F450829

General Info

Members Datasets Scaffolds Average Seq Length
472 203 448 596

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100000060|Ga0307408_10000006062
Length 577
Sequence MTTNGFSYPRPQLVRENWFSLNGIWKFSFDDENQLTELSDATQWPLEILVPFAPESKASGIGSQDFHHACWYQREFQLFKGGQRVLLHFGAVDYRARVWVNGHLVAEHEGGHTPFTADITCALGDVENHVVTVYAEDDPHDLAKPRGKQDWQLEGIWQTVWLECVAATYIQKIRWTPNFDGFEIGCETVIAGEIKGNLAVQVRILHNGKLLADDHYKIFGAEAARKISLSDPGIDDSRNELLWCPERPTLLDAEIILWRDGAMIDKVYSYTALRSAHINRDRFMLNGRPYFLRLVLDQGYWPDTLMTAPSDEALRRDVELAKAMGFNGVRKHQKIEDPRYLYWADKLGLLVWEEMPSAYRFTPTAVRRLVREWAEVIERDYNHPCIIVWVPFNESWGVPNLTSTQAHRNAVEALYHLTCTFDSTRPVIGNDGWEASATDIIGIHDYDANPQSLAARYGSPAPQELFDRRRPGGRILTLDGYPHRGQPIVLTEFGGIAYAKPQTGDGDKIWGYSQVFSDEEYFHRYRDLLQVVNETTLFSGFCYTQFADTFQEANGLLFADRTPKLPLDKIAFSTRGN

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
5 2643221638 Duganella sp. Root336D2 Isolate Unclassified
6 2643221645 Massilia sp. Root351 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2643221684 Massilia sp. Root133 Isolate Unclassified
9 2738541280 Massilia sp. GV090 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738543018 Massilia sp. GV045 Isolate Unclassified
12 2738543030 Massilia sp. GV097 Isolate Unclassified
13 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
14 2821131069 Duganella sp. 1224 Isolate Unclassified
15 2842711865 Duganella sp. R-73148 Isolate Unclassified
16 2857553236 Duganella sp. R-74557 Isolate Unclassified
17 2857558681 Duganella sp. R-74565 Isolate Unclassified
18 2857564685 Duganella sp. R-74599 Isolate Unclassified
19 2904424332 Duganella sp. 1411 Isolate Rhizosphere
20 2919476304 Duganella sp. 3397 Isolate Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
27 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
88 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
103 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
200 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
201 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.86
Metatranscriptomes 1.06
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.04
Nodule 0.42
Rhizoplane 2.75
Rhizosphere 73.09
Stem 0
Stem Tuber 0
Unclassified 8.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000356 3300002738 Bacteria 25874
2 JGI25158J39367_1002380 3300002739 Bacteria 3066
3 JGI25150J39212_1000117 3300002774 Bacteria 45175
4 JGI25150J39212_1001264 3300002774 Bacteria 7280
5 JGI25150J39212_1001933 3300002774 Bacteria 5438
6 JGI25159J45721_1001070 3300002987 Bacteria 11700
7 JGI25159J45721_1001146 3300002987 Bacteria 11321
8 rootH1_10070101 3300003323 Bacteria 11968
9 JGI25161J50226_1000266 3300003374 Bacteria 30738
10 Ga0007416J51690_1032490 3300003577 Bacteria 3511
11 Ga0007416J51690_1070779 3300003577 Bacteria 3035
12 Ga0055525_1000006 3300003759 Bacteria 642912
13 Ga0055529_1000341 3300003763 Bacteria 52197
14 Ga0055526_1000028 3300003771 Bacteria 150301
15 Ga0055526_1000911 3300003771 Bacteria 21980
16 Ga0055526_1001174 3300003771 Bacteria 18972
17 Ga0055526_1007706 3300003771 Bacteria 5531
18 Ga0055537_1000077 3300003773 Bacteria 70424
19 Ga0055537_1002996 3300003773 Bacteria 5343
20 Ga0055524_1000010 3300003775 Bacteria 282893
21 Ga0055524_1000322 3300003775 Bacteria 45133
22 Ga0055524_1001062 3300003775 Bacteria 16934
23 Ga0055534_1000139 3300003784 Bacteria 54768
24 Ga0055534_1006875 3300003784 Bacteria 2800
25 Ga0055528_1000011 3300003790 Bacteria 218512
26 Ga0055528_1009174 3300003790 Bacteria 4159
27 Ga0055530_10000499 3300003791 Bacteria 34011
28 Ga0055531_10013606 3300003794 Bacteria 3736
29 Ga0055543_1000339 3300004625 Bacteria 31976
30 Ga0065165_1000007 3300005262 Bacteria 337871
31 Ga0065165_1001110 3300005262 Bacteria 31976
32 Ga0065165_1001321 3300005262 Bacteria 27639
33 Ga0070670_100029798 3300005331 Bacteria 4701
34 Ga0070670_100154513 3300005331 Bacteria 1987
35 Ga0068868_100102678 3300005338 Bacteria 2315
36 Ga0070668_100003342 3300005347 Bacteria 11827
37 Ga0070668_100114465 3300005347 Bacteria 2149
38 Ga0070673_100018531 3300005364 Bacteria 4974
39 Ga0075362_10033547 3300006177 Bacteria 2233
40 Ga0075370_10005496 3300006353 Bacteria 6309
41 Ga0099826_10000002 3300006948 Bacteria 1125830
42 Ga0105244_10033422 3300009036 Bacteria 2711
43 Ga0105243_10003968 3300009148 Bacteria 11805
44 Ga0105243_10011212 3300009148 Bacteria 6781
45 Ga0105248_10143469 3300009177 Bacteria 2694
46 Ga0157371_10000014 3300013102 Bacteria 347490
47 Ga0163162_10098163 3300013306 Bacteria 3018
48 Ga0182008_10000303 3300014497 Bacteria 38737
49 Ga0182006_1000004 3300015261 Bacteria 622190
50 Ga0182006_1000042 3300015261 Bacteria 202969
51 Ga0182007_10000018 3300015262 Bacteria 198916
52 Ga0182005_1000008 3300015265 Bacteria 471394
53 Ga0182005_1000011 3300015265 Bacteria 420605
54 Ga0163161_10024659 3300017792 Bacteria 4251
55 Ga0206356_11281754 3300020070 Bacteria 4126
56 Ga0213872_10018520 3300021361 Bacteria 3211
57 Ga0213872_10018948 3300021361 Bacteria 3171
58 Ga0209436_100178 3300025208 Bacteria 30007
59 Ga0209436_104380 3300025208 Bacteria 3505
60 Ga0209563_100022 3300025230 Bacteria 643318
61 Ga0207425_1000001 3300025245 Bacteria 2525432
62 Ga0207425_1000067 3300025245 Bacteria 124459
63 Ga0207425_1000156 3300025245 Bacteria 57676
64 Ga0209646_1000023 3300025246 Bacteria 441100
65 Ga0209148_1000514 3300025254 Bacteria 38623
66 Ga0209129_1000003 3300025258 Bacteria 903689
67 Ga0209565_1000003 3300025263 Bacteria 1099648
68 Ga0209565_1000665 3300025263 Bacteria 21915
69 Ga0209565_1002783 3300025263 Bacteria 6057
70 Ga0209455_1000037 3300025272 Bacteria 464097
71 Ga0209673_1000003 3300025273 Bacteria 980859
72 Ga0209673_1013276 3300025273 Bacteria 3261
73 Ga0209130_1000047 3300025284 Bacteria 234691
74 Ga0209130_1000059 3300025284 Bacteria 204772
75 Ga0209675_1000003 3300025291 Bacteria 1003982
76 Ga0209675_1001696 3300025291 Bacteria 12210
77 Ga0209675_1006596 3300025291 Bacteria 4622
78 Ga0209025_1003818 3300025294 Bacteria 13753
79 Ga0209564_1000011 3300025295 Bacteria 822327
80 Ga0209564_1000012 3300025295 Bacteria 792078
81 Ga0209564_1000142 3300025295 Bacteria 178742
82 Ga0209564_1003654 3300025295 Bacteria 10193
83 Ga0209564_1005524 3300025295 Bacteria 7167
84 Ga0209758_1000020 3300025297 Bacteria 734220
85 Ga0209758_1000271 3300025297 Bacteria 102935
86 Ga0209050_1000058 3300025298 Bacteria 325558
87 Ga0209050_1000654 3300025298 Bacteria 53586
88 Ga0209050_1001112 3300025298 Bacteria 32536
89 Ga0209050_1001305 3300025298 Bacteria 28023
90 Ga0209256_1000007 3300025299 Bacteria 1136599
91 Ga0209256_1000029 3300025299 Bacteria 415922
92 Ga0209256_1000201 3300025299 Bacteria 112637
93 Ga0209256_1000875 3300025299 Bacteria 37255
94 Ga0209256_1002175 3300025299 Bacteria 16836
95 Ga0207426_1009496 3300025302 Bacteria 3845
96 Ga0209257_1000003 3300025304 Bacteria 1702593
97 Ga0207682_10005016 3300025893 Bacteria 5429
98 Ga0207705_10004165 3300025909 Bacteria 10970
99 Ga0207705_10092410 3300025909 Bacteria 2217
100 Ga0207654_10017712 3300025911 Bacteria 3730
101 Ga0207649_10032853 3300025920 Bacteria 3096
102 Ga0207650_10008699 3300025925 Bacteria 6930
103 Ga0207700_10002326 3300025928 Bacteria 10898
104 Ga0207665_10034778 3300025939 Bacteria 3343
105 Ga0207677_10112093 3300026023 Bacteria 2033
106 Ga0207648_10003379 3300026089 Bacteria 16765
107 Ga0207683_10007122 3300026121 Bacteria 9587
108 Ga0210000_1001687 3300027462 Bacteria 3117
109 Ga0209282_1000001 3300027666 Bacteria 2450367
110 Ga0209971_1001976 3300027682 Bacteria 4998
111 Ga0209974_10012307 3300027876 Bacteria 2861
112 Ga0307515_10135496 3300028794 Bacteria 2681
113 Ga0307408_100000060 3300031548 Bacteria 132341
114 Ga0307408_100000082 3300031548 Bacteria 106847
115 Ga0307408_100001091 3300031548 Bacteria 20747
116 Ga0395899_0000315 3300037312 Bacteria 61724
117 Ga0395899_0002512 3300037312 Bacteria 14872
118 Ga0395900_0000202 3300037418 Bacteria 93773
119 Ga0395900_0026243 3300037418 Bacteria 5965
120 Ga0395901_0000019 3300038443 Bacteria 317063
121 Ga0395901_0039784 3300038443 Bacteria 4866
122 Ga0395901_0169540 3300038443 Bacteria 2290
123 Ga0436361_0508408 3300039447 Bacteria 6723
124 Ga0436361_0889029 3300039447 Bacteria 11578
125 Ga0450904_000350 3300042139 Bacteria 9605
126 Ga0466972_0000211 3300044658 Bacteria 41532
127 Ga0466972_0007819 3300044658 Bacteria 5364
128 Ga0466964_0000713 3300044706 Bacteria 10748
129 Ga0466968_0000228 3300044735 Bacteria 17591
130 Ga0466959_0073810 3300045049 Bacteria 2467
131 Ga0466967_0140085 3300045976 Bacteria 2252
132 Ga0495617_000015 3300046452 Bacteria 260968
133 Ga0495617_000137 3300046452 Bacteria 48315
134 Ga0495627_000005 3300046453 Bacteria 630805
135 Ga0495627_000106 3300046453 Bacteria 102596
136 Ga0495627_001537 3300046453 Bacteria 13206
137 Ga0495627_002747 3300046453 Bacteria 8195
138 Ga0495603_0002805 3300046455 Bacteria 10290
139 Ga0495590_0000059 3300046457 Bacteria 92114
140 Ga0495590_0006771 3300046457 Bacteria 4454
141 Ga0495591_000079 3300046458 Bacteria 109302
142 Ga0495629_0009662 3300046459 Bacteria 7045
143 Ga0495653_0000005 3300046463 Bacteria 367438
144 Ga0495653_0010187 3300046463 Bacteria 7692
145 Ga0495653_0011945 3300046463 Bacteria 7092
146 Ga0495653_0045711 3300046463 Bacteria 3393
147 Ga0495653_0069534 3300046463 Bacteria 2637
148 Ga0495650_0000019 3300046471 Bacteria 533849
149 Ga0495650_0000152 3300046471 Bacteria 156983
150 Ga0495650_0000170 3300046471 Bacteria 143177
151 Ga0495650_0000344 3300046471 Bacteria 83050
152 Ga0495650_0000408 3300046471 Bacteria 70787
153 Ga0495650_0001715 3300046471 Bacteria 20119
154 Ga0495650_0016771 3300046471 Bacteria 3695
155 Ga0495580_0037114 3300046472 Bacteria 3498
156 Ga0495582_0006526 3300046473 Bacteria 6474
157 Ga0495582_0034196 3300046473 Bacteria 2794
158 Ga0495605_0000021 3300046474 Bacteria 248512
159 Ga0495605_0000065 3300046474 Bacteria 139441
160 Ga0495605_0000068 3300046474 Bacteria 137743
161 Ga0495605_0001349 3300046474 Bacteria 16210
162 Ga0495584_0000257 3300046491 Bacteria 37841
163 Ga0495584_0000903 3300046491 Bacteria 18966
164 Ga0495584_0014112 3300046491 Bacteria 4071
165 Ga0495585_0000094 3300046492 Bacteria 94735
166 Ga0495585_0000154 3300046492 Bacteria 73681
167 Ga0495585_0000547 3300046492 Bacteria 35540
168 Ga0495585_0002755 3300046492 Bacteria 12247
169 Ga0495585_0005302 3300046492 Bacteria 8141
170 Ga0495585_0008240 3300046492 Bacteria 6327
171 Ga0495585_0013794 3300046492 Bacteria 4721
172 Ga0495585_0014694 3300046492 Bacteria 4554
173 Ga0495585_0023559 3300046492 Bacteria 3532
174 Ga0495594_0033553 3300046499 Bacteria 2791
175 Ga0495596_0000293 3300046500 Bacteria 33171
176 Ga0495596_0001052 3300046500 Bacteria 16406
177 Ga0495596_0001494 3300046500 Bacteria 13375
178 Ga0495596_0002882 3300046500 Bacteria 8952
179 Ga0495596_0006016 3300046500 Bacteria 5661
180 Ga0495607_0001503 3300046501 Bacteria 20575
181 Ga0495607_0002424 3300046501 Bacteria 15219
182 Ga0495607_0004233 3300046501 Bacteria 10641
183 Ga0495607_0008909 3300046501 Bacteria 6833
184 Ga0495607_0025916 3300046501 Bacteria 3640
185 Ga0495583_0000130 3300046506 Bacteria 126298
186 Ga0495583_0000213 3300046506 Bacteria 97714
187 Ga0495583_0000250 3300046506 Bacteria 88815
188 Ga0495583_0000485 3300046506 Bacteria 58196
189 Ga0495583_0000601 3300046506 Bacteria 48898
190 Ga0495583_0003017 3300046506 Bacteria 13428
191 Ga0495606_0000118 3300046507 Bacteria 134504
192 Ga0495606_0000179 3300046507 Bacteria 111712
193 Ga0495606_0000224 3300046507 Bacteria 100442
194 Ga0495606_0000337 3300046507 Bacteria 80941
195 Ga0495606_0000380 3300046507 Bacteria 75389
196 Ga0495606_0000460 3300046507 Bacteria 66820
197 Ga0495606_0001085 3300046507 Bacteria 38987
198 Ga0495606_0001539 3300046507 Bacteria 30430
199 Ga0495606_0002181 3300046507 Bacteria 23504
200 Ga0495606_0005709 3300046507 Bacteria 11775
201 Ga0495606_0012265 3300046507 Bacteria 6894
202 Ga0495606_0014288 3300046507 Bacteria 6208
203 Ga0495606_0023431 3300046507 Bacteria 4472
204 Ga0495606_0028678 3300046507 Bacteria 3922
205 Ga0495610_0001107 3300046512 Bacteria 24535
206 Ga0495610_0002181 3300046512 Bacteria 16608
207 Ga0495610_0012184 3300046512 Bacteria 5193
208 Ga0495616_0000046 3300046513 Bacteria 112021
209 Ga0495616_0000147 3300046513 Bacteria 61479
210 Ga0495616_0005134 3300046513 Bacteria 8127
211 Ga0495616_0005837 3300046513 Bacteria 7517
212 Ga0495616_0010214 3300046513 Bacteria 5446
213 Ga0495616_0011636 3300046513 Bacteria 5032
214 Ga0495620_0015306 3300046515 Bacteria 3876
215 Ga0495630_0084241 3300046517 Bacteria 2400
216 Ga0495631_0000238 3300046518 Bacteria 37846
217 Ga0495631_0005499 3300046518 Bacteria 6623
218 Ga0495631_0030202 3300046518 Bacteria 2459
219 Ga0495632_0000061 3300046519 Bacteria 120049
220 Ga0495632_0000231 3300046519 Bacteria 55954
221 Ga0495632_0001054 3300046519 Bacteria 23647
222 Ga0495632_0004674 3300046519 Bacteria 9244
223 Ga0495637_0000011 3300046520 Bacteria 337279
224 Ga0495637_0000436 3300046520 Bacteria 30423
225 Ga0495643_0000258 3300046522 Bacteria 78084
226 Ga0495643_0000600 3300046522 Bacteria 43431
227 Ga0495643_0001430 3300046522 Bacteria 22061
228 Ga0495643_0006621 3300046522 Bacteria 7609
229 Ga0495643_0010028 3300046522 Bacteria 5846
230 Ga0495643_0029283 3300046522 Bacteria 3082
231 Ga0495644_0004958 3300046523 Bacteria 5220
232 Ga0495648_0000079 3300046524 Bacteria 126099
233 Ga0495648_0000200 3300046524 Bacteria 69169
234 Ga0495648_0001316 3300046524 Bacteria 24609
235 Ga0495648_0017608 3300046524 Bacteria 5099
236 Ga0495648_0019236 3300046524 Bacteria 4810
237 Ga0495648_0030319 3300046524 Bacteria 3578
238 Ga0495663_0002067 3300046525 Bacteria 6146
239 Ga0495666_0002223 3300046526 Bacteria 9664
240 Ga0495666_0008809 3300046526 Bacteria 5053
241 Ga0495642_0000182 3300046528 Bacteria 37089
242 Ga0495642_0002023 3300046528 Bacteria 8452
243 Ga0495642_0003178 3300046528 Bacteria 6517
244 Ga0495642_0006240 3300046528 Bacteria 4575
245 Ga0495642_0006696 3300046528 Bacteria 4422
246 Ga0495652_0037855 3300046529 Bacteria 4183
247 Ga0495654_0000038 3300046530 Bacteria 185693
248 Ga0495654_0007446 3300046530 Bacteria 6115
249 Ga0495654_0012707 3300046530 Bacteria 4520
250 Ga0495654_0023626 3300046530 Bacteria 3182
251 Ga0495654_0027338 3300046530 Bacteria 2926
252 Ga0495665_0003028 3300046531 Bacteria 9081
253 Ga0495665_0016457 3300046531 Bacteria 3985
254 Ga0495587_0003241 3300046536 Bacteria 10876
255 Ga0495587_0034507 3300046536 Bacteria 3050
256 Ga0495609_0000026 3300046538 Bacteria 251973
257 Ga0495609_0000229 3300046538 Bacteria 53704
258 Ga0495609_0001529 3300046538 Bacteria 15209
259 Ga0495609_0023690 3300046538 Bacteria 2820
260 Ga0495609_0024787 3300046538 Bacteria 2750
261 Ga0495597_0000021 3300046542 Bacteria 157613
262 Ga0495597_0000177 3300046542 Bacteria 56690
263 Ga0495597_0000652 3300046542 Bacteria 28170
264 Ga0495597_0000737 3300046542 Bacteria 26116
265 Ga0495597_0000913 3300046542 Bacteria 22894
266 Ga0495597_0001102 3300046542 Bacteria 20452
267 Ga0495597_0002468 3300046542 Bacteria 11681
268 Ga0495597_0002726 3300046542 Bacteria 10895
269 Ga0495622_0014120 3300046557 Bacteria 3707
270 Ga0495633_0000198 3300046558 Bacteria 76860
271 Ga0495633_0000455 3300046558 Bacteria 42004
272 Ga0495633_0000602 3300046558 Bacteria 34540
273 Ga0495633_0002196 3300046558 Bacteria 13973
274 Ga0495633_0004712 3300046558 Bacteria 8572
275 Ga0495633_0005426 3300046558 Bacteria 7802
276 Ga0495656_0006975 3300046615 Bacteria 3976
277 Ga0495668_0000020 3300046616 Bacteria 411641
278 Ga0495668_0000137 3300046616 Bacteria 111150
279 Ga0495668_0000316 3300046616 Bacteria 66381
280 Ga0495668_0001174 3300046616 Bacteria 26668
281 Ga0495668_0005154 3300046616 Bacteria 8973
282 Ga0495668_0030674 3300046616 Bacteria 3034
283 Ga0495634_0003814 3300046642 Bacteria 11979
284 Ga0495611_0000062 3300046648 Bacteria 75510
285 Ga0495611_0005880 3300046648 Bacteria 5234
286 Ga0495611_0009273 3300046648 Bacteria 4155
287 Ga0495611_0018964 3300046648 Bacteria 2953
288 Ga0495611_0026567 3300046648 Bacteria 2525
289 Ga0495625_0001866 3300046660 Bacteria 23958
290 Ga0495625_0010893 3300046660 Bacteria 7470
291 Ga0495625_0011360 3300046660 Bacteria 7268
292 Ga0495625_0047883 3300046660 Bacteria 3081
293 Ga0495659_0000053 3300046664 Bacteria 51215
294 Ga0495661_0000177 3300046665 Bacteria 73486
295 Ga0495661_0000408 3300046665 Bacteria 45688
296 Ga0495661_0000674 3300046665 Bacteria 34087
297 Ga0495661_0003206 3300046665 Bacteria 12215
298 Ga0495661_0004966 3300046665 Bacteria 9503
299 Ga0495661_0011169 3300046665 Bacteria 6095
300 Ga0495661_0016989 3300046665 Bacteria 4808
301 Ga0495661_0068955 3300046665 Bacteria 2073
302 Ga0495661_0075520 3300046665 Bacteria 1958
303 Ga0495588_0000435 3300046674 Bacteria 21447
304 Ga0495588_0005927 3300046674 Bacteria 5478
305 Ga0495588_0021301 3300046674 Bacteria 3193
306 Ga0495588_0030474 3300046674 Bacteria 2711
307 Ga0495599_0070664 3300046678 Bacteria 2179
308 Ga0495623_0013632 3300046679 Bacteria 5268
309 Ga0495623_0070730 3300046679 Bacteria 2173
310 Ga0495669_0000111 3300046684 Bacteria 52862
311 Ga0495669_0000804 3300046684 Bacteria 13413
312 Ga0495624_0003979 3300046690 Bacteria 10875
313 Ga0495670_0000381 3300046691 Bacteria 21133
314 Ga0495670_0000485 3300046691 Bacteria 18807
315 Ga0495670_0000921 3300046691 Bacteria 14197
316 Ga0495670_0002608 3300046691 Bacteria 8903
317 Ga0495670_0008495 3300046691 Bacteria 5053
318 Ga0495670_0008986 3300046691 Bacteria 4915
319 Ga0495671_0000006 3300046692 Bacteria 500471
320 Ga0495671_0000009 3300046692 Bacteria 369875
321 Ga0495671_0000110 3300046692 Bacteria 73703
322 Ga0495671_0000151 3300046692 Bacteria 60359
323 Ga0495671_0017898 3300046692 Bacteria 3768
324 Ga0495671_0050458 3300046692 Bacteria 2071
325 Ga0495649_0000141 3300046694 Bacteria 62853
326 Ga0495589_0000073 3300046794 Bacteria 94125
327 Ga0495589_0000683 3300046794 Bacteria 22125
328 Ga0495589_0001483 3300046794 Bacteria 13497
329 Ga0495589_0002948 3300046794 Bacteria 9381
330 Ga0495589_0002963 3300046794 Bacteria 9351
331 Ga0495589_0017120 3300046794 Bacteria 3721
332 Ga0495589_0028215 3300046794 Bacteria 2833
333 Ga0495600_0008092 3300046809 Bacteria 6449
334 Ga0495600_0011187 3300046809 Bacteria 5589
335 Ga0495660_0000027 3300046810 Bacteria 254331
336 Ga0495660_0005196 3300046810 Bacteria 7811
337 Ga0495660_0009332 3300046810 Bacteria 5721
338 Ga0495581_0001424 3300047315 Bacteria 13271
339 Ga0495581_0034821 3300047315 Bacteria 2913
340 Ga0495581_0041430 3300047315 Bacteria 2665
341 Ga0495604_0001679 3300047317 Bacteria 18223
342 Ga0495604_0045182 3300047317 Bacteria 3438
343 Ga0495674_0003110 3300047319 Bacteria 16123
344 Ga0495672_0000023 3300047320 Bacteria 419080
345 Ga0495672_0000032 3300047320 Bacteria 295356
346 Ga0495672_0000094 3300047320 Bacteria 144774
347 Ga0495672_0000377 3300047320 Bacteria 55213
348 Ga0495672_0000818 3300047320 Bacteria 33454
349 Ga0495672_0001776 3300047320 Bacteria 20725
350 Ga0495672_0015520 3300047320 Bacteria 5166
351 Ga0495676_0000056 3300047321 Bacteria 88073
352 Ga0495676_0016762 3300047321 Bacteria 6489
353 Ga0495680_0006382 3300047322 Bacteria 10969
354 Ga0495683_0000064 3300047323 Bacteria 112558
355 Ga0495683_0000124 3300047323 Bacteria 76910
356 Ga0495683_0017109 3300047323 Bacteria 3760
357 Ga0495683_0019861 3300047323 Bacteria 3465
358 Ga0495683_0023893 3300047323 Bacteria 3139
359 Ga0495683_0052047 3300047323 Bacteria 2045
360 Ga0495687_000037 3300047443 Bacteria 252363
361 Ga0495687_000108 3300047443 Bacteria 126739
362 Ga0495687_000352 3300047443 Bacteria 58944
363 Ga0495687_004157 3300047443 Bacteria 9962
364 Ga0495687_005059 3300047443 Bacteria 8577
365 Ga0495687_006559 3300047443 Bacteria 7098
366 Ga0495675_0002116 3300047444 Bacteria 11835
367 Ga0495677_0000014 3300047445 Bacteria 136236
368 Ga0495677_0000157 3300047445 Bacteria 32541
369 Ga0495677_0003458 3300047445 Bacteria 6129
370 Ga0495677_0009240 3300047445 Bacteria 3641
371 Ga0495679_002648 3300047446 Bacteria 8990
372 Ga0495679_008340 3300047446 Bacteria 4221
373 Ga0495685_012425 3300047447 Bacteria 2885
374 Ga0495673_0000015 3300047469 Bacteria 598766
375 Ga0495681_0000101 3300047470 Bacteria 75746
376 Ga0495681_0001034 3300047470 Bacteria 21259
377 Ga0495681_0002499 3300047470 Bacteria 13105
378 Ga0495681_0013497 3300047470 Bacteria 4734
379 Ga0495686_0000047 3300047472 Bacteria 280086
380 Ga0495686_0000869 3300047472 Bacteria 38479
381 Ga0495686_0001256 3300047472 Bacteria 28813
382 Ga0495686_0001740 3300047472 Bacteria 22341
383 Ga0495686_0017628 3300047472 Bacteria 4804
384 Ga0495593_0006550 3300047673 Bacteria 6817
385 Ga0495593_0014173 3300047673 Bacteria 4536
386 Ga0495602_0003891 3300048088 Bacteria 15541
387 Ga0495602_0046700 3300048088 Bacteria 3909
388 Ga0495614_0002605 3300048089 Bacteria 8015
389 Ga0495614_0003867 3300048089 Bacteria 6731
390 Ga0495626_0000009 3300048091 Bacteria 270596
391 Ga0495626_0000078 3300048091 Bacteria 130020
392 Ga0495626_0000501 3300048091 Bacteria 39276
393 Ga0495626_0000900 3300048091 Bacteria 26297
394 Ga0495626_0002188 3300048091 Bacteria 14037
395 Ga0495626_0004605 3300048091 Bacteria 8402
396 Ga0495626_0006964 3300048091 Bacteria 6361
397 Ga0495626_0007960 3300048091 Bacteria 5860
398 Ga0495626_0010497 3300048091 Bacteria 4935
399 Ga0495626_0011282 3300048091 Bacteria 4732
400 Ga0495626_0035965 3300048091 Bacteria 2361
401 Ga0496102_0000469 3300048905 Bacteria 44794
402 Ga0496102_0000538 3300048905 Bacteria 40982
403 Ga0496103_0004690 3300048906 Bacteria 8273
404 Ga0496106_0035385 3300048909 Bacteria 3734
405 Ga0496107_0035279 3300048910 Bacteria 3586
406 Ga0496109_0016109 3300048912 Bacteria 6532
407 Ga0496109_0157539 3300048912 Bacteria 2127
408 Ga0496110_0000026 3300048913 Bacteria 71385
409 Ga0496110_0007026 3300048913 Bacteria 8957
410 Ga0496110_0032712 3300048913 Bacteria 4495
411 Ga0496111_0019377 3300048914 Bacteria 4724
412 Ga0496111_0051909 3300048914 Bacteria 2961
413 Ga0496116_0024645 3300048919 Bacteria 4443
414 Ga0496117_0000011 3300048920 Bacteria 610930
415 Ga0496118_0000010 3300048921 Bacteria 610930
416 Ga0496121_0004403 3300048924 Bacteria 18980
417 Ga0496122_0000281 3300048925 Bacteria 113531
418 Ga0496122_0001081 3300048925 Bacteria 47312
419 Ga0496122_0001155 3300048925 Bacteria 45307
420 Ga0496122_0014415 3300048925 Bacteria 7646
421 Ga0496123_0000242 3300048926 Bacteria 110049
422 Ga0496123_0001409 3300048926 Bacteria 33622
423 Ga0496123_0005956 3300048926 Bacteria 12006
424 Ga0496123_0012555 3300048926 Bacteria 7211
425 Ga0496124_0012874 3300048927 Bacteria 8215
426 Ga0496124_0030794 3300048927 Bacteria 4755
427 Ga0496124_0032834 3300048927 Bacteria 4578
428 Ga0496124_0048351 3300048927 Bacteria 3635
429 Ga0496125_0000503 3300048928 Bacteria 68126
430 Ga0496125_0041329 3300048928 Bacteria 3943
431 Ga0495678_000006 3300049459 Bacteria 463690
432 Ga0495678_000009 3300049459 Bacteria 373806
433 Ga0495678_000045 3300049459 Bacteria 171880
434 Ga0495678_000085 3300049459 Bacteria 117187
435 Ga0495678_001047 3300049459 Bacteria 23403
436 Ga0495678_002591 3300049459 Bacteria 12089
437 Ga0495678_022880 3300049459 Bacteria 2726
438 Ga0495682_0000082 3300049460 Bacteria 83453
439 Ga0495682_0000782 3300049460 Bacteria 20155
440 Ga0495682_0006537 3300049460 Bacteria 4711
441 Ga0501269_000057 3300049766 Bacteria 34570
442 Ga0501035_0006900 3300049822 Bacteria 10607
443 Ga0501044_0040200 3300049823 Bacteria 4875
444 nmdc:mga03683_28059_c1 3300050489 Bacteria 2235
445 Ga0500618_000091 3300053125 Bacteria 73830
446 Ga0500586_000175 3300053145 Bacteria 11985
447 Ga0587080_002753 3300059503 Bacteria 2110
448 Ga0587104_000243 3300059650 Bacteria 2061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0000009 Ga0495671_0000009_343500_345182 560
2 3300048905 Ga0496102_0000469 Ga0496102_0000469_13777_15498 560
3 3300046471 Ga0495650_0001715 Ga0495650_0001715_14137_15903 561
4 3300046520 Ga0495637_0000436 Ga0495637_0000436_3975_5741 561
5 3300046530 Ga0495654_0000038 Ga0495654_0000038_4003_5769 561
6 3300006177 Ga0075362_10033547 Ga0075362_100335472 569
7 3300006353 Ga0075370_10005496 Ga0075370_100054964 569
8 3300046528 Ga0495642_0006240 Ga0495642_0006240_1376_3124 569
9 3300050489 nmdc:mga03683_28059_c1 nmdc:mga03683_28059_c1_150_1898 569
10 3300044658 Ga0466972_0000211 Ga0466972_0000211_35097_36899 571
11 3300031548 Ga0307408_100000060 Ga0307408_10000006062 572
12 3300046491 Ga0495584_0014112 Ga0495584_0014112_1362_3134 574
13 3300046492 Ga0495585_0014694 Ga0495585_0014694_2730_4502 574
14 3300046507 Ga0495606_0023431 Ga0495606_0023431_1277_3049 574
15 3300046523 Ga0495644_0004958 Ga0495644_0004958_1908_3680 574
16 3300046528 Ga0495642_0006696 Ga0495642_0006696_1752_3524 574
17 3300046542 Ga0495597_0002468 Ga0495597_0002468_2701_4473 574
18 3300046558 Ga0495633_0004712 Ga0495633_0004712_5327_7099 574
19 3300046615 Ga0495656_0006975 Ga0495656_0006975_2135_3907 574
20 3300046616 Ga0495668_0005154 Ga0495668_0005154_1246_3018 574
21 3300046648 Ga0495611_0005880 Ga0495611_0005880_1739_3511 574
22 3300046665 Ga0495661_0016989 Ga0495661_0016989_409_2181 574
23 3300046691 Ga0495670_0008495 Ga0495670_0008495_3048_4820 574
24 3300046692 Ga0495671_0017898 Ga0495671_0017898_101_1873 574
25 3300047323 Ga0495683_0023893 Ga0495683_0023893_734_2506 574
26 3300047445 Ga0495677_0009240 Ga0495677_0009240_1843_3615 574
27 3300048091 Ga0495626_0010497 Ga0495626_0010497_65_1837 574
28 3300049460 Ga0495682_0006537 Ga0495682_0006537_121_1893 574
29 3300020070 Ga0206356_11281754 Ga0206356_112817542 575
30 3300046558 Ga0495633_0000198 Ga0495633_0000198_18507_20246 575
31 3300048910 Ga0496107_0035279 Ga0496107_0035279_110_1837 575
32 3300003577 Ga0007416J51690_1070779 Ga0007416J51690_10707792 576
33 3300046525 Ga0495663_0002067 Ga0495663_0002067_210_2015 576
34 3300049459 Ga0495678_000009 Ga0495678_000009_295158_296888 576
35 3300005331 Ga0070670_100154513 Ga0070670_1001545131 579
36 3300017792 Ga0163161_10024659 Ga0163161_100246592 579
37 3300048912 Ga0496109_0157539 Ga0496109_0157539_198_2018 579
38 3300048913 Ga0496110_0032712 Ga0496110_0032712_741_2561 579
39 3300048914 Ga0496111_0051909 Ga0496111_0051909_225_2045 579
40 iso_pu_bacteria 2842711865 2842712427 579
41 3300003323 rootH1_10070101 rootH1_100701012 580
42 3300027462 Ga0210000_1001687 Ga0210000_10016872 580
43 iso_pu_bacteria 2643221554 2643791532 580
44 iso_pu_bacteria 2643221638 2644211384 580
45 iso_pu_bacteria 2821131069 2821132400 580
46 3300027682 Ga0209971_1001976 Ga0209971_10019762 581
47 3300027876 Ga0209974_10012307 Ga0209974_100123072 581
48 iso_pu_bacteria 2643221556 2643801467 581
49 iso_pu_bacteria 2643221603 2644029062 581
50 iso_pu_bacteria 2643221684 2644471471 581
51 iso_pu_bacteria 2808606418 2809142160 581
52 iso_pu_bacteria 2857553236 2857553330 581
53 iso_pu_bacteria 2857558681 2857562820 581
54 iso_pu_bacteria 8047673197 8047677226 581
55 iso_pu_bacteria 2643221645 2644252991 582
56 iso_pu_bacteria 2643221664 2644354948 582
57 iso_pu_bacteria 2738541280 2738737889 582
58 iso_pu_bacteria 2738541300 2738842100 582
59 iso_pu_bacteria 2738543018 2739272960 582
60 iso_pu_bacteria 2738543030 2739342004 582
61 iso_pu_bacteria 2857553236 2857556993 582
62 iso_pu_bacteria 2857558681 2857563641 582
63 iso_pu_bacteria 2857564685 2857567050 582
64 iso_pu_bacteria 2904424332 2904427149 582
65 3300005331 Ga0070670_100029798 Ga0070670_1000297983 583
66 3300005347 Ga0070668_100114465 Ga0070668_1001144652 583
67 3300014497 Ga0182008_10000303 Ga0182008_100003039 583
68 3300015261 Ga0182006_1000004 Ga0182006_1000004219 583
69 3300015262 Ga0182007_10000018 Ga0182007_10000018152 583
70 3300015265 Ga0182005_1000011 Ga0182005_1000011162 583
71 3300025925 Ga0207650_10008699 Ga0207650_100086995 583
72 3300025928 Ga0207700_10002326 Ga0207700_100023268 583
73 3300046660 Ga0495625_0001866 Ga0495625_0001866_3940_5697 583
74 3300048919 Ga0496116_0024645 Ga0496116_0024645_735_2567 583
75 3300048920 Ga0496117_0000011 Ga0496117_0000011_263700_265532 583
76 3300048921 Ga0496118_0000010 Ga0496118_0000010_345399_347231 583
77 3300048924 Ga0496121_0004403 Ga0496121_0004403_2514_4346 583
78 3300048925 Ga0496122_0001155 Ga0496122_0001155_35601_37433 583
79 3300048926 Ga0496123_0001409 Ga0496123_0001409_3253_5085 583
80 3300048928 Ga0496125_0041329 Ga0496125_0041329_1093_2925 583
81 3300053125 Ga0500618_000091 Ga0500618_000091_63481_65232 583
82 3300002739 JGI25158J39367_1002380 JGI25158J39367_10023801 584
83 3300002774 JGI25150J39212_1000117 JGI25150J39212_100011727 584
84 3300002774 JGI25150J39212_1001933 JGI25150J39212_10019332 584
85 3300002987 JGI25159J45721_1001070 JGI25159J45721_10010702 584
86 3300003374 JGI25161J50226_1000266 JGI25161J50226_100026627 584
87 3300003771 Ga0055526_1000911 Ga0055526_10009119 584
88 3300003771 Ga0055526_1007706 Ga0055526_10077064 584
89 3300003773 Ga0055537_1002996 Ga0055537_10029964 584
90 3300003775 Ga0055524_1000322 Ga0055524_100032226 584
91 3300003775 Ga0055524_1001062 Ga0055524_100106210 584
92 3300003784 Ga0055534_1006875 Ga0055534_10068752 584
93 3300003790 Ga0055528_1009174 Ga0055528_10091742 584
94 3300003791 Ga0055530_10000499 Ga0055530_1000049929 584
95 3300003794 Ga0055531_10013606 Ga0055531_100136061 584
96 3300004625 Ga0055543_1000339 Ga0055543_10003398 584
97 3300005262 Ga0065165_1001110 Ga0065165_100111027 584
98 3300005338 Ga0068868_100102678 Ga0068868_1001026781 584
99 3300005364 Ga0070673_100018531 Ga0070673_1000185313 584
100 3300009177 Ga0105248_10143469 Ga0105248_101434692 584
101 3300013306 Ga0163162_10098163 Ga0163162_100981632 584
102 3300021361 Ga0213872_10018520 Ga0213872_100185202 584
103 3300021361 Ga0213872_10018948 Ga0213872_100189482 584
104 3300025208 Ga0209436_100178 Ga0209436_10017814 584
105 3300025208 Ga0209436_104380 Ga0209436_1043802 584
106 3300025245 Ga0207425_1000001 Ga0207425_1000001632 584
107 3300025245 Ga0207425_1000067 Ga0207425_100006791 584
108 3300025258 Ga0209129_1000003 Ga0209129_1000003632 584
109 3300025263 Ga0209565_1000665 Ga0209565_100066520 584
110 3300025263 Ga0209565_1002783 Ga0209565_10027834 584
111 3300025273 Ga0209673_1013276 Ga0209673_10132762 584
112 3300025284 Ga0209130_1000059 Ga0209130_100005920 584
113 3300025291 Ga0209675_1001696 Ga0209675_10016962 584
114 3300025291 Ga0209675_1006596 Ga0209675_10065962 584
115 3300025295 Ga0209564_1000142 Ga0209564_1000142117 584
116 3300025295 Ga0209564_1003654 Ga0209564_10036542 584
117 3300025295 Ga0209564_1005524 Ga0209564_10055242 584
118 3300025297 Ga0209758_1000020 Ga0209758_1000020642 584
119 3300025298 Ga0209050_1000058 Ga0209050_1000058211 584
120 3300025298 Ga0209050_1000654 Ga0209050_100065424 584
121 3300025298 Ga0209050_1001112 Ga0209050_100111224 584
122 3300025298 Ga0209050_1001305 Ga0209050_100130523 584
123 3300025299 Ga0209256_1000201 Ga0209256_100020119 584
124 3300025299 Ga0209256_1000875 Ga0209256_100087523 584
125 3300025299 Ga0209256_1002175 Ga0209256_100217520 584
126 3300025302 Ga0207426_1009496 Ga0207426_10094962 584
127 3300025304 Ga0209257_1000003 Ga0209257_1000003645 584
128 3300025893 Ga0207682_10005016 Ga0207682_100050165 584
129 3300026023 Ga0207677_10112093 Ga0207677_101120931 584
130 3300026089 Ga0207648_10003379 Ga0207648_100033797 584
131 3300026121 Ga0207683_10007122 Ga0207683_100071227 584
132 3300031548 Ga0307408_100000082 Ga0307408_10000008276 584
133 3300031548 Ga0307408_100001091 Ga0307408_10000109118 584
134 3300039447 Ga0436361_0508408 Ga0436361_0508408_824_2578 584
135 3300039447 Ga0436361_0889029 Ga0436361_0889029_8498_10252 584
136 3300046473 Ga0495582_0006526 Ga0495582_0006526_1505_3310 584
137 3300046492 Ga0495585_0023559 Ga0495585_0023559_1349_3154 584
138 3300046513 Ga0495616_0010214 Ga0495616_0010214_2058_3863 584
139 3300046524 Ga0495648_0030319 Ga0495648_0030319_154_1950 584
140 3300046542 Ga0495597_0000737 Ga0495597_0000737_16935_18695 584
141 3300046616 Ga0495668_0000020 Ga0495668_0000020_347016_348770 584
142 3300047315 Ga0495581_0001424 Ga0495581_0001424_8005_9810 584
143 3300048089 Ga0495614_0002605 Ga0495614_0002605_3165_4970 584
144 3300003577 Ga0007416J51690_1032490 Ga0007416J51690_10324901 585
145 3300003759 Ga0055525_1000006 Ga0055525_1000006570 585
146 3300005262 Ga0065165_1001321 Ga0065165_100132119 585
147 3300005347 Ga0070668_100003342 Ga0070668_1000033422 585
148 3300009036 Ga0105244_10033422 Ga0105244_100334222 585
149 3300009148 Ga0105243_10011212 Ga0105243_100112122 585
150 3300013102 Ga0157371_10000014 Ga0157371_10000014233 585
151 3300015261 Ga0182006_1000042 Ga0182006_100004220 585
152 3300015265 Ga0182005_1000008 Ga0182005_10000082 585
153 3300025230 Ga0209563_100022 Ga0209563_100022568 585
154 3300025254 Ga0209148_1000514 Ga0209148_100051422 585
155 3300025909 Ga0207705_10004165 Ga0207705_100041655 585
156 3300025909 Ga0207705_10092410 Ga0207705_100924102 585
157 3300025911 Ga0207654_10017712 Ga0207654_100177122 585
158 3300025920 Ga0207649_10032853 Ga0207649_100328532 585
159 3300025939 Ga0207665_10034778 Ga0207665_100347782 585
160 3300028794 Ga0307515_10135496 Ga0307515_101354962 585
161 3300037312 Ga0395899_0000315 Ga0395899_0000315_31815_33620 585
162 3300037312 Ga0395899_0002512 Ga0395899_0002512_10449_12257 585
163 3300037418 Ga0395900_0000202 Ga0395900_0000202_53218_55026 585
164 3300037418 Ga0395900_0026243 Ga0395900_0026243_1050_2858 585
165 3300038443 Ga0395901_0000019 Ga0395901_0000019_262050_263858 585
166 3300038443 Ga0395901_0039784 Ga0395901_0039784_122_1930 585
167 3300038443 Ga0395901_0169540 Ga0395901_0169540_43_1851 585
168 3300042139 Ga0450904_000350 Ga0450904_000350_6221_8026 585
169 3300044658 Ga0466972_0007819 Ga0466972_0007819_871_2676 585
170 3300044706 Ga0466964_0000713 Ga0466964_0000713_6465_8273 585
171 3300044735 Ga0466968_0000228 Ga0466968_0000228_2408_4213 585
172 3300045049 Ga0466959_0073810 Ga0466959_0073810_287_2095 585
173 3300045976 Ga0466967_0140085 Ga0466967_0140085_83_1891 585
174 3300046452 Ga0495617_000015 Ga0495617_000015_133132_134940 585
175 3300046452 Ga0495617_000137 Ga0495617_000137_44471_46228 585
176 3300046453 Ga0495627_000005 Ga0495627_000005_597698_599461 585
177 3300046453 Ga0495627_000106 Ga0495627_000106_48244_50052 585
178 3300046453 Ga0495627_001537 Ga0495627_001537_1009_2817 585
179 3300046453 Ga0495627_002747 Ga0495627_002747_1838_3643 585
180 3300046455 Ga0495603_0002805 Ga0495603_0002805_1545_3353 585
181 3300046457 Ga0495590_0000059 Ga0495590_0000059_84697_86502 585
182 3300046457 Ga0495590_0006771 Ga0495590_0006771_1072_2880 585
183 3300046458 Ga0495591_000079 Ga0495591_000079_63718_65523 585
184 3300046459 Ga0495629_0009662 Ga0495629_0009662_4222_6027 585
185 3300046463 Ga0495653_0000005 Ga0495653_0000005_119623_121380 585
186 3300046463 Ga0495653_0010187 Ga0495653_0010187_4003_5811 585
187 3300046463 Ga0495653_0011945 Ga0495653_0011945_4887_6695 585
188 3300046463 Ga0495653_0045711 Ga0495653_0045711_1470_3293 585
189 3300046463 Ga0495653_0069534 Ga0495653_0069534_523_2334 585
190 3300046471 Ga0495650_0000152 Ga0495650_0000152_13499_15337 585
191 3300046471 Ga0495650_0000344 Ga0495650_0000344_1550_3355 585
192 3300046471 Ga0495650_0016771 Ga0495650_0016771_1770_3590 585
193 3300046472 Ga0495580_0037114 Ga0495580_0037114_1353_3161 585
194 3300046473 Ga0495582_0034196 Ga0495582_0034196_191_1996 585
195 3300046474 Ga0495605_0000021 Ga0495605_0000021_124496_126304 585
196 3300046474 Ga0495605_0000065 Ga0495605_0000065_76322_78124 585
197 3300046474 Ga0495605_0001349 Ga0495605_0001349_10000_11805 585
198 3300046491 Ga0495584_0000257 Ga0495584_0000257_9811_11616 585
199 3300046491 Ga0495584_0000903 Ga0495584_0000903_36_1844 585
200 3300046492 Ga0495585_0000094 Ga0495585_0000094_49185_50993 585
201 3300046492 Ga0495585_0000154 Ga0495585_0000154_18352_20160 585
202 3300046492 Ga0495585_0000547 Ga0495585_0000547_10964_12769 585
203 3300046492 Ga0495585_0002755 Ga0495585_0002755_7750_9555 585
204 3300046492 Ga0495585_0005302 Ga0495585_0005302_1939_3744 585
205 3300046492 Ga0495585_0008240 Ga0495585_0008240_4311_6119 585
206 3300046492 Ga0495585_0013794 Ga0495585_0013794_1601_3403 585
207 3300046499 Ga0495594_0033553 Ga0495594_0033553_338_2146 585
208 3300046500 Ga0495596_0000293 Ga0495596_0000293_31141_32943 585
209 3300046500 Ga0495596_0001052 Ga0495596_0001052_9037_10842 585
210 3300046500 Ga0495596_0001494 Ga0495596_0001494_9891_11699 585
211 3300046500 Ga0495596_0002882 Ga0495596_0002882_5977_7782 585
212 3300046500 Ga0495596_0006016 Ga0495596_0006016_1044_2852 585
213 3300046501 Ga0495607_0001503 Ga0495607_0001503_4767_6572 585
214 3300046501 Ga0495607_0002424 Ga0495607_0002424_8835_10643 585
215 3300046501 Ga0495607_0008909 Ga0495607_0008909_3186_4991 585
216 3300046501 Ga0495607_0025916 Ga0495607_0025916_1418_3223 585
217 3300046506 Ga0495583_0000130 Ga0495583_0000130_115633_117441 585
218 3300046506 Ga0495583_0000213 Ga0495583_0000213_70770_72566 585
219 3300046506 Ga0495583_0000250 Ga0495583_0000250_36089_37897 585
220 3300046506 Ga0495583_0000485 Ga0495583_0000485_37975_39783 585
221 3300046506 Ga0495583_0000601 Ga0495583_0000601_37292_39097 585
222 3300046506 Ga0495583_0003017 Ga0495583_0003017_9382_11223 585
223 3300046507 Ga0495606_0000380 Ga0495606_0000380_56782_58539 585
224 3300046507 Ga0495606_0002181 Ga0495606_0002181_4905_6740 585
225 3300046507 Ga0495606_0005709 Ga0495606_0005709_8265_10073 585
226 3300046507 Ga0495606_0014288 Ga0495606_0014288_2740_4548 585
227 3300046507 Ga0495606_0028678 Ga0495606_0028678_561_2369 585
228 3300046512 Ga0495610_0001107 Ga0495610_0001107_6809_8614 585
229 3300046512 Ga0495610_0012184 Ga0495610_0012184_1433_3193 585
230 3300046513 Ga0495616_0000046 Ga0495616_0000046_24336_26144 585
231 3300046513 Ga0495616_0000147 Ga0495616_0000147_7510_9315 585
232 3300046513 Ga0495616_0005134 Ga0495616_0005134_5645_7453 585
233 3300046513 Ga0495616_0005837 Ga0495616_0005837_3776_5584 585
234 3300046513 Ga0495616_0011636 Ga0495616_0011636_2412_4220 585
235 3300046515 Ga0495620_0015306 Ga0495620_0015306_1560_3368 585
236 3300046517 Ga0495630_0084241 Ga0495630_0084241_53_1876 585
237 3300046518 Ga0495631_0000238 Ga0495631_0000238_28521_30326 585
238 3300046518 Ga0495631_0005499 Ga0495631_0005499_1440_3248 585
239 3300046518 Ga0495631_0030202 Ga0495631_0030202_71_1876 585
240 3300046519 Ga0495632_0000061 Ga0495632_0000061_79586_81394 585
241 3300046519 Ga0495632_0000231 Ga0495632_0000231_49374_51182 585
242 3300046519 Ga0495632_0001054 Ga0495632_0001054_19839_21647 585
243 3300046519 Ga0495632_0004674 Ga0495632_0004674_6095_7900 585
244 3300046520 Ga0495637_0000011 Ga0495637_0000011_74895_76700 585
245 3300046522 Ga0495643_0000258 Ga0495643_0000258_47094_48899 585
246 3300046522 Ga0495643_0000600 Ga0495643_0000600_11682_13490 585
247 3300046522 Ga0495643_0001430 Ga0495643_0001430_2693_4450 585
248 3300046522 Ga0495643_0006621 Ga0495643_0006621_2143_3948 585
249 3300046522 Ga0495643_0010028 Ga0495643_0010028_185_1993 585
250 3300046522 Ga0495643_0029283 Ga0495643_0029283_789_2597 585
251 3300046524 Ga0495648_0000079 Ga0495648_0000079_21066_22874 585
252 3300046524 Ga0495648_0000200 Ga0495648_0000200_42697_44505 585
253 3300046524 Ga0495648_0001316 Ga0495648_0001316_17264_19102 585
254 3300046524 Ga0495648_0017608 Ga0495648_0017608_1545_3350 585
255 3300046524 Ga0495648_0019236 Ga0495648_0019236_1525_3333 585
256 3300046526 Ga0495666_0002223 Ga0495666_0002223_7117_8925 585
257 3300046526 Ga0495666_0008809 Ga0495666_0008809_1200_3008 585
258 3300046528 Ga0495642_0000182 Ga0495642_0000182_30685_32493 585
259 3300046528 Ga0495642_0002023 Ga0495642_0002023_353_2161 585
260 3300046528 Ga0495642_0003178 Ga0495642_0003178_3525_5330 585
261 3300046529 Ga0495652_0037855 Ga0495652_0037855_850_2673 585
262 3300046530 Ga0495654_0007446 Ga0495654_0007446_4269_6059 585
263 3300046530 Ga0495654_0012707 Ga0495654_0012707_448_2253 585
264 3300046530 Ga0495654_0023626 Ga0495654_0023626_1098_2906 585
265 3300046531 Ga0495665_0003028 Ga0495665_0003028_6025_7848 585
266 3300046531 Ga0495665_0016457 Ga0495665_0016457_552_2360 585
267 3300046536 Ga0495587_0003241 Ga0495587_0003241_6678_8501 585
268 3300046536 Ga0495587_0034507 Ga0495587_0034507_933_2741 585
269 3300046538 Ga0495609_0000026 Ga0495609_0000026_113957_115762 585
270 3300046538 Ga0495609_0000229 Ga0495609_0000229_16174_17937 585
271 3300046538 Ga0495609_0001529 Ga0495609_0001529_11815_13620 585
272 3300046538 Ga0495609_0024787 Ga0495609_0024787_175_1980 585
273 3300046542 Ga0495597_0000021 Ga0495597_0000021_31259_33067 585
274 3300046542 Ga0495597_0000177 Ga0495597_0000177_8046_9854 585
275 3300046542 Ga0495597_0000652 Ga0495597_0000652_23280_25088 585
276 3300046542 Ga0495597_0000913 Ga0495597_0000913_5545_7350 585
277 3300046542 Ga0495597_0001102 Ga0495597_0001102_17546_19303 585
278 3300046542 Ga0495597_0002726 Ga0495597_0002726_6361_8169 585
279 3300046557 Ga0495622_0014120 Ga0495622_0014120_182_1987 585
280 3300046558 Ga0495633_0000455 Ga0495633_0000455_8850_10640 585
281 3300046558 Ga0495633_0000602 Ga0495633_0000602_26893_28698 585
282 3300046558 Ga0495633_0002196 Ga0495633_0002196_10795_12600 585
283 3300046558 Ga0495633_0005426 Ga0495633_0005426_334_2094 585
284 3300046616 Ga0495668_0000316 Ga0495668_0000316_52592_54400 585
285 3300046616 Ga0495668_0001174 Ga0495668_0001174_6040_7848 585
286 3300046616 Ga0495668_0030674 Ga0495668_0030674_1025_2860 585
287 3300046642 Ga0495634_0003814 Ga0495634_0003814_2770_4578 585
288 3300046648 Ga0495611_0000062 Ga0495611_0000062_57957_59762 585
289 3300046648 Ga0495611_0009273 Ga0495611_0009273_2038_3843 585
290 3300046648 Ga0495611_0018964 Ga0495611_0018964_115_1923 585
291 3300046648 Ga0495611_0026567 Ga0495611_0026567_510_2312 585
292 3300046660 Ga0495625_0011360 Ga0495625_0011360_129_1934 585
293 3300046660 Ga0495625_0047883 Ga0495625_0047883_32_1837 585
294 3300046665 Ga0495661_0000177 Ga0495661_0000177_66356_68167 585
295 3300046665 Ga0495661_0000408 Ga0495661_0000408_20328_22133 585
296 3300046665 Ga0495661_0000674 Ga0495661_0000674_14058_15866 585
297 3300046665 Ga0495661_0003206 Ga0495661_0003206_9967_11775 585
298 3300046665 Ga0495661_0004966 Ga0495661_0004966_2310_4118 585
299 3300046665 Ga0495661_0011169 Ga0495661_0011169_957_2762 585
300 3300046665 Ga0495661_0068955 Ga0495661_0068955_112_1917 585
301 3300046665 Ga0495661_0075520 Ga0495661_0075520_92_1900 585
302 3300046674 Ga0495588_0000435 Ga0495588_0000435_1080_2888 585
303 3300046674 Ga0495588_0005927 Ga0495588_0005927_1471_3276 585
304 3300046674 Ga0495588_0021301 Ga0495588_0021301_812_2620 585
305 3300046674 Ga0495588_0030474 Ga0495588_0030474_788_2611 585
306 3300046678 Ga0495599_0070664 Ga0495599_0070664_176_1999 585
307 3300046679 Ga0495623_0013632 Ga0495623_0013632_1069_2877 585
308 3300046679 Ga0495623_0070730 Ga0495623_0070730_61_1866 585
309 3300046684 Ga0495669_0000111 Ga0495669_0000111_1725_3533 585
310 3300046684 Ga0495669_0000804 Ga0495669_0000804_4598_6406 585
311 3300046690 Ga0495624_0003979 Ga0495624_0003979_2365_4188 585
312 3300046691 Ga0495670_0000381 Ga0495670_0000381_14668_16476 585
313 3300046691 Ga0495670_0000485 Ga0495670_0000485_5147_6952 585
314 3300046691 Ga0495670_0000921 Ga0495670_0000921_535_2343 585
315 3300046691 Ga0495670_0002608 Ga0495670_0002608_1974_3776 585
316 3300046691 Ga0495670_0008986 Ga0495670_0008986_1937_3742 585
317 3300046692 Ga0495671_0000006 Ga0495671_0000006_103028_104785 585
318 3300046692 Ga0495671_0000151 Ga0495671_0000151_39264_41072 585
319 3300046692 Ga0495671_0050458 Ga0495671_0050458_162_1970 585
320 3300046694 Ga0495649_0000141 Ga0495649_0000141_61013_62818 585
321 3300046794 Ga0495589_0000073 Ga0495589_0000073_60544_62349 585
322 3300046794 Ga0495589_0000683 Ga0495589_0000683_17606_19408 585
323 3300046794 Ga0495589_0001483 Ga0495589_0001483_9254_11059 585
324 3300046794 Ga0495589_0002948 Ga0495589_0002948_5589_7397 585
325 3300046794 Ga0495589_0002963 Ga0495589_0002963_2059_3867 585
326 3300046794 Ga0495589_0017120 Ga0495589_0017120_454_2262 585
327 3300046794 Ga0495589_0028215 Ga0495589_0028215_820_2625 585
328 3300046809 Ga0495600_0008092 Ga0495600_0008092_548_2371 585
329 3300046809 Ga0495600_0011187 Ga0495600_0011187_2298_4106 585
330 3300046810 Ga0495660_0000027 Ga0495660_0000027_230540_232342 585
331 3300046810 Ga0495660_0005196 Ga0495660_0005196_3331_5106 585
332 3300046810 Ga0495660_0009332 Ga0495660_0009332_3218_5026 585
333 3300047315 Ga0495581_0034821 Ga0495581_0034821_1078_2901 585
334 3300047315 Ga0495581_0041430 Ga0495581_0041430_180_1985 585
335 3300047317 Ga0495604_0001679 Ga0495604_0001679_1647_3455 585
336 3300047317 Ga0495604_0045182 Ga0495604_0045182_1620_3425 585
337 3300047319 Ga0495674_0003110 Ga0495674_0003110_1863_3668 585
338 3300047320 Ga0495672_0000032 Ga0495672_0000032_120070_121854 585
339 3300047320 Ga0495672_0000094 Ga0495672_0000094_87746_89551 585
340 3300047320 Ga0495672_0000377 Ga0495672_0000377_18092_19897 585
341 3300047320 Ga0495672_0000818 Ga0495672_0000818_21335_23137 585
342 3300047320 Ga0495672_0001776 Ga0495672_0001776_1579_3384 585
343 3300047320 Ga0495672_0015520 Ga0495672_0015520_851_2659 585
344 3300047321 Ga0495676_0000056 Ga0495676_0000056_48352_50160 585
345 3300047321 Ga0495676_0016762 Ga0495676_0016762_546_2348 585
346 3300047322 Ga0495680_0006382 Ga0495680_0006382_8180_9988 585
347 3300047323 Ga0495683_0000064 Ga0495683_0000064_90652_92460 585
348 3300047323 Ga0495683_0000124 Ga0495683_0000124_48806_50611 585
349 3300047323 Ga0495683_0017109 Ga0495683_0017109_1595_3400 585
350 3300047323 Ga0495683_0019861 Ga0495683_0019861_279_2087 585
351 3300047323 Ga0495683_0052047 Ga0495683_0052047_194_2002 585
352 3300047443 Ga0495687_000037 Ga0495687_000037_113957_115762 585
353 3300047443 Ga0495687_000108 Ga0495687_000108_43025_44836 585
354 3300047443 Ga0495687_000352 Ga0495687_000352_4800_6608 585
355 3300047443 Ga0495687_004157 Ga0495687_004157_8061_9869 585
356 3300047443 Ga0495687_005059 Ga0495687_005059_4543_6300 585
357 3300047443 Ga0495687_006559 Ga0495687_006559_4711_6468 585
358 3300047444 Ga0495675_0002116 Ga0495675_0002116_9851_11659 585
359 3300047445 Ga0495677_0000014 Ga0495677_0000014_20475_22280 585
360 3300047445 Ga0495677_0000157 Ga0495677_0000157_20487_22292 585
361 3300047445 Ga0495677_0003458 Ga0495677_0003458_1640_3448 585
362 3300047446 Ga0495679_002648 Ga0495679_002648_610_2415 585
363 3300047446 Ga0495679_008340 Ga0495679_008340_1234_3042 585
364 3300047447 Ga0495685_012425 Ga0495685_012425_625_2433 585
365 3300047469 Ga0495673_0000015 Ga0495673_0000015_395319_397076 585
366 3300047470 Ga0495681_0000101 Ga0495681_0000101_48410_50218 585
367 3300047470 Ga0495681_0001034 Ga0495681_0001034_8326_10134 585
368 3300047470 Ga0495681_0002499 Ga0495681_0002499_7264_9072 585
369 3300047470 Ga0495681_0013497 Ga0495681_0013497_1532_3340 585
370 3300047472 Ga0495686_0000047 Ga0495686_0000047_128102_129913 585
371 3300047472 Ga0495686_0001256 Ga0495686_0001256_45_1850 585
372 3300047472 Ga0495686_0017628 Ga0495686_0017628_2295_4085 585
373 3300047673 Ga0495593_0006550 Ga0495593_0006550_2051_3859 585
374 3300047673 Ga0495593_0014173 Ga0495593_0014173_970_2775 585
375 3300048088 Ga0495602_0003891 Ga0495602_0003891_6749_8560 585
376 3300048088 Ga0495602_0046700 Ga0495602_0046700_1444_3267 585
377 3300048089 Ga0495614_0003867 Ga0495614_0003867_2320_4128 585
378 3300048091 Ga0495626_0000009 Ga0495626_0000009_118459_120270 585
379 3300048091 Ga0495626_0000078 Ga0495626_0000078_8000_9802 585
380 3300048091 Ga0495626_0000501 Ga0495626_0000501_31738_33561 585
381 3300048091 Ga0495626_0000900 Ga0495626_0000900_11216_13021 585
382 3300048091 Ga0495626_0002188 Ga0495626_0002188_3881_5686 585
383 3300048091 Ga0495626_0004605 Ga0495626_0004605_4076_5887 585
384 3300048091 Ga0495626_0006964 Ga0495626_0006964_196_2004 585
385 3300048091 Ga0495626_0007960 Ga0495626_0007960_3856_5664 585
386 3300048091 Ga0495626_0011282 Ga0495626_0011282_889_2712 585
387 3300048091 Ga0495626_0035965 Ga0495626_0035965_212_2020 585
388 3300048905 Ga0496102_0000538 Ga0496102_0000538_31322_33130 585
389 3300048909 Ga0496106_0035385 Ga0496106_0035385_1396_3204 585
390 3300048912 Ga0496109_0016109 Ga0496109_0016109_3480_5291 585
391 3300048913 Ga0496110_0000026 Ga0496110_0000026_68396_70207 585
392 3300048913 Ga0496110_0007026 Ga0496110_0007026_6781_8589 585
393 3300048914 Ga0496111_0019377 Ga0496111_0019377_1443_3251 585
394 3300048925 Ga0496122_0000281 Ga0496122_0000281_42960_44771 585
395 3300048925 Ga0496122_0001081 Ga0496122_0001081_20012_21820 585
396 3300048925 Ga0496122_0014415 Ga0496122_0014415_2562_4319 585
397 3300048926 Ga0496123_0000242 Ga0496123_0000242_68743_70554 585
398 3300048926 Ga0496123_0005956 Ga0496123_0005956_1585_3342 585
399 3300048926 Ga0496123_0012555 Ga0496123_0012555_4491_6299 585
400 3300048927 Ga0496124_0012874 Ga0496124_0012874_2435_4246 585
401 3300048927 Ga0496124_0030794 Ga0496124_0030794_259_2064 585
402 3300048927 Ga0496124_0032834 Ga0496124_0032834_1339_3135 585
403 3300048927 Ga0496124_0048351 Ga0496124_0048351_1086_2894 585
404 3300048928 Ga0496125_0000503 Ga0496125_0000503_42225_44036 585
405 3300049459 Ga0495678_000006 Ga0495678_000006_262107_263882 585
406 3300049459 Ga0495678_000045 Ga0495678_000045_115735_117543 585
407 3300049459 Ga0495678_000085 Ga0495678_000085_103664_105469 585
408 3300049459 Ga0495678_001047 Ga0495678_001047_6586_8424 585
409 3300049459 Ga0495678_002591 Ga0495678_002591_9597_11405 585
410 3300049459 Ga0495678_022880 Ga0495678_022880_115_1956 585
411 3300049460 Ga0495682_0000082 Ga0495682_0000082_36921_38729 585
412 3300049460 Ga0495682_0000782 Ga0495682_0000782_1912_3702 585
413 3300049822 Ga0501035_0006900 Ga0501035_0006900_2451_4259 585
414 3300049823 Ga0501044_0040200 Ga0501044_0040200_1115_2923 585
415 3300053145 Ga0500586_000175 Ga0500586_000175_4182_5942 585
416 3300059503 Ga0587080_002753 Ga0587080_002753_107_1915 585
417 3300059650 Ga0587104_000243 Ga0587104_000243_189_1997 585
418 iso_pu_bacteria 2600255292 2601669385 585
419 3300002738 JGI25154J39366_1000356 JGI25154J39366_10003562 586
420 3300002774 JGI25150J39212_1001264 JGI25150J39212_10012645 586
421 3300002987 JGI25159J45721_1001146 JGI25159J45721_10011467 586
422 3300003763 Ga0055529_1000341 Ga0055529_100034113 586
423 3300003771 Ga0055526_1000028 Ga0055526_100002889 586
424 3300003771 Ga0055526_1001174 Ga0055526_10011748 586
425 3300003773 Ga0055537_1000077 Ga0055537_100007762 586
426 3300003775 Ga0055524_1000010 Ga0055524_1000010227 586
427 3300003784 Ga0055534_1000139 Ga0055534_100013947 586
428 3300003790 Ga0055528_1000011 Ga0055528_10000118 586
429 3300005262 Ga0065165_1000007 Ga0065165_1000007110 586
430 3300006948 Ga0099826_10000002 Ga0099826_10000002191 586
431 3300009148 Ga0105243_10003968 Ga0105243_100039684 586
432 3300025245 Ga0207425_1000156 Ga0207425_100015622 586
433 3300025246 Ga0209646_1000023 Ga0209646_1000023215 586
434 3300025263 Ga0209565_1000003 Ga0209565_1000003682 586
435 3300025272 Ga0209455_1000037 Ga0209455_1000037406 586
436 3300025273 Ga0209673_1000003 Ga0209673_1000003568 586
437 3300025284 Ga0209130_1000047 Ga0209130_100004790 586
438 3300025291 Ga0209675_1000003 Ga0209675_1000003356 586
439 3300025294 Ga0209025_1003818 Ga0209025_10038187 586
440 3300025295 Ga0209564_1000011 Ga0209564_1000011535 586
441 3300025295 Ga0209564_1000012 Ga0209564_1000012164 586
442 3300025297 Ga0209758_1000271 Ga0209758_100027146 586
443 3300025299 Ga0209256_1000007 Ga0209256_1000007605 586
444 3300025299 Ga0209256_1000029 Ga0209256_100002969 586
445 3300027666 Ga0209282_1000001 Ga0209282_1000001956 586
446 3300046471 Ga0495650_0000019 Ga0495650_0000019_31682_33448 586
447 3300046471 Ga0495650_0000170 Ga0495650_0000170_35846_37630 586
448 3300046471 Ga0495650_0000408 Ga0495650_0000408_68661_70421 586
449 3300046474 Ga0495605_0000068 Ga0495605_0000068_90118_91878 586
450 3300046501 Ga0495607_0004233 Ga0495607_0004233_6258_8033 586
451 3300046507 Ga0495606_0000118 Ga0495606_0000118_108776_110536 586
452 3300046507 Ga0495606_0000179 Ga0495606_0000179_45464_47224 586
453 3300046507 Ga0495606_0000224 Ga0495606_0000224_91583_93385 586
454 3300046507 Ga0495606_0000337 Ga0495606_0000337_18047_19813 586
455 3300046507 Ga0495606_0000460 Ga0495606_0000460_35784_37559 586
456 3300046507 Ga0495606_0001085 Ga0495606_0001085_7024_8808 586
457 3300046507 Ga0495606_0001539 Ga0495606_0001539_17271_19043 586
458 3300046507 Ga0495606_0012265 Ga0495606_0012265_1976_3736 586
459 3300046512 Ga0495610_0002181 Ga0495610_0002181_9814_11574 586
460 3300046530 Ga0495654_0027338 Ga0495654_0027338_676_2436 586
461 3300046538 Ga0495609_0023690 Ga0495609_0023690_668_2479 586
462 3300046616 Ga0495668_0000137 Ga0495668_0000137_486_2246 586
463 3300046660 Ga0495625_0010893 Ga0495625_0010893_2380_4140 586
464 3300046664 Ga0495659_0000053 Ga0495659_0000053_9421_11181 586
465 3300046692 Ga0495671_0000110 Ga0495671_0000110_69392_71152 586
466 3300047320 Ga0495672_0000023 Ga0495672_0000023_410554_412314 586
467 3300047472 Ga0495686_0000869 Ga0495686_0000869_14001_15776 586
468 3300047472 Ga0495686_0001740 Ga0495686_0001740_7301_9061 586
469 3300048906 Ga0496103_0004690 Ga0496103_0004690_1474_3234 586
470 3300049766 Ga0501269_000057 Ga0501269_000057_29095_30888 586
471 iso_pu_bacteria 2904424332 2904425002 586
472 iso_pu_bacteria 2919476304 2919479750 586

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22666

Glyco_hydro_2_N2

Glycosyl hydrolase 2 galactose-binding domain-like

61

189

0.84

PF02837

Glyco_hydro_2_N

Glycosyl hydrolases family 2, sugar binding domain

18

165

0.76

PF02836

Glyco_hydro_2_C

Glycosyl hydrolases family 2, TIM barrel domain

276

571

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xyr-assembly1.cif.gz_A cystal structure of beta-glucuronidase from bacteroides thetaiotaomicron 0.8289 1 585
7xyr-assembly1.cif.gz_A cystal structure of beta-glucuronidase from bacteroides thetaiotaomicron 0.8218 1 585
7sf2-assembly2.cif.gz_C crystal structure of beta-galactosidase from bacteroides cellulosilyticus 0.8116 5 581
7brs-assembly4.cif.gz_D e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.7805 14 454
7brs-assembly2.cif.gz_B e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.7696 14 454
ID Description Score Start End Superfamily
af_I1KBP5_438_571_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8269 66 134 2.60.120.260
af_A0A1D6MYX1_524_644_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8034 66 134 2.60.120.260
4jkmB02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7667 176 283 2.60.40.10
af_A0A0R4J2Z7_614_732_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7543 64 139 2.60.120.260
4jklB02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7542 176 283 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7V3I7R8-F1-model_v4 Glycoside hydrolase family 2 0.9527 2 294 GO:0004553
GO:0005975
AF-A0A2T1F417-F1-model_v4 Glycoside hydrolase family 2 0.9467 4 409 GO:0004553
GO:0005975
AF-A0A6B3EED5-F1-model_v4 Glycoside hydrolase family 2 0.9246 171 357 GO:0004553
GO:0005975
AF-A0A418KJT3-F1-model_v4 Glycoside hydrolase family 2 0.9169 1 394 GO:0004553
GO:0005975
AF-A0A355SGR6-F1-model_v4 Beta-galactosidase 0.9124 1 235 GO:0004553
GO:0005975

Feature Viewer

pLDDT pTM Quality
78.08 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map