga0439460_0028330
831 Ga0451576_0327296
832 Ga0466967_0248372
833 Ga0495639_0316690
834 Ga0495640_0277990
835 Ga0495598_0013215
836 Ga0495621_0004270
837 Ga0495656_0088030
838 Ga0495635_0109022
839 Ga0495659_0023951
840 Ga0495669_0102089
841 Ga0496104_0012768
842 Ga0496104_0510263
843 Ga0496105_0004105
844 Ga0496106_0208618
845 Ga0496107_0445459
846 Ga0496108_0043652
847 Ga0496109_0000421
848 Ga0496110_0016779
849 Ga0496111_0001922
850 Ga0496112_0000526
851 Ga0496114_0332194
852 Ga0501299_006071
853 Ga0501033_0089499
854 Ga0501034_0003973
855 Ga0501036_0071922
856 Ga0501036_0746397
857 Ga0501039_0055936
858 Ga0501039_0221277
859 Ga0501039_0387076
860 Ga0501040_0034920
861 Ga0501040_0126804
862 Ga0501041_0092564
863 Ga0501041_0096751
864 Ga0501042_0002722
865 Ga0501042_0003000
866 Ga0501048_0348109
867 Ga0501067_0027089
868 Ga0501067_0031510
869 Ga0501069_0127260
870 Ga0501071_0066010
871 Ga0501071_0172278
872 Ga0501072_0032146
873 Ga0501072_0043351
874 Ga0501072_0078142
875 Ga0501075_0011166
876 Ga0501075_0270584
877 Ga0501076_0007846
878 Ga0501076_0105653
879 Ga0501077_0188855
880 Ga0501079_0028835
881 Ga0501080_0187794
882 Ga0501081_0028418
883 Ga0501081_0135664
884 Ga0501081_0191483
885 Ga0501045_0077455
886 Ga0501045_0313374
887 Ga0501045_0383806
888 nmdc:mga00v17_26303_c1
889 nmdc:mga00v17_406410_c1
890 nmdc:mga0yw44_1297_c1
891 nmdc:mga0yw44_90267_c1
892 nmdc:mga0k408_31367_c1
893 nmdc:mga06z11_14172_c1
894 nmdc:mga04h51_31508_c1
895 nmdc:mga05p37_3607_c1
896 nmdc:mga05p37_474_c1
897 nmdc:mga05p37_49973_c2
898 nmdc:mga05p37_763186_c1
899 nmdc:mga09592_103645_c1
900 nmdc:mga09592_127915_c1
901 nmdc:mga09592_41992_c1
902 nmdc:mga09592_68507_c1
903 nmdc:mga0qj67_14982_c1
904 nmdc:mga0qj67_17494_c1
905 nmdc:mga0qj67_206_c1
906 nmdc:mga0qj67_234940_c1
907 nmdc:mga0qj67_255730_c1
908 nmdc:mga0qj67_424566_c1
909 nmdc:mga06r32_101040_c1
910 nmdc:mga06r32_157430_c1
911 nmdc:mga06r32_2143_c1
912 nmdc:mga06r32_352230_c1
913 nmdc:mga06r32_524209_c1
914 nmdc:mga08y16_15347_c1
915 nmdc:mga08y16_2212_c1
916 nmdc:mga08y16_486765_c1
917 nmdc:mga08y16_5476_c1
918 nmdc:mga08y16_636029_c1
919 nmdc:mga08y16_68185_c1
920 nmdc:mga08y16_782561_c1
921 nmdc:mga08y16_8750_c1
922 nmdc:mga0n895_114890_c1
923 nmdc:mga0n895_227322_c1
924 nmdc:mga0n895_297877_c1
925 nmdc:mga0rr50_10131_c1
926 nmdc:mga0rr50_383247_c1
927 nmdc:mga08x19_706551_c1
928 nmdc:mga0a205_203837_c1
929 nmdc:mga0a205_256306_c1
930 nmdc:mga0a205_3889_c1
931 nmdc:mga0a205_57646_c1
932 Ga0495619_0038909
933 Ga0495619_0132965
934 Ga0500641_0001496
935 Ga0500616_0005994
936 Ga0501084_0200616
937 Ga0590071_002717
938 Ga0590071_036052
939 Ga0590074_002318
940 Ga0590075_000523
941 Ga0590077_000003
942 Ga0590077_016961
943 Ga0501082_0206211
944 Ga0530510_0005346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06508

QueC

Queuosine biosynthesis protein QueC

19

234

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.824 7 217
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8047 7 217
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8042 7 217
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.7854 7 217
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.7401 7 217
ID Description Score Start End Superfamily
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8561 8 220 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8132 8 220 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8027 7 216 3.40.50.620
af_O45307_4_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7959 9 39 3.40.50.720
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7763 7 216 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7V9CK80-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9849 22 221
AF-A0A7Z9T943-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9841 5 221
AF-A0A2V8GBF9-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9825 77 221
AF-A0A2D8R4V0-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9799 6 221
AF-A0A2V8FKX7-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9773 68 221

Map