F450901

General Info

Members Datasets Scaffolds Average Seq Length
472 293 944 183

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0223821|Ga0501038_0223821_17_646
Length 200
Sequence MAHFPRSHDIVIGPLDLVARVDEALAVQAVAFGLDADEIAVRRQIVLHHMTCLGARALGATTTGGRLVGFVYGMPNDRVHWWSTVVEPYLRARGHEDWLDDSFVITELHVHPRHQNRGIGRALITTITDSAAEPRSILSAIDTDSPARGLYHSLGYQDLARQVLFPSAPKPYAVMGALLPLRRRPGQQPAIDFHRPSPPG

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
38 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
39 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
45 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
54 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
55 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
56 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
57 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
58 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
59 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
60 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
61 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
62 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
63 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
64 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
65 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
66 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
202 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
203 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
204 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
212 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
213 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
216 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
219 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
220 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
221 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
222 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
228 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
229 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
230 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
231 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
232 2643221548 Streptomyces sp. Root55 Isolate Unclassified
233 2643221578 Streptomyces sp. Root63 Isolate Unclassified
234 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
235 2643221647 Streptomyces sp. Root369 Isolate Unclassified
236 2643221670 Streptomyces sp. Root431 Isolate Unclassified
237 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
238 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
239 2643221714 Streptomyces sp. Root264 Isolate Unclassified
240 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
241 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
242 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
243 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
244 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
245 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
246 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
247 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
248 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
249 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
250 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
251 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
252 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
253 2862574272 Streptomyces sp. AcE210 Isolate Nodule
254 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
255 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
256 2867369537 Streptomyces sp. Z26 Isolate Unclassified
257 2867428634 Streptomyces sp. RP5T Isolate Unclassified
258 2867475112 Streptomyces sp. TM32 Isolate Unclassified
259 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
260 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
261 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
262 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
263 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
264 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
265 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
266 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
267 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
268 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
269 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
270 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
271 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
272 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
273 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
274 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
275 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
276 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
277 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
278 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
279 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
280 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
281 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
282 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
283 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
284 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
285 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
286 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
287 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
288 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
289 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
290 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
291 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
292 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
293 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.81
Metatranscriptomes 0
Isolates 14.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.26
Nodule 0.64
Rhizoplane 1.06
Rhizosphere 77.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0223821 3300049574 Bacteria 1500
2 JGI24738J21930_10030345 3300002075 Bacteria 1104
3 rootH1_10089050 3300003323 Bacteria 1227
4 Ga0070670_100813312 3300005331 Bacteria 844
5 Ga0070681_10442129 3300005458 Bacteria 1212
6 Ga0068853_100207606 3300005539 Bacteria 1784
7 Ga0068855_100155972 3300005563 Bacteria 2594
8 Ga0068856_100164198 3300005614 Bacteria 2232
9 Ga0081455_10070144 3300005937 Bacteria 2911
10 Ga0075365_10146398 3300006038 Bacteria 1641
11 Ga0075370_10094471 3300006353 Bacteria 1727
12 Ga0105250_10054436 3300009092 Bacteria 1605
13 Ga0105243_10504521 3300009148 Bacteria 1147
14 Ga0105238_10296607 3300009551 Bacteria 1600
15 Ga0105239_10305201 3300010375 Bacteria 1793
16 Ga0105246_10050240 3300011119 Bacteria 2860
17 Ga0157369_10334693 3300013105 Bacteria 1573
18 Ga0157372_10136543 3300013307 Bacteria 2824
19 Ga0182008_10002627 3300014497 Bacteria 11152
20 Ga0182007_10001609 3300015262 Bacteria 11985
21 Ga0183367_1013 3300015688 Bacteria 334176
22 Ga0213875_10002706 3300021388 Bacteria 10470
23 Ga0209758_1001931 3300025297 Bacteria 22510
24 Ga0207426_1004698 3300025302 Bacteria 6543
25 Ga0207426_1011895 3300025302 Bacteria 3293
26 Ga0207647_10020503 3300025904 Bacteria 4431
27 Ga0207709_10220943 3300025935 Bacteria 1366
28 Ga0207691_10408485 3300025940 Bacteria 1158
29 Ga0207667_10239192 3300025949 Bacteria 1858
30 Ga0207702_10108022 3300026078 Bacteria 2468
31 Ga0307517_10046442 3300028786 Bacteria 4530
32 Ga0307515_10160679 3300028794 Bacteria 2293
33 Ga0268256_1017068 3300030500 Bacteria 2057
34 Ga0307511_10013718 3300030521 Bacteria 7906
35 Ga0307512_10002763 3300030522 Bacteria 21448
36 Ga0307512_10017744 3300030522 Bacteria 6518
37 Ga0307513_10021535 3300031456 Bacteria 7608
38 Ga0307513_10308372 3300031456 Bacteria 1346
39 Ga0307508_10002014 3300031616 Bacteria 22128
40 Ga0307508_10003354 3300031616 Bacteria 16243
41 Ga0307508_10027776 3300031616 Bacteria 5120
42 Ga0307508_10047719 3300031616 Bacteria 3817
43 Ga0307508_10251109 3300031616 Bacteria 1365
44 Ga0307514_10064277 3300031649 Bacteria 2783
45 Ga0307514_10068120 3300031649 Bacteria 2683
46 Ga0307514_10072822 3300031649 Bacteria 2571
47 Ga0307516_10041811 3300031730 Bacteria 4552
48 Ga0307516_10075048 3300031730 Bacteria 3236
49 Ga0307516_10111727 3300031730 Bacteria 2534
50 Ga0307518_10097795 3300031838 Bacteria 2104
51 Ga0307518_10137224 3300031838 Bacteria 1711
52 Ga0307410_10144837 3300031852 Bacteria 1762
53 Ga0307410_10967042 3300031852 Bacteria 733
54 Ga0307409_100214933 3300031995 Bacteria 1731
55 Ga0307416_101004678 3300032002 Bacteria 937
56 Ga0307416_101302194 3300032002 Bacteria 832
57 Ga0307416_101914486 3300032002 Bacteria 696
58 Ga0307411_10131491 3300032005 Bacteria 1830
59 Ga0307507_10013905 3300033179 Bacteria 9684
60 Ga0307507_10125911 3300033179 Bacteria 2027
61 Ga0307510_10063001 3300033180 Bacteria 3781
62 Ga0307510_10251296 3300033180 Bacteria 1256
63 Ga0395900_0074862 3300037418 Bacteria 3480
64 Ga0395900_1229506 3300037418 Bacteria 664
65 Ga0395898_0007411 3300037466 Bacteria 11647
66 Ga0436364_1263823 3300037853 Bacteria 35965
67 Ga0395901_0019315 3300038443 Bacteria 6967
68 Ga0439436_0003897 3300041404 Bacteria 4574
69 Ga0451849_0115485 3300041505 Bacteria 699
70 Ga0451853_0254657 3300041512 Bacteria 3172
71 Ga0451853_3045339 3300041512 Bacteria 1072
72 Ga0439433_0038793 3300041999 Bacteria 1105
73 Ga0439448_0163923 3300042005 Bacteria 774
74 Ga0439449_0070347 3300042007 Bacteria 1290
75 Ga0439449_0118725 3300042007 Bacteria 981
76 Ga0439449_0177399 3300042007 Bacteria 796
77 Ga0439457_000213 3300042014 Bacteria 15420
78 Ga0439462_0022248 3300042015 Bacteria 1658
79 Ga0439463_115917 3300042016 Bacteria 692
80 Ga0450890_027492 3300042127 Bacteria 797
81 Ga0450897_007398 3300042128 Bacteria 1001
82 Ga0450894_000614 3300042131 Bacteria 5999
83 Ga0450898_000734 3300042134 Bacteria 3997
84 Ga0450900_042966 3300042136 Bacteria 680
85 Ga0450903_000124 3300042138 Bacteria 16697
86 Ga0439458_0001305 3300042157 Bacteria 6292
87 Ga0450908_006004 3300042184 Bacteria 2318
88 Ga0466969_0013287 3300044656 Bacteria 4336
89 Ga0466969_0031914 3300044656 Bacteria 2679
90 Ga0466972_0008208 3300044658 Bacteria 5236
91 Ga0466972_0019186 3300044658 Bacteria 3420
92 Ga0466972_0292406 3300044658 Bacteria 761
93 Ga0466965_0002839 3300044683 Bacteria 7467
94 Ga0466966_0006551 3300044684 Bacteria 7707
95 Ga0466966_0069650 3300044684 Bacteria 2206
96 Ga0466961_0001365 3300044693 Bacteria 15062
97 Ga0466961_0050041 3300044693 Bacteria 2669
98 Ga0466963_0000146 3300044694 Bacteria 27935
99 Ga0466963_0092426 3300044694 Bacteria 2061
100 Ga0466963_0512424 3300044694 Bacteria 847
101 Ga0466964_0034447 3300044706 Bacteria 2021
102 Ga0466964_0049268 3300044706 Bacteria 1724
103 Ga0466971_0000681 3300044719 Bacteria 13594
104 Ga0466971_0083829 3300044719 Bacteria 1455
105 Ga0466971_0131413 3300044719 Bacteria 1162
106 Ga0466968_0045781 3300044735 Bacteria 1857
107 Ga0466970_0001388 3300044765 Bacteria 11677
108 Ga0466957_0001009 3300044842 Bacteria 14495
109 Ga0466959_0001182 3300045049 Bacteria 15746
110 Ga0466959_0215697 3300045049 Bacteria 1332
111 Ga0466958_0001814 3300045836 Bacteria 10364
112 Ga0466958_0047842 3300045836 Bacteria 2583
113 Ga0466958_0377480 3300045836 Bacteria 914
114 Ga0466967_0021830 3300045976 Bacteria 5209
115 Ga0466967_0042917 3300045976 Bacteria 3912
116 Ga0466967_0123593 3300045976 Bacteria 2394
117 Ga0495617_002127 3300046452 Bacteria 8149
118 Ga0495617_123336 3300046452 Bacteria 834
119 Ga0495627_028159 3300046453 Bacteria 1797
120 Ga0495592_0024488 3300046454 Bacteria 4587
121 Ga0495603_0000260 3300046455 Bacteria 27834
122 Ga0495603_0017077 3300046455 Bacteria 4393
123 Ga0495603_0020582 3300046455 Bacteria 3996
124 Ga0495603_0035588 3300046455 Bacteria 2990
125 Ga0495603_0047167 3300046455 Bacteria 2566
126 Ga0495603_0599576 3300046455 Bacteria 630
127 Ga0495590_0044377 3300046457 Bacteria 1550
128 Ga0495629_0005680 3300046459 Bacteria 9315
129 Ga0495629_0021532 3300046459 Bacteria 4600
130 Ga0495629_0041309 3300046459 Bacteria 3245
131 Ga0495629_0057571 3300046459 Bacteria 2717
132 Ga0495629_0063198 3300046459 Bacteria 2585
133 Ga0495629_0090744 3300046459 Bacteria 2132
134 Ga0495629_0098172 3300046459 Bacteria 2043
135 Ga0495629_0143313 3300046459 Bacteria 1662
136 Ga0495638_0027353 3300046460 Bacteria 3692
137 Ga0495638_0030285 3300046460 Bacteria 3485
138 Ga0495638_0030724 3300046460 Bacteria 3455
139 Ga0495651_0000524 3300046462 Bacteria 29820
140 Ga0495651_0113297 3300046462 Bacteria 2002
141 Ga0495580_0218696 3300046472 Bacteria 1309
142 Ga0495582_0094498 3300046473 Bacteria 1669
143 Ga0495582_0366929 3300046473 Bacteria 829
144 Ga0495639_0137359 3300046475 Bacteria 1173
145 Ga0495639_0300097 3300046475 Bacteria 801
146 Ga0495662_0015669 3300046476 Bacteria 3679
147 Ga0495662_0026141 3300046476 Bacteria 2819
148 Ga0495662_0339513 3300046476 Bacteria 738
149 Ga0495664_0024529 3300046477 Bacteria 3506
150 Ga0495664_0508093 3300046477 Bacteria 719
151 Ga0495584_0100974 3300046491 Bacteria 1458
152 Ga0495585_0010601 3300046492 Bacteria 5479
153 Ga0495585_0016823 3300046492 Bacteria 4237
154 Ga0495585_0046284 3300046492 Bacteria 2426
155 Ga0495585_0183665 3300046492 Bacteria 1074
156 Ga0495594_0000468 3300046499 Bacteria 20543
157 Ga0495594_0015862 3300046499 Bacteria 3963
158 Ga0495594_0045215 3300046499 Bacteria 2417
159 Ga0495594_0188873 3300046499 Bacteria 1173
160 Ga0495594_0281575 3300046499 Bacteria 947
161 Ga0495594_0633655 3300046499 Bacteria 605
162 Ga0495607_0026303 3300046501 Bacteria 3610
163 Ga0495607_0182471 3300046501 Bacteria 1051
164 Ga0495583_0022645 3300046506 Bacteria 3199
165 Ga0495583_0151326 3300046506 Bacteria 961
166 Ga0495606_0012214 3300046507 Bacteria 6911
167 Ga0495618_0035584 3300046514 Bacteria 3125
168 Ga0495618_0077144 3300046514 Bacteria 2123
169 Ga0495620_0036242 3300046515 Bacteria 2208
170 Ga0495620_0039471 3300046515 Bacteria 2085
171 Ga0495628_0035435 3300046516 Bacteria 4010
172 Ga0495628_0094890 3300046516 Bacteria 2305
173 Ga0495630_0046909 3300046517 Bacteria 3230
174 Ga0495630_0108400 3300046517 Bacteria 2104
175 Ga0495631_0012167 3300046518 Bacteria 4211
176 Ga0495631_0071400 3300046518 Bacteria 1500
177 Ga0495632_0023483 3300046519 Bacteria 3293
178 Ga0495632_0065744 3300046519 Bacteria 1751
179 Ga0495637_0036639 3300046520 Bacteria 2134
180 Ga0495643_0007025 3300046522 Bacteria 7313
181 Ga0495643_0012445 3300046522 Bacteria 5133
182 Ga0495643_0164773 3300046522 Bacteria 1088
183 Ga0495644_0130911 3300046523 Bacteria 956
184 Ga0495648_0038373 3300046524 Bacteria 3064
185 Ga0495666_0113567 3300046526 Bacteria 1271
186 Ga0495652_0014315 3300046529 Bacteria 7123
187 Ga0495652_0137508 3300046529 Bacteria 1925
188 Ga0495654_0025665 3300046530 Bacteria 3034
189 Ga0495640_0058705 3300046533 Bacteria 2623
190 Ga0495640_0106857 3300046533 Bacteria 1832
191 Ga0495640_0462248 3300046533 Bacteria 774
192 Ga0495586_0367594 3300046535 Bacteria 827
193 Ga0495587_0097654 3300046536 Bacteria 1693
194 Ga0495609_0026983 3300046538 Bacteria 2626
195 Ga0495597_0070887 3300046542 Bacteria 1501
196 Ga0495645_0028863 3300046543 Bacteria 4032
197 Ga0495645_0160933 3300046543 Bacteria 1552
198 Ga0495622_0045952 3300046557 Bacteria 2028
199 Ga0495622_0064830 3300046557 Bacteria 1689
200 Ga0495633_0013378 3300046558 Bacteria 4327
201 Ga0495633_0025900 3300046558 Bacteria 2884
202 Ga0495633_0068719 3300046558 Bacteria 1654
203 Ga0495667_0075833 3300046559 Bacteria 2188
204 Ga0495656_0160947 3300046615 Bacteria 1091
205 Ga0495656_0171539 3300046615 Bacteria 1061
206 Ga0495668_0056340 3300046616 Bacteria 2169
207 Ga0495668_0083798 3300046616 Bacteria 1748
208 Ga0495634_0021581 3300046642 Bacteria 4548
209 Ga0495611_0007706 3300046648 Bacteria 4573
210 Ga0495611_0018761 3300046648 Bacteria 2967
211 Ga0495611_0449612 3300046648 Bacteria 587
212 Ga0495625_0151802 3300046660 Bacteria 1557
213 Ga0495635_0002772 3300046663 Bacteria 12017
214 Ga0495635_0153361 3300046663 Bacteria 1568
215 Ga0495635_0361238 3300046663 Bacteria 968
216 Ga0495661_0040388 3300046665 Bacteria 2893
217 Ga0495661_0045748 3300046665 Bacteria 2675
218 Ga0495661_0414728 3300046665 Bacteria 653
219 Ga0495588_0002219 3300046674 Bacteria 8316
220 Ga0495588_0018518 3300046674 Bacteria 3397
221 Ga0495588_0092994 3300046674 Bacteria 1580
222 Ga0495657_0046358 3300046675 Bacteria 2943
223 Ga0495657_0082795 3300046675 Bacteria 2072
224 Ga0495657_0370460 3300046675 Bacteria 845
225 Ga0495623_0008170 3300046679 Bacteria 6805
226 Ga0495646_0097325 3300046680 Bacteria 1691
227 Ga0495646_0121120 3300046680 Bacteria 1480
228 Ga0495613_0001119 3300046689 Bacteria 20415
229 Ga0495613_0010768 3300046689 Bacteria 6784
230 Ga0495613_0059758 3300046689 Bacteria 2793
231 Ga0495613_0061337 3300046689 Bacteria 2753
232 Ga0495613_0102146 3300046689 Bacteria 2070
233 Ga0495613_0235446 3300046689 Bacteria 1281
234 Ga0495613_0419158 3300046689 Bacteria 911
235 Ga0495624_0324835 3300046690 Bacteria 926
236 Ga0495670_0022614 3300046691 Bacteria 3105
237 Ga0495670_0061049 3300046691 Bacteria 1895
238 Ga0495671_0046000 3300046692 Bacteria 2183
239 Ga0495671_0057429 3300046692 Bacteria 1926
240 Ga0495671_0110782 3300046692 Bacteria 1341
241 Ga0495671_0138505 3300046692 Bacteria 1186
242 Ga0495671_0180960 3300046692 Bacteria 1024
243 Ga0495671_0256065 3300046692 Bacteria 845
244 Ga0495649_0049636 3300046694 Bacteria 2279
245 Ga0495649_0213084 3300046694 Bacteria 1000
246 Ga0495589_0012085 3300046794 Bacteria 4477
247 Ga0495589_0027799 3300046794 Bacteria 2858
248 Ga0495589_0030885 3300046794 Bacteria 2698
249 Ga0495589_0053113 3300046794 Bacteria 2000
250 Ga0495589_0062162 3300046794 Bacteria 1832
251 Ga0495589_0164930 3300046794 Bacteria 1054
252 Ga0495600_0029761 3300046809 Bacteria 3536
253 Ga0495600_0095120 3300046809 Bacteria 1942
254 Ga0495600_0144635 3300046809 Bacteria 1541
255 Ga0495660_0055036 3300046810 Bacteria 2154
256 Ga0495660_0105061 3300046810 Bacteria 1448
257 Ga0495581_0020124 3300047315 Bacteria 3874
258 Ga0495581_0051815 3300047315 Bacteria 2370
259 Ga0495581_0189195 3300047315 Bacteria 1204
260 Ga0495604_0003849 3300047317 Bacteria 11954
261 Ga0495604_0034076 3300047317 Bacteria 4029
262 Ga0495604_0057842 3300047317 Bacteria 2979
263 Ga0495636_0001057 3300047318 Bacteria 10339
264 Ga0495636_0030899 3300047318 Bacteria 2192
265 Ga0495636_0044254 3300047318 Bacteria 1853
266 Ga0495636_0125306 3300047318 Bacteria 1139
267 Ga0495636_0288715 3300047318 Bacteria 765
268 Ga0495674_0053802 3300047319 Bacteria 3537
269 Ga0495676_0022585 3300047321 Bacteria 5471
270 Ga0495676_0046245 3300047321 Bacteria 3534
271 Ga0495676_0081552 3300047321 Bacteria 2451
272 Ga0495676_0107520 3300047321 Bacteria 2053
273 Ga0495676_0145994 3300047321 Bacteria 1689
274 Ga0495676_0202979 3300047321 Bacteria 1376
275 Ga0495680_0003865 3300047322 Bacteria 14497
276 Ga0495683_0008343 3300047323 Bacteria 5551
277 Ga0495683_0020839 3300047323 Bacteria 3380
278 Ga0495683_0255444 3300047323 Bacteria 767
279 Ga0495687_012486 3300047443 Bacteria 4486
280 Ga0495687_037187 3300047443 Bacteria 2170
281 Ga0495675_0005829 3300047444 Bacteria 7526
282 Ga0495675_0067213 3300047444 Bacteria 2265
283 Ga0495675_0080016 3300047444 Bacteria 2058
284 Ga0495677_0027769 3300047445 Bacteria 2054
285 Ga0495679_110422 3300047446 Bacteria 757
286 Ga0495685_003473 3300047447 Bacteria 5033
287 Ga0495685_009384 3300047447 Bacteria 3266
288 Ga0495685_016414 3300047447 Bacteria 2529
289 Ga0495685_120976 3300047447 Bacteria 859
290 Ga0495685_124420 3300047447 Bacteria 845
291 Ga0495685_133904 3300047447 Bacteria 809
292 Ga0495681_0001749 3300047470 Bacteria 16021
293 Ga0495681_0010814 3300047470 Bacteria 5494
294 Ga0495681_0018085 3300047470 Bacteria 3892
295 Ga0495684_0150828 3300047471 Bacteria 1738
296 Ga0495686_0057805 3300047472 Bacteria 2420
297 Ga0495686_0087168 3300047472 Bacteria 1899
298 Ga0495686_0223975 3300047472 Bacteria 1068
299 Ga0495593_0002624 3300047673 Bacteria 10810
300 Ga0495593_0191464 3300047673 Bacteria 1029
301 Ga0495602_0366434 3300048088 Bacteria 1036
302 Ga0495614_0001484 3300048089 Bacteria 10158
303 Ga0495614_0009959 3300048089 Bacteria 4195
304 Ga0495614_0014753 3300048089 Bacteria 3417
305 Ga0495614_0073442 3300048089 Bacteria 1476
306 Ga0495614_0403353 3300048089 Bacteria 642
307 Ga0495614_0403354 3300048089 Bacteria 642
308 Ga0496106_0038793 3300048909 Bacteria 3566
309 Ga0496108_0069533 3300048911 Bacteria 2971
310 Ga0496109_0006599 3300048912 Bacteria 9772
311 Ga0496113_0465195 3300048916 Bacteria 1016
312 Ga0495678_108640 3300049459 Bacteria 949
313 Ga0501031_0007460 3300049568 Bacteria 7123
314 Ga0501031_0073394 3300049568 Bacteria 2227
315 Ga0501032_0007932 3300049569 Bacteria 7732
316 Ga0501033_0009636 3300049570 Bacteria 7432
317 Ga0501033_0106385 3300049570 Bacteria 2044
318 Ga0501033_0157897 3300049570 Bacteria 1633
319 Ga0501034_0002969 3300049571 Bacteria 19649
320 Ga0501034_0113910 3300049571 Bacteria 2693
321 Ga0501036_0005070 3300049572 Bacteria 10659
322 Ga0501036_0034621 3300049572 Bacteria 4273
323 Ga0501037_0010417 3300049573 Bacteria 6823
324 Ga0501037_0536190 3300049573 Bacteria 791
325 Ga0501038_0001654 3300049574 Bacteria 20719
326 Ga0501038_0003074 3300049574 Bacteria 15554
327 Ga0501039_0130760 3300049575 Bacteria 1970
328 Ga0501039_0161423 3300049575 Bacteria 1761
329 Ga0501040_0023000 3300049576 Bacteria 4176
330 Ga0501041_0007008 3300049577 Bacteria 6612
331 Ga0501042_0273953 3300049578 Bacteria 1218
332 Ga0501043_0002107 3300049579 Bacteria 16982
333 Ga0501046_0005014 3300049580 Bacteria 11888
334 Ga0501046_0188879 3300049580 Bacteria 1538
335 Ga0501047_0000577 3300049581 Bacteria 39081
336 Ga0501047_0017370 3300049581 Bacteria 6890
337 Ga0501047_0044712 3300049581 Bacteria 4280
338 Ga0501047_0255027 3300049581 Bacteria 1602
339 Ga0501048_0002104 3300049582 Bacteria 15177
340 Ga0501069_0261951 3300049585 Bacteria 1010
341 Ga0501070_0346029 3300049586 Bacteria 1207
342 Ga0501070_0621979 3300049586 Bacteria 859
343 Ga0501071_0001009 3300049587 Bacteria 15483
344 Ga0501072_0000779 3300049588 Bacteria 23322
345 Ga0501073_0056827 3300049589 Bacteria 2737
346 Ga0501074_0073209 3300049590 Bacteria 2461
347 Ga0501074_0333245 3300049590 Bacteria 1077
348 Ga0501076_0002946 3300049592 Bacteria 11800
349 Ga0501079_0009350 3300049741 Bacteria 7426
350 Ga0501080_0226479 3300049742 Bacteria 1709
351 Ga0501080_0279684 3300049742 Bacteria 1517
352 Ga0501083_0001149 3300049744 Bacteria 17806
353 Ga0501035_0002230 3300049822 Bacteria 19220
354 Ga0501035_0101620 3300049822 Bacteria 2523
355 Ga0501035_0353943 3300049822 Bacteria 1228
356 Ga0501035_1130903 3300049822 Bacteria 610
357 Ga0501044_0000883 3300049823 Bacteria 36150
358 Ga0501044_0002866 3300049823 Bacteria 19638
359 Ga0501044_0011498 3300049823 Bacteria 9589
360 Ga0501044_0028757 3300049823 Bacteria 5864
361 Ga0501044_0112804 3300049823 Bacteria 2725
362 Ga0501044_0212606 3300049823 Bacteria 1887
363 Ga0501045_0093222 3300049824 Bacteria 2227
364 nmdc:mga03n38_55621_c1 3300050490 Bacteria 1783
365 nmdc:mga0yw44_126320_c1 3300050492 Bacteria 1652
366 nmdc:mga07m45_586850_c1 3300050496 Bacteria 644
367 Ga0495612_0045745 3300053078 Bacteria 1792
368 Ga0500578_0037987 3300053086 Bacteria 3092
369 Ga0500644_0008353 3300053088 Bacteria 2731
370 Ga0500583_0122951 3300053092 Bacteria 1285
371 Ga0500566_0011136 3300053094 Bacteria 5299
372 Ga0500640_006474 3300053095 Bacteria 4474
373 Ga0500641_0189703 3300053096 Bacteria 880
374 Ga0500654_029120 3300053099 Bacteria 3360
375 Ga0500558_246316 3300053106 Bacteria 590
376 Ga0500560_005281 3300053107 Bacteria 2844
377 Ga0500560_043736 3300053107 Bacteria 1414
378 Ga0500569_002057 3300053109 Bacteria 3914
379 Ga0500572_004010 3300053111 Bacteria 3347
380 Ga0500614_045972 3300053123 Bacteria 1128
381 Ga0500628_001946 3300053129 Bacteria 3473
382 Ga0500652_009436 3300053131 Bacteria 3300
383 Ga0500658_0012540 3300053134 Bacteria 3128
384 Ga0500559_0328988 3300053136 Bacteria 716
385 Ga0500561_0000965 3300053137 Bacteria 4600
386 Ga0500573_0082160 3300053140 Bacteria 1830
387 Ga0500574_131006 3300053141 Bacteria 739
388 Ga0500577_0094131 3300053142 Bacteria 1216
389 Ga0500600_0023154 3300053149 Bacteria 3713
390 Ga0500600_0148033 3300053149 Bacteria 1172
391 Ga0500600_0151063 3300053149 Bacteria 1155
392 Ga0500603_024367 3300053150 Bacteria 1514
393 Ga0500616_0011791 3300053153 Bacteria 5142
394 Ga0500624_006266 3300053157 Bacteria 1605
395 Ga0500633_0001744 3300053160 Bacteria 4237
396 Ga0500634_0017299 3300053161 Bacteria 3860
397 Ga0500656_000239 3300053732 Bacteria 3665
398 Ga0500587_002079 3300053739 Bacteria 2861
399 Ga0501084_0005162 3300054114 Bacteria 10681
400 Ga0501084_1080824 3300054114 Bacteria 674
401 Ga0501082_0003379 3300060353 Bacteria 13925
402 Ga0466962_0030067 3300061719 Bacteria 2600
403 Ga0466962_0105762 3300061719 Bacteria 1353
404 Ga0466962_0174499 3300061719 Bacteria 1047
405 Ga0530510_0025602 3300061734 Bacteria 4220
406 2554255970 2554235005 Bacteria 6457341
407 2585302131 2582581312 Bacteria 7308206
408 2585307839 2582581313 Bacteria 10042643
409 2585316823 2582581314 Bacteria 11452267
410 2616700108 2616644814 Bacteria 11555299
411 2643762735 2643221548 Bacteria 8053412
412 2643899322 2643221578 Bacteria 9213798
413 2643943722 2643221587 Bacteria 7586415
414 2644269652 2643221647 Bacteria 10741251
415 2644387204 2643221670 Bacteria 6497041
416 2644406943 2643221673 Bacteria 9196637
417 2644434019 2643221677 Bacteria 7584031
418 2644629154 2643221714 Bacteria 9015452
419 2768647132 2767802112 Bacteria 6465194
420 2785340881 2784746763 Bacteria 9783172
421 2785371866 2784746768 Bacteria 10036182
422 2786672979 2786546132 Bacteria 10419719
423 2793982816 2791355406 Bacteria 11364898
424 2808913944 2808606375 Bacteria 9466072
425 2811844086 2808606982 Bacteria 7791042
426 2812478466 2811994917 Bacteria 7761064
427 2819698897 2818991463 Bacteria 7948711
428 2862284277 2862281513 Bacteria 9621493
429 2862294239 2862290372 Bacteria 7471434
430 2862386522 2862382967 Bacteria 10317375
431 2862514279 2862507626 Bacteria 9425308
432 2862577173 2862574272 Bacteria 10567477
433 2863408962 2863404153 Bacteria 9672205
434 2867350943 2867346516 Bacteria 7608576
435 2867374128 2867369537 Bacteria 6501581
436 2867433294 2867428634 Bacteria 9590268
437 2867477167 2867475112 Bacteria 6909112
438 2875397033 2875391855 Bacteria 7600475
439 2877678714 2877676314 Bacteria 9512378
440 2912717275 2912715099 Bacteria 9460473
441 2912729854 2912723979 Bacteria 8557534
442 2918506831 2918501144 Bacteria 8668083
443 2946047520 2946045630 Bacteria 8527308
444 2946078044 2946072368 Bacteria 8999607
445 2954383686 2954380949 Bacteria 10050426
446 2954679288 2954673503 Bacteria 9685905
447 2954684867 2954682443 Bacteria 9862841
448 2954694484 2954691527 Bacteria 10720516
449 2954709688 2954701450 Bacteria 10834262
450 2954713975 2954711539 Bacteria 10867210
451 2954723944 2954721474 Bacteria 10456478
452 2954737894 2954731030 Bacteria 10243860
453 2954742841 2954740390 Bacteria 10229294
454 2954756748 2954749733 Bacteria 10366972
455 2954761801 2954759201 Bacteria 9358192
456 2966600557 2966598605 Bacteria 7676064
457 2990045936 2990044586 Bacteria 6603797
458 2990088398 2990088156 Bacteria 6657676
459 2997455977 2997451912 Bacteria 8492419
460 2997606218 2997600082 Bacteria 9896405
461 3006394168 3006393351 Bacteria 6615579
462 8008487296 8008485437 Bacteria 7198341
463 8008563124 8008558824 Bacteria 10610750
464 8008576843 8008574985 Bacteria 7815457
465 8023626258 8023623736 Bacteria 8593882
466 8025485487 8025478263 Bacteria 8209203
467 8025526271 8025524527 Bacteria 7197316
468 8047895770 8047893842 Bacteria 11723082
469 8048135605 8048127548 Bacteria 11053136
470 8048363164 8048356638 Bacteria 11044339
471 8048372794 8048369669 Bacteria 11666822
472 8048381728 8048379754 Bacteria 11877923
473 Ga0501038_0223821
474 JGI24738J21930_10030345
475 rootH1_10089050
476 Ga0070670_100813312
477 Ga0070681_10442129
478 Ga0068853_100207606
479 Ga0068855_100155972
480 Ga0068856_100164198
481 Ga0081455_10070144
482 Ga0075365_10146398
483 Ga0075370_10094471
484 Ga0105250_10054436
485 Ga0105243_10504521
486 Ga0105238_10296607
487 Ga0105239_10305201
488 Ga0105246_10050240
489 Ga0157369_10334693
490 Ga0157372_10136543
491 Ga0182008_10002627
492 Ga0182007_10001609
493 Ga0183367_1013
494 Ga0213875_10002706
495 Ga0209758_1001931
496 Ga0207426_1004698
497 Ga0207426_1011895
498 Ga0207647_10020503
499 Ga0207709_10220943
500 Ga0207691_10408485
501 Ga0207667_10239192
502 Ga0207702_10108022
503 Ga0307517_10046442
504 Ga0307515_10160679
505 Ga0268256_1017068
506 Ga0307511_10013718
507 Ga0307512_10002763
508 Ga0307512_10017744
509 Ga0307513_10021535
510 Ga0307513_10308372
511 Ga0307508_10002014
512 Ga0307508_10003354
513 Ga0307508_10027776
514 Ga0307508_10047719
515 Ga0307508_10251109
516 Ga0307514_10064277
517 Ga0307514_10068120
518 Ga0307514_10072822
519 Ga0307516_10041811
520 Ga0307516_10075048
521 Ga0307516_10111727
522 Ga0307518_10097795
523 Ga0307518_10137224
524 Ga0307410_10144837
525 Ga0307410_10967042
526 Ga0307409_100214933
527 Ga0307416_101004678
528 Ga0307416_101302194
529 Ga0307416_101914486
530 Ga0307411_10131491
531 Ga0307507_10013905
532 Ga0307507_10125911
533 Ga0307510_10063001
534 Ga0307510_10251296
535 Ga0395900_0074862
536 Ga0395900_1229506
537 Ga0395898_0007411
538 Ga0436364_1263823
539 Ga0395901_0019315
540 Ga0439436_0003897
541 Ga0451849_0115485
542 Ga0451853_0254657
543 Ga0451853_3045339
544 Ga0439433_0038793
545 Ga0439448_0163923
546 Ga0439449_0070347
547 Ga0439449_0118725
548 Ga0439449_0177399
549 Ga0439457_000213
550 Ga0439462_0022248
551 Ga0439463_115917
552 Ga0450890_027492
553 Ga0450897_007398
554 Ga0450894_000614
555 Ga0450898_000734
556 Ga0450900_042966
557 Ga0450903_000124
558 Ga0439458_0001305
559 Ga0450908_006004
560 Ga0466969_0013287
561 Ga0466969_0031914
562 Ga0466972_0008208
563 Ga0466972_0019186
564 Ga0466972_0292406
565 Ga0466965_0002839
566 Ga0466966_0006551
567 Ga0466966_0069650
568 Ga0466961_0001365
569 Ga0466961_0050041
570 Ga0466963_0000146
571 Ga0466963_0092426
572 Ga0466963_0512424
573 Ga0466964_0034447
574 Ga0466964_0049268
575 Ga0466971_0000681
576 Ga0466971_0083829
577 Ga0466971_0131413
578 Ga0466968_0045781
579 Ga0466970_0001388
580 Ga0466957_0001009
581 Ga0466959_0001182
582 Ga0466959_0215697
583 Ga0466958_0001814
584 Ga0466958_0047842
585 Ga0466958_0377480
586 Ga0466967_0021830
587 Ga0466967_0042917
588 Ga0466967_0123593
589 Ga0495617_002127
590 Ga0495617_123336
591 Ga0495627_028159
592 Ga0495592_0024488
593 Ga0495603_0000260
594 Ga0495603_0017077
595 Ga0495603_0020582
596 Ga0495603_0035588
597 Ga0495603_0047167
598 Ga0495603_0599576
599 Ga0495590_0044377
600 Ga0495629_0005680
601 Ga0495629_0021532
602 Ga0495629_0041309
603 Ga0495629_0057571
604 Ga0495629_0063198
605 Ga0495629_0090744
606 Ga0495629_0098172
607 Ga0495629_0143313
608 Ga0495638_0027353
609 Ga0495638_0030285
610 Ga0495638_0030724
611 Ga0495651_0000524
612 Ga0495651_0113297
613 Ga0495580_0218696
614 Ga0495582_0094498
615 Ga0495582_0366929
616 Ga0495639_0137359
617 Ga0495639_0300097
618 Ga0495662_0015669
619 Ga0495662_0026141
620 Ga0495662_0339513
621 Ga0495664_0024529
622 Ga0495664_0508093
623 Ga0495584_0100974
624 Ga0495585_0010601
625 Ga0495585_0016823
626 Ga0495585_0046284
627 Ga0495585_0183665
628 Ga0495594_0000468
629 Ga0495594_0015862
630 Ga0495594_0045215
631 Ga0495594_0188873
632 Ga0495594_0281575
633 Ga0495594_0633655
634 Ga0495607_0026303
635 Ga0495607_0182471
636 Ga0495583_0022645
637 Ga0495583_0151326
638 Ga0495606_0012214
639 Ga0495618_0035584
640 Ga0495618_0077144
641 Ga0495620_0036242
642 Ga0495620_0039471
643 Ga0495628_0035435
644 Ga0495628_0094890
645 Ga0495630_0046909
646 Ga0495630_0108400
647 Ga0495631_0012167
648 Ga0495631_0071400
649 Ga0495632_0023483
650 Ga0495632_0065744
651 Ga0495637_0036639
652 Ga0495643_0007025
653 Ga0495643_0012445
654 Ga0495643_0164773
655 Ga0495644_0130911
656 Ga0495648_0038373
657 Ga0495666_0113567
658 Ga0495652_0014315
659 Ga0495652_0137508
660 Ga0495654_0025665
661 Ga0495640_0058705
662 Ga0495640_0106857
663 Ga0495640_0462248
664 Ga0495586_0367594
665 Ga0495587_0097654
666 Ga0495609_0026983
667 Ga0495597_0070887
668 Ga0495645_0028863
669 Ga0495645_0160933
670 Ga0495622_0045952
671 Ga0495622_0064830
672 Ga0495633_0013378
673 Ga0495633_0025900
674 Ga0495633_0068719
675 Ga0495667_0075833
676 Ga0495656_0160947
677 Ga0495656_0171539
678 Ga0495668_0056340
679 Ga0495668_0083798
680 Ga0495634_0021581
681 Ga0495611_0007706
682 Ga0495611_0018761
683 Ga0495611_0449612
684 Ga0495625_0151802
685 Ga0495635_0002772
686 Ga0495635_0153361
687 Ga0495635_0361238
688 Ga0495661_0040388
689 Ga0495661_0045748
690 Ga0495661_0414728
691 Ga0495588_0002219
692 Ga0495588_0018518
693 Ga0495588_0092994
694 Ga0495657_0046358
695 Ga0495657_0082795
696 Ga0495657_0370460
697 Ga0495623_0008170
698 Ga0495646_0097325
699 Ga0495646_0121120
700 Ga0495613_0001119
701 Ga0495613_0010768
702 Ga0495613_0059758
703 Ga0495613_0061337
704 Ga0495613_0102146
705 Ga0495613_0235446
706 Ga0495613_0419158
707 Ga0495624_0324835
708 Ga0495670_0022614
709 Ga0495670_0061049
710 Ga0495671_0046000
711 Ga0495671_0057429
712 Ga0495671_0110782
713 Ga0495671_0138505
714 Ga0495671_0180960
715 Ga0495671_0256065
716 Ga0495649_0049636
717 Ga0495649_0213084
718 Ga0495589_0012085
719 Ga0495589_0027799
720 Ga0495589_0030885
721 Ga0495589_0053113
722 Ga0495589_0062162
723 Ga0495589_0164930
724 Ga0495600_0029761
725 Ga0495600_0095120
726 Ga0495600_0144635
727 Ga0495660_0055036
728 Ga0495660_0105061
729 Ga0495581_0020124
730 Ga0495581_0051815
731 Ga0495581_0189195
732 Ga0495604_0003849
733 Ga0495604_0034076
734 Ga0495604_0057842
735 Ga0495636_0001057
736 Ga0495636_0030899
737 Ga0495636_0044254
738 Ga0495636_0125306
739 Ga0495636_0288715
740 Ga0495674_0053802
741 Ga0495676_0022585
742 Ga0495676_0046245
743 Ga0495676_0081552
744 Ga0495676_0107520
745 Ga0495676_0145994
746 Ga0495676_0202979
747 Ga0495680_0003865
748 Ga0495683_0008343
749 Ga0495683_0020839
750 Ga0495683_0255444
751 Ga0495687_012486
752 Ga0495687_037187
753 Ga0495675_0005829
754 Ga0495675_0067213
755 Ga0495675_0080016
756 Ga0495677_0027769
757 Ga0495679_110422
758 Ga0495685_003473
759 Ga0495685_009384
760 Ga0495685_016414
761 Ga0495685_120976
762 Ga0495685_124420
763 Ga0495685_133904
764 Ga0495681_0001749
765 Ga0495681_0010814
766 Ga0495681_0018085
767 Ga0495684_0150828
768 Ga0495686_0057805
769 Ga0495686_0087168
770 Ga0495686_0223975
771 Ga0495593_0002624
772 Ga0495593_0191464
773 Ga0495602_0366434
774 Ga0495614_0001484
775 Ga0495614_0009959
776 Ga0495614_0014753
777 Ga0495614_0073442
778 Ga0495614_0403353
779 Ga0495614_0403354
780 Ga0496106_0038793
781 Ga0496108_0069533
782 Ga0496109_0006599
783 Ga0496113_0465195
784 Ga0495678_108640
785 Ga0501031_0007460
786 Ga0501031_0073394
787 Ga0501032_0007932
788 Ga0501033_0009636
789 Ga0501033_0106385
790 Ga0501033_0157897
791 Ga0501034_0002969
792 Ga0501034_0113910
793 Ga0501036_0005070
794 Ga0501036_0034621
795 Ga0501037_0010417
796 Ga0501037_0536190
797 Ga0501038_0001654
798 Ga0501038_0003074
799 Ga0501039_0130760
800 Ga0501039_0161423
801 Ga0501040_0023000
802 Ga0501041_0007008
803 Ga0501042_0273953
804 Ga0501043_0002107
805 Ga0501046_0005014
806 Ga0501046_0188879
807 Ga0501047_0000577
808 Ga0501047_0017370
809 Ga0501047_0044712
810 Ga0501047_0255027
811 Ga0501048_0002104
812 Ga0501069_0261951
813 Ga0501070_0346029
814 Ga0501070_0621979
815 Ga0501071_0001009
816 Ga0501072_0000779
817 Ga0501073_0056827
818 Ga0501074_0073209
819 Ga0501074_0333245
820 Ga0501076_0002946
821 Ga0501079_0009350
822 Ga0501080_0226479
823 Ga0501080_0279684
824 Ga0501083_0001149
825 Ga0501035_0002230
826 Ga0501035_0101620
827 Ga0501035_0353943
828 Ga0501035_1130903
829 Ga0501044_0000883
830 Ga0501044_0002866
831 Ga0501044_0011498
832 Ga0501044_0028757
833 Ga0501044_0112804
834 Ga0501044_0212606
835 Ga0501045_0093222
836 nmdc:mga03n38_55621_c1
837 nmdc:mga0yw44_126320_c1
838 nmdc:mga07m45_586850_c1
839 Ga0495612_0045745
840 Ga0500578_0037987
841 Ga0500644_0008353
842 Ga0500583_0122951
843 Ga0500566_0011136
844 Ga0500640_006474
845 Ga0500641_0189703
846 Ga0500654_029120
847 Ga0500558_246316
848 Ga0500560_005281
849 Ga0500560_043736
850 Ga0500569_002057
851 Ga0500572_004010
852 Ga0500614_045972
853 Ga0500628_001946
854 Ga0500652_009436
855 Ga0500658_0012540
856 Ga0500559_0328988
857 Ga0500561_0000965
858 Ga0500573_0082160
859 Ga0500574_131006
860 Ga0500577_0094131
861 Ga0500600_0023154
862 Ga0500600_0148033
863 Ga0500600_0151063
864 Ga0500603_024367
865 Ga0500616_0011791
866 Ga0500624_006266
867 Ga0500633_0001744
868 Ga0500634_0017299
869 Ga0500656_000239
870 Ga0500587_002079
871 Ga0501084_0005162
872 Ga0501084_1080824
873 Ga0501082_0003379
874 Ga0466962_0030067
875 Ga0466962_0105762
876 Ga0466962_0174499
877 Ga0530510_0025602
878 2554255970
879 2585302131
880 2585307839
881 2585316823
882 2616700108
883 2643762735
884 2643899322
885 2643943722
886 2644269652
887 2644387204
888 2644406943
889 2644434019
890 2644629154
891 2768647132
892 2785340881
893 2785371866
894 2786672979
895 2793982816
896 2808913944
897 2811844086
898 2812478466
899 2819698897
900 2862284277
901 2862294239
902 2862386522
903 2862514279
904 2862577173
905 2863408962
906 2867350943
907 2867374128
908 2867433294
909 2867477167
910 2875397033
911 2877678714
912 2912717275
913 2912729854
914 2918506831
915 2946047520
916 2946078044
917 2954383686
918 2954679288
919 2954684867
920 2954694484
921 2954709688
922 2954713975
923 2954723944
924 2954737894
925 2954742841
926 2954756748
927 2954761801
928 2966600557
929 2990045936
930 2990088398
931 2997455977
932 2997606218
933 3006394168
934 8008487296
935 8008563124
936 8008576843
937 8023626258
938 8025485487
939 8025526271
940 8047895770
941 8048135605
942 8048363164
943 8048372794
944 8048381728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

99

165

0.85

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

92

165

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

31

156

0.78

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

55

158

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8438 62 133
3bln-assembly1.cif.gz_A-2 crystal structure of acetyltransferase gnat family (np_981174.1) from bacillus cereus atcc 10987 at 1.31 a resolution 0.8054 15 182
3ddd-assembly1.cif.gz_A crystal structure of a putative acetyltransferase (np_142035.1) from pyrococcus horikoshii at 2.25 a resolution 0.8028 1 162
2evn-assembly1.cif.gz_A nmr solution structures of at1g77540 0.7929 73 133
2r7h-assembly1.cif.gz_A crystal structure of a putative acetyltransferase of the gnat family (dde_3044) from desulfovibrio desulfuricans subsp. at 1.85 a resolution 0.7924 15 182
ID Description Score Start End Superfamily
af_O53504_27_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9173 39 169 3.40.630.30
5i0cA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8438 62 133 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8307 108 182 3.40.630.30
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8263 16 181 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8133 26 180 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0C5GI21-F1-model_v4 Acetyltransferase 0.9879 14 188 GO:0016747
AF-A0A2A2ZAD7-F1-model_v4 deleted 0.9861 14 187
AF-A0A7W5F584-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9861 14 188 GO:0005840
GO:0016747
AF-A0A160P5F4-F1-model_v4 Acetyltransferase 0.9858 15 188 GO:0016747
AF-A0A4Q7WL46-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9856 14 188 GO:0016747

Map