F450744

General Info

Members Datasets Scaffolds Average Seq Length
472 193 944 202

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100209476|Ga0070700_1002094762
Length 230
Sequence VIADFQLPIADCGTSANWQSAIGNRKLAMLRVGLTGSIGVGKTFVASVFIELGCHVLDADQTAREVVMPGTPGLKALVEEFGDDILATDGTLDRKRLGALIFADQSKRQRLNHILHPFIIARQDEILNGWEAEDPNGIGIVDAALMIESGGYKRFDKLIVVHCRPEVQLERLMLRDKLSREEALRRINSQMPQQEKQQFADYLIDTSDGFELTRSRSVEIYNQLLRVIRG

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
163 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
164 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
165 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
166 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
167 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
168 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
169 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
170 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
171 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
172 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
173 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
174 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
178 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
183 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
184 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
185 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.21
Rhizosphere 99.79
Stem 0
Stem Tuber 0
Unclassified 20.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100209476 3300005441 Unclassified 1374
2 SwRhRL2b_contig_80242 2162886007 Bacteria 828
3 JGI24751J29686_10000249 3300002459 Bacteria 21224
4 Ga0065712_10067742 3300005290 Bacteria 73878
5 Ga0065715_10001142 3300005293 Bacteria 8503
6 Ga0065715_10032352 3300005293 Unclassified 1237
7 Ga0065715_10143169 3300005293 Bacteria 1824
8 Ga0065715_10157735 3300005293 Bacteria 1639
9 Ga0065715_10208120 3300005293 Bacteria 1302
10 Ga0065715_10270694 3300005293 Bacteria 1112
11 Ga0065715_10301292 3300005293 Bacteria 1040
12 Ga0065715_10364437 3300005293 Unclassified 930
13 Ga0065707_10045593 3300005295 Unclassified 1014
14 Ga0065707_10103331 3300005295 Bacteria 2754
15 Ga0065707_10231112 3300005295 Bacteria 1188
16 Ga0070676_10040995 3300005328 Bacteria 2683
17 Ga0070690_100254020 3300005330 Bacteria 1244
18 Ga0070670_100000118 3300005331 Bacteria 73231
19 Ga0070670_100022772 3300005331 Bacteria 5391
20 Ga0070670_100124824 3300005331 Bacteria 2222
21 Ga0070670_100659281 3300005331 Bacteria 939
22 Ga0068869_101009438 3300005334 Unclassified 725
23 Ga0068869_101050808 3300005334 Bacteria 711
24 Ga0070666_10395914 3300005335 Unclassified 992
25 Ga0070680_100303976 3300005336 Unclassified 1353
26 Ga0070682_100062802 3300005337 Unclassified 2353
27 Ga0070660_100093124 3300005339 Unclassified 2379
28 Ga0070689_100531744 3300005340 Bacteria 1011
29 Ga0070687_100120487 3300005343 Unclassified 1500
30 Ga0070687_100358234 3300005343 Bacteria 943
31 Ga0070692_10010638 3300005345 Bacteria 4197
32 Ga0070692_10101122 3300005345 Bacteria 1580
33 Ga0070692_10237027 3300005345 Unclassified 1086
34 Ga0070668_100026945 3300005347 Bacteria 4362
35 Ga0070668_100740559 3300005347 Bacteria 869
36 Ga0070669_100003658 3300005353 Bacteria 11087
37 Ga0070669_100022940 3300005353 Bacteria 4465
38 Ga0070669_100153791 3300005353 Bacteria 1782
39 Ga0070669_100269467 3300005353 Unclassified 1361
40 Ga0070671_100510925 3300005355 Bacteria 1034
41 Ga0070673_100040859 3300005364 Bacteria 3561
42 Ga0070673_100349911 3300005364 Unclassified 1311
43 Ga0070673_100691440 3300005364 Bacteria 936
44 Ga0070659_100003093 3300005366 Bacteria 11832
45 Ga0070659_100011933 3300005366 Bacteria 6433
46 Ga0070659_100907518 3300005366 Bacteria 770
47 Ga0070667_101233123 3300005367 Unclassified 700
48 Ga0070703_10070344 3300005406 Bacteria 1167
49 Ga0070701_10202559 3300005438 Bacteria 1174
50 Ga0070701_10533414 3300005438 Unclassified 767
51 Ga0070705_100008100 3300005440 Bacteria 5198
52 Ga0070705_100011658 3300005440 Bacteria 4443
53 Ga0070705_100028922 3300005440 Unclassified 3041
54 Ga0070705_100159982 3300005440 Bacteria 1504
55 Ga0070705_100472239 3300005440 Bacteria 946
56 Ga0070700_100000115 3300005441 Bacteria 51077
57 Ga0070700_100089621 3300005441 Bacteria 2004
58 Ga0070700_100109872 3300005441 Bacteria 1831
59 Ga0070700_100214925 3300005441 Bacteria 1359
60 Ga0070694_100461089 3300005444 Bacteria 1005
61 Ga0070708_100000002 3300005445 Bacteria 195857
62 Ga0070708_100899458 3300005445 Unclassified 831
63 Ga0070662_100266711 3300005457 Bacteria 1381
64 Ga0070681_10004212 3300005458 Bacteria 13627
65 Ga0070681_10022848 3300005458 Bacteria 6285
66 Ga0070681_10397752 3300005458 Bacteria 1289
67 Ga0068867_100377067 3300005459 Bacteria 1191
68 Ga0068867_100442740 3300005459 Bacteria 1105
69 Ga0068867_100555177 3300005459 Unclassified 995
70 Ga0070706_100000032 3300005467 Bacteria 152892
71 Ga0070706_100014698 3300005467 Bacteria 7231
72 Ga0070707_100337011 3300005468 Unclassified 1465
73 Ga0070698_100003636 3300005471 Bacteria 16941
74 Ga0070698_100049397 3300005471 Bacteria 4293
75 Ga0070699_100002994 3300005518 Bacteria 15008
76 Ga0070699_100193943 3300005518 Bacteria 1805
77 Ga0070699_100410387 3300005518 Bacteria 1225
78 Ga0070699_100542409 3300005518 Unclassified 1058
79 Ga0070699_100586658 3300005518 Bacteria 1016
80 Ga0070679_100013546 3300005530 Bacteria 7813
81 Ga0070684_100249211 3300005535 Bacteria 1623
82 Ga0070697_100015177 3300005536 Bacteria 6049
83 Ga0070697_100022661 3300005536 Bacteria 4988
84 Ga0068853_100171599 3300005539 Unclassified 1962
85 Ga0070672_100131120 3300005543 Unclassified 2060
86 Ga0070672_100540448 3300005543 Bacteria 1011
87 Ga0070695_100029022 3300005545 Bacteria 3435
88 Ga0070695_100057015 3300005545 Bacteria 2523
89 Ga0070695_100093523 3300005545 Bacteria 2012
90 Ga0070695_100146350 3300005545 Bacteria 1644
91 Ga0070695_100850830 3300005545 Unclassified 734
92 Ga0070696_100018529 3300005546 Bacteria 4706
93 Ga0070696_100062555 3300005546 Unclassified 2605
94 Ga0070693_100001675 3300005547 Bacteria 10036
95 Ga0070693_100035327 3300005547 Bacteria 2771
96 Ga0070693_100310658 3300005547 Unclassified 1066
97 Ga0070704_100067100 3300005549 Bacteria 2589
98 Ga0070704_100694152 3300005549 Bacteria 902
99 Ga0070704_100741305 3300005549 Unclassified 874
100 Ga0070704_101129222 3300005549 Unclassified 713
101 Ga0068855_100608168 3300005563 Bacteria 1178
102 Ga0070664_100004180 3300005564 Bacteria 11603
103 Ga0070664_100705827 3300005564 Unclassified 940
104 Ga0070664_100987961 3300005564 Bacteria 791
105 Ga0068857_100001586 3300005577 Bacteria 18226
106 Ga0068857_100034083 3300005577 Unclassified 4505
107 Ga0068857_100343134 3300005577 Bacteria 1382
108 Ga0068857_100607516 3300005577 Bacteria 1034
109 Ga0068857_100765517 3300005577 Bacteria 920
110 Ga0070702_100012076 3300005615 Unclassified 4316
111 Ga0070702_100020738 3300005615 Bacteria 3447
112 Ga0070702_100155914 3300005615 Bacteria 1471
113 Ga0070702_100571595 3300005615 Unclassified 843
114 Ga0070702_100756128 3300005615 Bacteria 747
115 Ga0068852_100046722 3300005616 Bacteria 3690
116 Ga0068852_100179911 3300005616 Bacteria 1988
117 Ga0068852_100621632 3300005616 Bacteria 1086
118 Ga0068859_100002161 3300005617 Bacteria 19974
119 Ga0068859_100017992 3300005617 Bacteria 7102
120 Ga0068859_100049487 3300005617 Bacteria 4220
121 Ga0068859_100055726 3300005617 Bacteria 3977
122 Ga0068859_100080022 3300005617 Bacteria 3308
123 Ga0068859_100120627 3300005617 Bacteria 2689
124 Ga0068859_100180812 3300005617 Bacteria 2192
125 Ga0068859_100533295 3300005617 Bacteria 1269
126 Ga0068859_100588299 3300005617 Bacteria 1206
127 Ga0068859_100938191 3300005617 Unclassified 949
128 Ga0068859_101227527 3300005617 Unclassified 826
129 Ga0068864_100018122 3300005618 Bacteria 5876
130 Ga0068864_100110178 3300005618 Bacteria 2451
131 Ga0068861_100118079 3300005719 Bacteria 2136
132 Ga0068861_100128663 3300005719 Unclassified 2053
133 Ga0068861_100203586 3300005719 Bacteria 1663
134 Ga0068851_10025146 3300005834 Bacteria 2920
135 Ga0068851_10324441 3300005834 Bacteria 890
136 Ga0068870_10112017 3300005840 Bacteria 1560
137 Ga0068863_100130020 3300005841 Bacteria 2404
138 Ga0068863_100192059 3300005841 Bacteria 1962
139 Ga0068863_101311812 3300005841 Unclassified 731
140 Ga0068858_100013118 3300005842 Bacteria 7813
141 Ga0068858_100050388 3300005842 Unclassified 3854
142 Ga0068858_100082356 3300005842 Unclassified 2991
143 Ga0068858_100210685 3300005842 Bacteria 1839
144 Ga0068858_100353463 3300005842 Unclassified 1408
145 Ga0068860_100043915 3300005843 Bacteria 4261
146 Ga0068860_100075964 3300005843 Unclassified 3195
147 Ga0068860_100139218 3300005843 Bacteria 2332
148 Ga0068860_100796940 3300005843 Bacteria 958
149 Ga0068860_101171282 3300005843 Unclassified 789
150 Ga0068862_100019763 3300005844 Bacteria 5626
151 Ga0068862_100168916 3300005844 Bacteria 1957
152 Ga0068862_100938529 3300005844 Unclassified 853
153 Ga0068862_101517779 3300005844 Bacteria 676
154 Ga0081455_10079517 3300005937 Bacteria 2691
155 Ga0081539_10000390 3300005985 Bacteria 94524
156 Ga0070716_100104283 3300006173 Bacteria 1745
157 Ga0068871_100004892 3300006358 Bacteria 9357
158 Ga0068871_100187592 3300006358 Bacteria 1780
159 Ga0075428_100235051 3300006844 Bacteria 1978
160 Ga0075428_100328562 3300006844 Bacteria 1643
161 Ga0075428_101163795 3300006844 Unclassified 813
162 Ga0075430_100032772 3300006846 Bacteria 4409
163 Ga0075430_100228948 3300006846 Bacteria 1541
164 Ga0075433_10010272 3300006852 Bacteria 7510
165 Ga0075433_10079145 3300006852 Unclassified 2896
166 Ga0075433_10087754 3300006852 Bacteria 2747
167 Ga0075434_100030100 3300006871 Bacteria 5344
168 Ga0075434_100085779 3300006871 Bacteria 3148
169 Ga0075429_100232310 3300006880 Bacteria 1616
170 Ga0068865_100640785 3300006881 Unclassified 902
171 Ga0075436_100041674 3300006914 Bacteria 3168
172 Ga0097620_100002161 3300006931 Bacteria 19974
173 Ga0097620_100016326 3300006931 Bacteria 7459
174 Ga0097620_100017991 3300006931 Bacteria 7102
175 Ga0097620_100049486 3300006931 Bacteria 4220
176 Ga0097620_100055724 3300006931 Bacteria 3977
177 Ga0097620_100080024 3300006931 Bacteria 3308
178 Ga0097620_100120622 3300006931 Bacteria 2689
179 Ga0097620_100180821 3300006931 Bacteria 2192
180 Ga0097620_100533301 3300006931 Bacteria 1269
181 Ga0097620_100588286 3300006931 Bacteria 1206
182 Ga0097620_100713050 3300006931 Unclassified 1093
183 Ga0097620_100937971 3300006931 Unclassified 949
184 Ga0097620_101227486 3300006931 Unclassified 826
185 Ga0075435_100070272 3300007076 Bacteria 2857
186 Ga0105240_10023889 3300009093 Bacteria 8073
187 Ga0111539_10045939 3300009094 Bacteria 5226
188 Ga0111539_10139427 3300009094 Bacteria 2839
189 Ga0111539_10869235 3300009094 Bacteria 1049
190 Ga0105245_10476839 3300009098 Bacteria 1260
191 Ga0105245_10523647 3300009098 Unclassified 1204
192 Ga0105247_10004069 3300009101 Bacteria 9397
193 Ga0105247_10141862 3300009101 Unclassified 1575
194 Ga0105247_10237221 3300009101 Bacteria 1241
195 Ga0105247_10679753 3300009101 Bacteria 772
196 Ga0114129_10033798 3300009147 Bacteria 7224
197 Ga0114129_10048816 3300009147 Bacteria 5949
198 Ga0114129_10055064 3300009147 Bacteria 5575
199 Ga0114129_10254563 3300009147 Bacteria 2356
200 Ga0114129_10500063 3300009147 Bacteria 1588
201 Ga0114129_10509699 3300009147 Unclassified 1570
202 Ga0114129_10684235 3300009147 Bacteria 1320
203 Ga0114129_10794826 3300009147 Bacteria 1207
204 Ga0105243_10028159 3300009148 Unclassified 4311
205 Ga0105243_10550104 3300009148 Bacteria 1103
206 Ga0105241_10024827 3300009174 Bacteria 4453
207 Ga0105241_10115398 3300009174 Bacteria 2155
208 Ga0105241_10511232 3300009174 Bacteria 1073
209 Ga0105241_10581042 3300009174 Unclassified 1010
210 Ga0105241_10771101 3300009174 Bacteria 883
211 Ga0105241_11299481 3300009174 Bacteria 693
212 Ga0105242_10021858 3300009176 Bacteria 5027
213 Ga0105242_10110646 3300009176 Bacteria 2341
214 Ga0105248_10003642 3300009177 Bacteria 17107
215 Ga0105248_10004355 3300009177 Bacteria 15659
216 Ga0105248_10083570 3300009177 Bacteria 3591
217 Ga0105248_10114646 3300009177 Bacteria 3040
218 Ga0105248_10135557 3300009177 Unclassified 2777
219 Ga0105248_10240279 3300009177 Bacteria 2039
220 Ga0105248_10297262 3300009177 Bacteria 1818
221 Ga0105248_10300170 3300009177 Unclassified 1808
222 Ga0105248_11047925 3300009177 Bacteria 922
223 Ga0105248_11082368 3300009177 Bacteria 906
224 Ga0105237_10004036 3300009545 Bacteria 17147
225 Ga0105237_10040118 3300009545 Bacteria 4722
226 Ga0105238_10055700 3300009551 Bacteria 3969
227 Ga0105249_10000254 3300009553 Bacteria 58502
228 Ga0105249_10104466 3300009553 Bacteria 2670
229 Ga0105249_10779866 3300009553 Bacteria 1019
230 Ga0105239_10789581 3300010375 Bacteria 1088
231 Ga0105239_11182575 3300010375 Bacteria 881
232 Ga0105246_10163419 3300011119 Bacteria 1698
233 Ga0157373_10003210 3300013100 Bacteria 12367
234 Ga0157373_10012171 3300013100 Bacteria 6324
235 Ga0157373_10275292 3300013100 Unclassified 1192
236 Ga0157373_10410486 3300013100 Unclassified 971
237 Ga0157378_10044684 3300013297 Bacteria 3935
238 Ga0157378_10489099 3300013297 Bacteria 1227
239 Ga0157378_10763054 3300013297 Unclassified 991
240 Ga0163162_10000179 3300013306 Bacteria 58502
241 Ga0163162_10007237 3300013306 Bacteria 10771
242 Ga0163162_10016548 3300013306 Bacteria 7207
243 Ga0163162_10018505 3300013306 Bacteria 6825
244 Ga0163162_10042028 3300013306 Bacteria 4574
245 Ga0163162_10145983 3300013306 Bacteria 2482
246 Ga0163162_10716563 3300013306 Bacteria 1121
247 Ga0157372_10052688 3300013307 Bacteria 4532
248 Ga0157372_10552745 3300013307 Bacteria 1342
249 Ga0157372_11003357 3300013307 Bacteria 967
250 Ga0157375_10004034 3300013308 Bacteria 12736
251 Ga0157375_10089123 3300013308 Bacteria 3141
252 Ga0157375_10103885 3300013308 Bacteria 2929
253 Ga0157375_10126903 3300013308 Bacteria 2667
254 Ga0157375_10210199 3300013308 Bacteria 2103
255 Ga0157375_11086289 3300013308 Bacteria 936
256 Ga0163163_10000540 3300014325 Bacteria 33464
257 Ga0163163_10180864 3300014325 Bacteria 2156
258 Ga0163163_10199016 3300014325 Unclassified 2052
259 Ga0163163_10231170 3300014325 Bacteria 1898
260 Ga0163163_10397495 3300014325 Unclassified 1436
261 Ga0163163_10824616 3300014325 Bacteria 991
262 Ga0157380_10005314 3300014326 Bacteria 9000
263 Ga0157380_10093163 3300014326 Bacteria 2491
264 Ga0157380_10132575 3300014326 Bacteria 2128
265 Ga0157380_10238219 3300014326 Bacteria 1639
266 Ga0157380_11176011 3300014326 Bacteria 810
267 Ga0157377_10023154 3300014745 Bacteria 3289
268 Ga0157377_10278281 3300014745 Unclassified 1096
269 Ga0157379_10230221 3300014968 Bacteria 1680
270 Ga0157379_10293988 3300014968 Bacteria 1480
271 Ga0157379_10767897 3300014968 Unclassified 908
272 Ga0163161_10047154 3300017792 Bacteria 3112
273 Ga0207656_10018306 3300025321 Bacteria 2756
274 Ga0207653_10022086 3300025885 Bacteria 2020
275 Ga0207710_10000938 3300025900 Bacteria 15505
276 Ga0207710_10063494 3300025900 Unclassified 1680
277 Ga0207647_10009964 3300025904 Bacteria 6731
278 Ga0207647_10202597 3300025904 Bacteria 1147
279 Ga0207645_10099140 3300025907 Bacteria 1879
280 Ga0207645_10309722 3300025907 Bacteria 1052
281 Ga0207645_10791271 3300025907 Unclassified 645
282 Ga0207643_10000914 3300025908 Bacteria 17655
283 Ga0207684_10000065 3300025910 Bacteria 194463
284 Ga0207684_10012871 3300025910 Bacteria 7246
285 Ga0207654_10140039 3300025911 Bacteria 1542
286 Ga0207654_10275414 3300025911 Bacteria 1136
287 Ga0207654_10319399 3300025911 Bacteria 1061
288 Ga0207707_10045070 3300025912 Bacteria 3843
289 Ga0207707_10368790 3300025912 Bacteria 1236
290 Ga0207671_10003695 3300025914 Bacteria 15087
291 Ga0207660_10037000 3300025917 Bacteria 3397
292 Ga0207662_10058996 3300025918 Bacteria 2299
293 Ga0207657_10260053 3300025919 Bacteria 1381
294 Ga0207652_10299822 3300025921 Bacteria 1450
295 Ga0207646_10062703 3300025922 Unclassified 3319
296 Ga0207646_10097740 3300025922 Bacteria 2630
297 Ga0207646_10128446 3300025922 Bacteria 2280
298 Ga0207681_10062277 3300025923 Bacteria 2568
299 Ga0207681_10174168 3300025923 Bacteria 1633
300 Ga0207681_10415181 3300025923 Unclassified 1089
301 Ga0207681_10992885 3300025923 Bacteria 704
302 Ga0207650_10000046 3300025925 Bacteria 178190
303 Ga0207650_10097747 3300025925 Bacteria 2255
304 Ga0207650_10160204 3300025925 Bacteria 1782
305 Ga0207650_10263537 3300025925 Unclassified 1398
306 Ga0207650_10506961 3300025925 Bacteria 1009
307 Ga0207650_10876133 3300025925 Bacteria 762
308 Ga0207687_10192271 3300025927 Bacteria 1589
309 Ga0207690_10019206 3300025932 Bacteria 4203
310 Ga0207690_10131574 3300025932 Bacteria 1832
311 Ga0207690_10784454 3300025932 Bacteria 787
312 Ga0207706_10036057 3300025933 Bacteria 4395
313 Ga0207706_10182204 3300025933 Bacteria 1845
314 Ga0207686_10652320 3300025934 Bacteria 833
315 Ga0207709_10408654 3300025935 Bacteria 1040
316 Ga0207709_10585950 3300025935 Bacteria 881
317 Ga0207670_10333938 3300025936 Bacteria 1196
318 Ga0207665_10135244 3300025939 Bacteria 1753
319 Ga0207691_10112895 3300025940 Bacteria 2415
320 Ga0207691_10277162 3300025940 Bacteria 1443
321 Ga0207711_10003384 3300025941 Bacteria 13822
322 Ga0207711_10011609 3300025941 Bacteria 7319
323 Ga0207711_10014520 3300025941 Bacteria 6547
324 Ga0207689_10076224 3300025942 Bacteria 2757
325 Ga0207689_10147862 3300025942 Unclassified 1936
326 Ga0207689_10188152 3300025942 Bacteria 1703
327 Ga0207689_10246380 3300025942 Bacteria 1478
328 Ga0207689_10636204 3300025942 Unclassified 898
329 Ga0207689_10734734 3300025942 Unclassified 833
330 Ga0207679_10550262 3300025945 Unclassified 1035
331 Ga0207679_10872268 3300025945 Bacteria 822
332 Ga0207667_10221830 3300025949 Bacteria 1937
333 Ga0207651_10284760 3300025960 Unclassified 1368
334 Ga0207651_10330811 3300025960 Bacteria 1277
335 Ga0207712_10004973 3300025961 Bacteria 8404
336 Ga0207712_10017707 3300025961 Bacteria 4631
337 Ga0207712_10276970 3300025961 Unclassified 1367
338 Ga0207712_10921584 3300025961 Bacteria 773
339 Ga0207668_10010077 3300025972 Bacteria 5693
340 Ga0207640_10123827 3300025981 Bacteria 1857
341 Ga0207640_10199789 3300025981 Unclassified 1514
342 Ga0207703_10037624 3300026035 Unclassified 3855
343 Ga0207703_10093458 3300026035 Unclassified 2533
344 Ga0207703_10255068 3300026035 Bacteria 1583
345 Ga0207703_10283981 3300026035 Bacteria 1504
346 Ga0207703_10388972 3300026035 Unclassified 1292
347 Ga0207703_10821089 3300026035 Bacteria 888
348 Ga0207708_10000083 3300026075 Bacteria 74423
349 Ga0207708_10035362 3300026075 Bacteria 3802
350 Ga0207708_10089395 3300026075 Unclassified 2374
351 Ga0207708_10128598 3300026075 Bacteria 1978
352 Ga0207708_10646380 3300026075 Unclassified 900
353 Ga0207708_10992880 3300026075 Unclassified 729
354 Ga0207641_10071180 3300026088 Unclassified 2990
355 Ga0207641_10127906 3300026088 Bacteria 2277
356 Ga0207641_10338685 3300026088 Bacteria 1431
357 Ga0207648_10016472 3300026089 Bacteria 6751
358 Ga0207648_10365231 3300026089 Unclassified 1303
359 Ga0207648_10375982 3300026089 Unclassified 1284
360 Ga0207676_10001749 3300026095 Bacteria 15935
361 Ga0207676_10136423 3300026095 Bacteria 2094
362 Ga0207676_10424352 3300026095 Bacteria 1248
363 Ga0207674_10000006 3300026116 Bacteria 233530
364 Ga0207674_10095800 3300026116 Bacteria 2953
365 Ga0207674_10095986 3300026116 Bacteria 2950
366 Ga0207675_100027696 3300026118 Bacteria 5278
367 Ga0207675_100083100 3300026118 Bacteria 3003
368 Ga0207675_100098841 3300026118 Unclassified 2749
369 Ga0207675_100256460 3300026118 Bacteria 1694
370 Ga0207675_100285236 3300026118 Bacteria 1605
371 Ga0207675_101255335 3300026118 Unclassified 761
372 Ga0207683_10667661 3300026121 Bacteria 963
373 Ga0207698_10176337 3300026142 Unclassified 1888
374 Ga0207698_10454381 3300026142 Bacteria 1237
375 Ga0207428_10092745 3300027907 Bacteria 2343
376 Ga0268265_10020244 3300028380 Bacteria 4642
377 Ga0268265_10075961 3300028380 Bacteria 2634
378 Ga0268265_10080970 3300028380 Bacteria 2563
379 Ga0268265_10258519 3300028380 Bacteria 1547
380 Ga0268265_10695675 3300028380 Bacteria 982
381 Ga0268264_10025223 3300028381 Unclassified 4857
382 Ga0268264_10102761 3300028381 Bacteria 2487
383 Ga0268264_10121312 3300028381 Bacteria 2304
384 Ga0268264_10140194 3300028381 Bacteria 2155
385 Ga0307408_100048003 3300031548 Bacteria 3060
386 Ga0307408_100181091 3300031548 Bacteria 1690
387 Ga0307408_100324895 3300031548 Unclassified 1297
388 Ga0307405_10043849 3300031731 Bacteria 2732
389 Ga0307405_10082195 3300031731 Bacteria 2108
390 Ga0307413_10253310 3300031824 Bacteria 1307
391 Ga0307410_10115752 3300031852 Bacteria 1947
392 Ga0307406_10213663 3300031901 Bacteria 1429
393 Ga0307406_10238915 3300031901 Bacteria 1361
394 Ga0307412_10052174 3300031911 Bacteria 2707
395 Ga0307409_100256460 3300031995 Bacteria 1602
396 Ga0307416_100452905 3300032002 Bacteria 1336
397 Ga0307414_10061201 3300032004 Bacteria 2666
398 Ga0307414_10588416 3300032004 Bacteria 996
399 Ga0307411_10072558 3300032005 Bacteria 2338
400 Ga0307411_10220540 3300032005 Bacteria 1471
401 Ga0307411_10268192 3300032005 Bacteria 1352
402 Ga0307411_10354856 3300032005 Bacteria 1197
403 Ga0307415_100021402 3300032126 Bacteria 3974
404 Ga0373951_0000419 3300035091 Bacteria 12462
405 Ga0373941_0036367 3300035115 Bacteria 1497
406 Ga0373937_0033453 3300036401 Unclassified 4669
407 Ga0395900_0051906 3300037418 Bacteria 4223
408 Ga0395898_0501603 3300037466 Bacteria 1154
409 Ga0395898_0614416 3300037466 Bacteria 1030
410 Ga0395901_0103716 3300038443 Bacteria 2984
411 Ga0395901_0198223 3300038443 Unclassified 2105
412 Ga0395901_0647846 3300038443 Bacteria 1060
413 Ga0439448_0062722 3300042005 Bacteria 1230
414 Ga0439446_0082169 3300042156 Bacteria 999
415 Ga0439458_0030956 3300042157 Bacteria 1274
416 Ga0496110_0343009 3300048913 Bacteria 1361
417 Ga0501291_008265 3300049514 Bacteria 1434
418 Ga0501292_016501 3300049515 Unclassified 1162
419 Ga0501296_004046 3300049519 Bacteria 1585
420 Ga0501298_001905 3300049521 Bacteria 3108
421 Ga0501298_012662 3300049521 Bacteria 1483
422 Ga0501298_020971 3300049521 Bacteria 1221
423 Ga0501299_002472 3300049522 Bacteria 2559
424 Ga0501299_050506 3300049522 Bacteria 858
425 Ga0501198_003554 3300049649 Bacteria 2134
426 Ga0501202_039451 3300049652 Bacteria 1015
427 Ga0501206_030336 3300049653 Bacteria 802
428 Ga0501207_042074 3300049654 Bacteria 796
429 Ga0501214_004392 3300049659 Bacteria 1302
430 Ga0501217_071587 3300049661 Bacteria 944
431 Ga0501227_014429 3300049665 Bacteria 1753
432 Ga0501227_126225 3300049665 Bacteria 694
433 Ga0501233_042084 3300049668 Bacteria 1078
434 Ga0501235_010692 3300049669 Bacteria 2006
435 Ga0501235_027777 3300049669 Bacteria 1270
436 Ga0501235_043251 3300049669 Unclassified 1033
437 Ga0501249_046064 3300049679 Unclassified 996
438 Ga0501253_047111 3300049683 Unclassified 891
439 Ga0501253_071862 3300049683 Bacteria 766
440 Ga0501255_026365 3300049684 Unclassified 785
441 Ga0501257_020457 3300049686 Bacteria 1554
442 Ga0501257_070714 3300049686 Unclassified 891
443 Ga0501259_015822 3300049688 Bacteria 1291
444 Ga0501259_016174 3300049688 Bacteria 1280
445 Ga0501225_0008054 3300049705 Bacteria 3033
446 Ga0501225_0014277 3300049705 Bacteria 2219
447 Ga0501234_003186 3300049707 Bacteria 2582
448 Ga0501245_016989 3300049708 Bacteria 1109
449 Ga0501241_028138 3300049758 Bacteria 1054
450 Ga0501274_006149 3300049771 Bacteria 1031
451 nmdc:mga05p37_159065_c1 3300050507 Bacteria 2759
452 nmdc:mga05p37_373843_c1 3300050507 Bacteria 1672
453 nmdc:mga05p37_42694_c1 3300050507 Bacteria 5573
454 nmdc:mga05p37_433922_c1 3300050507 Bacteria 1525
455 nmdc:mga05p37_577298_c1 3300050507 Bacteria 1274
456 nmdc:mga09592_1005022_c1 3300050508 Bacteria 697
457 nmdc:mga09592_422676_c1 3300050508 Bacteria 1151
458 nmdc:mga09592_488956_c1 3300050508 Bacteria 1060
459 nmdc:mga09592_87645_c1 3300050508 Bacteria 2657
460 nmdc:mga0qj67_24628_c1 3300050509 Bacteria 4642
461 nmdc:mga0qj67_61169_c1 3300050509 Bacteria 2990
462 nmdc:mga06r32_155881_c1 3300050510 Bacteria 2265
463 nmdc:mga06r32_197682_c1 3300050510 Bacteria 1998
464 nmdc:mga08y16_162583_c1 3300050511 Bacteria 2320
465 nmdc:mga08y16_42738_c1 3300050511 Unclassified 4746
466 nmdc:mga08y16_433156_c1 3300050511 Bacteria 1343
467 nmdc:mga0n895_127546_c1 3300050512 Bacteria 2568
468 nmdc:mga08x19_23015_c1 3300050514 Bacteria 3863
469 nmdc:mga08x19_430513_c1 3300050514 Bacteria 927
470 nmdc:mga0a205_536821_c1 3300050515 Bacteria 1025
471 nmdc:mga0a205_60466_c1 3300050515 Bacteria 3659
472 nmdc:mga0a205_84512_c1 3300050515 Bacteria 3066
473 Ga0070700_100209476
474 SwRhRL2b_contig_80242
475 JGI24751J29686_10000249
476 Ga0065712_10067742
477 Ga0065715_10001142
478 Ga0065715_10032352
479 Ga0065715_10143169
480 Ga0065715_10157735
481 Ga0065715_10208120
482 Ga0065715_10270694
483 Ga0065715_10301292
484 Ga0065715_10364437
485 Ga0065707_10045593
486 Ga0065707_10103331
487 Ga0065707_10231112
488 Ga0070676_10040995
489 Ga0070690_100254020
490 Ga0070670_100000118
491 Ga0070670_100022772
492 Ga0070670_100124824
493 Ga0070670_100659281
494 Ga0068869_101009438
495 Ga0068869_101050808
496 Ga0070666_10395914
497 Ga0070680_100303976
498 Ga0070682_100062802
499 Ga0070660_100093124
500 Ga0070689_100531744
501 Ga0070687_100120487
502 Ga0070687_100358234
503 Ga0070692_10010638
504 Ga0070692_10101122
505 Ga0070692_10237027
506 Ga0070668_100026945
507 Ga0070668_100740559
508 Ga0070669_100003658
509 Ga0070669_100022940
510 Ga0070669_100153791
511 Ga0070669_100269467
512 Ga0070671_100510925
513 Ga0070673_100040859
514 Ga0070673_100349911
515 Ga0070673_100691440
516 Ga0070659_100003093
517 Ga0070659_100011933
518 Ga0070659_100907518
519 Ga0070667_101233123
520 Ga0070703_10070344
521 Ga0070701_10202559
522 Ga0070701_10533414
523 Ga0070705_100008100
524 Ga0070705_100011658
525 Ga0070705_100028922
526 Ga0070705_100159982
527 Ga0070705_100472239
528 Ga0070700_100000115
529 Ga0070700_100089621
530 Ga0070700_100109872
531 Ga0070700_100214925
532 Ga0070694_100461089
533 Ga0070708_100000002
534 Ga0070708_100899458
535 Ga0070662_100266711
536 Ga0070681_10004212
537 Ga0070681_10022848
538 Ga0070681_10397752
539 Ga0068867_100377067
540 Ga0068867_100442740
541 Ga0068867_100555177
542 Ga0070706_100000032
543 Ga0070706_100014698
544 Ga0070707_100337011
545 Ga0070698_100003636
546 Ga0070698_100049397
547 Ga0070699_100002994
548 Ga0070699_100193943
549 Ga0070699_100410387
550 Ga0070699_100542409
551 Ga0070699_100586658
552 Ga0070679_100013546
553 Ga0070684_100249211
554 Ga0070697_100015177
555 Ga0070697_100022661
556 Ga0068853_100171599
557 Ga0070672_100131120
558 Ga0070672_100540448
559 Ga0070695_100029022
560 Ga0070695_100057015
561 Ga0070695_100093523
562 Ga0070695_100146350
563 Ga0070695_100850830
564 Ga0070696_100018529
565 Ga0070696_100062555
566 Ga0070693_100001675
567 Ga0070693_100035327
568 Ga0070693_100310658
569 Ga0070704_100067100
570 Ga0070704_100694152
571 Ga0070704_100741305
572 Ga0070704_101129222
573 Ga0068855_100608168
574 Ga0070664_100004180
575 Ga0070664_100705827
576 Ga0070664_100987961
577 Ga0068857_100001586
578 Ga0068857_100034083
579 Ga0068857_100343134
580 Ga0068857_100607516
581 Ga0068857_100765517
582 Ga0070702_100012076
583 Ga0070702_100020738
584 Ga0070702_100155914
585 Ga0070702_100571595
586 Ga0070702_100756128
587 Ga0068852_100046722
588 Ga0068852_100179911
589 Ga0068852_100621632
590 Ga0068859_100002161
591 Ga0068859_100017992
592 Ga0068859_100049487
593 Ga0068859_100055726
594 Ga0068859_100080022
595 Ga0068859_100120627
596 Ga0068859_100180812
597 Ga0068859_100533295
598 Ga0068859_100588299
599 Ga0068859_100938191
600 Ga0068859_101227527
601 Ga0068864_100018122
602 Ga0068864_100110178
603 Ga0068861_100118079
604 Ga0068861_100128663
605 Ga0068861_100203586
606 Ga0068851_10025146
607 Ga0068851_10324441
608 Ga0068870_10112017
609 Ga0068863_100130020
610 Ga0068863_100192059
611 Ga0068863_101311812
612 Ga0068858_100013118
613 Ga0068858_100050388
614 Ga0068858_100082356
615 Ga0068858_100210685
616 Ga0068858_100353463
617 Ga0068860_100043915
618 Ga0068860_100075964
619 Ga0068860_100139218
620 Ga0068860_100796940
621 Ga0068860_101171282
622 Ga0068862_100019763
623 Ga0068862_100168916
624 Ga0068862_100938529
625 Ga0068862_101517779
626 Ga0081455_10079517
627 Ga0081539_10000390
628 Ga0070716_100104283
629 Ga0068871_100004892
630 Ga0068871_100187592
631 Ga0075428_100235051
632 Ga0075428_100328562
633 Ga0075428_101163795
634 Ga0075430_100032772
635 Ga0075430_100228948
636 Ga0075433_10010272
637 Ga0075433_10079145
638 Ga0075433_10087754
639 Ga0075434_100030100
640 Ga0075434_100085779
641 Ga0075429_100232310
642 Ga0068865_100640785
643 Ga0075436_100041674
644 Ga0097620_100002161
645 Ga0097620_100016326
646 Ga0097620_100017991
647 Ga0097620_100049486
648 Ga0097620_100055724
649 Ga0097620_100080024
650 Ga0097620_100120622
651 Ga0097620_100180821
652 Ga0097620_100533301
653 Ga0097620_100588286
654 Ga0097620_100713050
655 Ga0097620_100937971
656 Ga0097620_101227486
657 Ga0075435_100070272
658 Ga0105240_10023889
659 Ga0111539_10045939
660 Ga0111539_10139427
661 Ga0111539_10869235
662 Ga0105245_10476839
663 Ga0105245_10523647
664 Ga0105247_10004069
665 Ga0105247_10141862
666 Ga0105247_10237221
667 Ga0105247_10679753
668 Ga0114129_10033798
669 Ga0114129_10048816
670 Ga0114129_10055064
671 Ga0114129_10254563
672 Ga0114129_10500063
673 Ga0114129_10509699
674 Ga0114129_10684235
675 Ga0114129_10794826
676 Ga0105243_10028159
677 Ga0105243_10550104
678 Ga0105241_10024827
679 Ga0105241_10115398
680 Ga0105241_10511232
681 Ga0105241_10581042
682 Ga0105241_10771101
683 Ga0105241_11299481
684 Ga0105242_10021858
685 Ga0105242_10110646
686 Ga0105248_10003642
687 Ga0105248_10004355
688 Ga0105248_10083570
689 Ga0105248_10114646
690 Ga0105248_10135557
691 Ga0105248_10240279
692 Ga0105248_10297262
693 Ga0105248_10300170
694 Ga0105248_11047925
695 Ga0105248_11082368
696 Ga0105237_10004036
697 Ga0105237_10040118
698 Ga0105238_10055700
699 Ga0105249_10000254
700 Ga0105249_10104466
701 Ga0105249_10779866
702 Ga0105239_10789581
703 Ga0105239_11182575
704 Ga0105246_10163419
705 Ga0157373_10003210
706 Ga0157373_10012171
707 Ga0157373_10275292
708 Ga0157373_10410486
709 Ga0157378_10044684
710 Ga0157378_10489099
711 Ga0157378_10763054
712 Ga0163162_10000179
713 Ga0163162_10007237
714 Ga0163162_10016548
715 Ga0163162_10018505
716 Ga0163162_10042028
717 Ga0163162_10145983
718 Ga0163162_10716563
719 Ga0157372_10052688
720 Ga0157372_10552745
721 Ga0157372_11003357
722 Ga0157375_10004034
723 Ga0157375_10089123
724 Ga0157375_10103885
725 Ga0157375_10126903
726 Ga0157375_10210199
727 Ga0157375_11086289
728 Ga0163163_10000540
729 Ga0163163_10180864
730 Ga0163163_10199016
731 Ga0163163_10231170
732 Ga0163163_10397495
733 Ga0163163_10824616
734 Ga0157380_10005314
735 Ga0157380_10093163
736 Ga0157380_10132575
737 Ga0157380_10238219
738 Ga0157380_11176011
739 Ga0157377_10023154
740 Ga0157377_10278281
741 Ga0157379_10230221
742 Ga0157379_10293988
743 Ga0157379_10767897
744 Ga0163161_10047154
745 Ga0207656_10018306
746 Ga0207653_10022086
747 Ga0207710_10000938
748 Ga0207710_10063494
749 Ga0207647_10009964
750 Ga0207647_10202597
751 Ga0207645_10099140
752 Ga0207645_10309722
753 Ga0207645_10791271
754 Ga0207643_10000914
755 Ga0207684_10000065
756 Ga0207684_10012871
757 Ga0207654_10140039
758 Ga0207654_10275414
759 Ga0207654_10319399
760 Ga0207707_10045070
761 Ga0207707_10368790
762 Ga0207671_10003695
763 Ga0207660_10037000
764 Ga0207662_10058996
765 Ga0207657_10260053
766 Ga0207652_10299822
767 Ga0207646_10062703
768 Ga0207646_10097740
769 Ga0207646_10128446
770 Ga0207681_10062277
771 Ga0207681_10174168
772 Ga0207681_10415181
773 Ga0207681_10992885
774 Ga0207650_10000046
775 Ga0207650_10097747
776 Ga0207650_10160204
777 Ga0207650_10263537
778 Ga0207650_10506961
779 Ga0207650_10876133
780 Ga0207687_10192271
781 Ga0207690_10019206
782 Ga0207690_10131574
783 Ga0207690_10784454
784 Ga0207706_10036057
785 Ga0207706_10182204
786 Ga0207686_10652320
787 Ga0207709_10408654
788 Ga0207709_10585950
789 Ga0207670_10333938
790 Ga0207665_10135244
791 Ga0207691_10112895
792 Ga0207691_10277162
793 Ga0207711_10003384
794 Ga0207711_10011609
795 Ga0207711_10014520
796 Ga0207689_10076224
797 Ga0207689_10147862
798 Ga0207689_10188152
799 Ga0207689_10246380
800 Ga0207689_10636204
801 Ga0207689_10734734
802 Ga0207679_10550262
803 Ga0207679_10872268
804 Ga0207667_10221830
805 Ga0207651_10284760
806 Ga0207651_10330811
807 Ga0207712_10004973
808 Ga0207712_10017707
809 Ga0207712_10276970
810 Ga0207712_10921584
811 Ga0207668_10010077
812 Ga0207640_10123827
813 Ga0207640_10199789
814 Ga0207703_10037624
815 Ga0207703_10093458
816 Ga0207703_10255068
817 Ga0207703_10283981
818 Ga0207703_10388972
819 Ga0207703_10821089
820 Ga0207708_10000083
821 Ga0207708_10035362
822 Ga0207708_10089395
823 Ga0207708_10128598
824 Ga0207708_10646380
825 Ga0207708_10992880
826 Ga0207641_10071180
827 Ga0207641_10127906
828 Ga0207641_10338685
829 Ga0207648_10016472
830 Ga0207648_10365231
831 Ga0207648_10375982
832 Ga0207676_10001749
833 Ga0207676_10136423
834 Ga0207676_10424352
835 Ga0207674_10000006
836 Ga0207674_10095800
837 Ga0207674_10095986
838 Ga0207675_100027696
839 Ga0207675_100083100
840 Ga0207675_100098841
841 Ga0207675_100256460
842 Ga0207675_100285236
843 Ga0207675_101255335
844 Ga0207683_10667661
845 Ga0207698_10176337
846 Ga0207698_10454381
847 Ga0207428_10092745
848 Ga0268265_10020244
849 Ga0268265_10075961
850 Ga0268265_10080970
851 Ga0268265_10258519
852 Ga0268265_10695675
853 Ga0268264_10025223
854 Ga0268264_10102761
855 Ga0268264_10121312
856 Ga0268264_10140194
857 Ga0307408_100048003
858 Ga0307408_100181091
859 Ga0307408_100324895
860 Ga0307405_10043849
861 Ga0307405_10082195
862 Ga0307413_10253310
863 Ga0307410_10115752
864 Ga0307406_10213663
865 Ga0307406_10238915
866 Ga0307412_10052174
867 Ga0307409_100256460
868 Ga0307416_100452905
869 Ga0307414_10061201
870 Ga0307414_10588416
871 Ga0307411_10072558
872 Ga0307411_10220540
873 Ga0307411_10268192
874 Ga0307411_10354856
875 Ga0307415_100021402
876 Ga0373951_0000419
877 Ga0373941_0036367
878 Ga0373937_0033453
879 Ga0395900_0051906
880 Ga0395898_0501603
881 Ga0395898_0614416
882 Ga0395901_0103716
883 Ga0395901_0198223
884 Ga0395901_0647846
885 Ga0439448_0062722
886 Ga0439446_0082169
887 Ga0439458_0030956
888 Ga0496110_0343009
889 Ga0501291_008265
890 Ga0501292_016501
891 Ga0501296_004046
892 Ga0501298_001905
893 Ga0501298_012662
894 Ga0501298_020971
895 Ga0501299_002472
896 Ga0501299_050506
897 Ga0501198_003554
898 Ga0501202_039451
899 Ga0501206_030336
900 Ga0501207_042074
901 Ga0501214_004392
902 Ga0501217_071587
903 Ga0501227_014429
904 Ga0501227_126225
905 Ga0501233_042084
906 Ga0501235_010692
907 Ga0501235_027777
908 Ga0501235_043251
909 Ga0501249_046064
910 Ga0501253_047111
911 Ga0501253_071862
912 Ga0501255_026365
913 Ga0501257_020457
914 Ga0501257_070714
915 Ga0501259_015822
916 Ga0501259_016174
917 Ga0501225_0008054
918 Ga0501225_0014277
919 Ga0501234_003186
920 Ga0501245_016989
921 Ga0501241_028138
922 Ga0501274_006149
923 nmdc:mga05p37_159065_c1
924 nmdc:mga05p37_373843_c1
925 nmdc:mga05p37_42694_c1
926 nmdc:mga05p37_433922_c1
927 nmdc:mga05p37_577298_c1
928 nmdc:mga09592_1005022_c1
929 nmdc:mga09592_422676_c1
930 nmdc:mga09592_488956_c1
931 nmdc:mga09592_87645_c1
932 nmdc:mga0qj67_24628_c1
933 nmdc:mga0qj67_61169_c1
934 nmdc:mga06r32_155881_c1
935 nmdc:mga06r32_197682_c1
936 nmdc:mga08y16_162583_c1
937 nmdc:mga08y16_42738_c1
938 nmdc:mga08y16_433156_c1
939 nmdc:mga0n895_127546_c1
940 nmdc:mga08x19_23015_c1
941 nmdc:mga08x19_430513_c1
942 nmdc:mga0a205_536821_c1
943 nmdc:mga0a205_60466_c1
944 nmdc:mga0a205_84512_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

30

211

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f6r-assembly1.cif.gz_A crystal structure of bifunctional coenzyme a synthase (coa synthase): (18044849) from mus musculus at 1.70 a resolution 0.8996 1 198
2f6r-assembly1.cif.gz_A crystal structure of bifunctional coenzyme a synthase (coa synthase): (18044849) from mus musculus at 1.70 a resolution 0.8749 1 198
1n3b-assembly1.cif.gz_C crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.8588 2 200
1n3b-assembly1.cif.gz_A crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.8577 2 200
1uf9-assembly3.cif.gz_C crystal structure of tt1252 from thermus thermophilus 0.8575 2 195
ID Description Score Start End Superfamily
af_Q9BL56_263_460_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9509 2 198 3.40.50.300
af_Q9VRP4_309_517_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.948 2 200 3.40.50.300
af_Q54N39_1_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9441 1 202 3.40.50.300
af_Q54N39_1_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9396 1 202 3.40.50.300
af_Q13057_357_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9304 1 198 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W0GT09-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.991 1 201 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7W0GT09-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9813 1 201 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7W0G5H0-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9792 1 200 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A2A5WPX9-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9765 1 196 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A2V2FI66-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9758 2 201 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Map