F450560

General Info

Members Datasets Scaffolds Average Seq Length
471 283 432 178

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_101064057|Ga0068856_1010640572
Length 215
Sequence MDRSRISSSRKRRCDRRLALNRSWSKERADHSLLRLKDPMDLSKIPVGVNPPYDVNAIIEIPQGGEPVKYEIDKESGALFVDRFLHTAMFYPGNYGFIPHTLADDGDPMDIMVVGQTPVVPGAIIRARPIGALMMTDEAGGDEKVLAVPVDALHPFYTGVDSWRSLPRILTEQIAHFFQHYKDLEKGKSVEIVRWADPEEAAELIRASIERAKAG

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
4 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
5 2643221593 Lysobacter sp. Root690 Isolate Unclassified
6 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
7 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
8 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
9 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
10 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
11 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
12 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
13 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
14 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
15 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
16 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
17 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
18 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
19 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
20 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
21 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
22 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
23 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
24 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
25 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
26 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
27 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
28 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
260 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
264 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
274 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
275 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
276 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
277 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
278 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
279 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
280 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
281 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
282 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
283 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.72
Metatranscriptomes 0
Isolates 8.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 5.94
Rhizoplane 5.73
Rhizosphere 76.01
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1010668 3300002741 Bacteria 1204
2 Ga0055530_10000586 3300003791 Bacteria 31506
3 Ga0055530_10016357 3300003791 Bacteria 2374
4 Ga0055531_10000968 3300003794 Bacteria 22999
5 Ga0055531_10026269 3300003794 Bacteria 2082
6 Ga0055543_1016794 3300004625 Bacteria 1387
7 Ga0065165_1000941 3300005262 Bacteria 37145
8 Ga0065714_10327071 3300005288 Bacteria 661
9 Ga0070658_10017547 3300005327 Bacteria 5725
10 Ga0070658_10140049 3300005327 Bacteria 2020
11 Ga0070676_10660779 3300005328 Bacteria 760
12 Ga0070683_100228587 3300005329 Bacteria 1768
13 Ga0070683_100747977 3300005329 Bacteria 937
14 Ga0070666_10152253 3300005335 Bacteria 1614
15 Ga0070666_10357605 3300005335 Bacteria 1046
16 Ga0070680_100024503 3300005336 Bacteria 4821
17 Ga0070680_100033104 3300005336 Bacteria 4163
18 Ga0070680_100092198 3300005336 Bacteria 2508
19 Ga0070680_100214420 3300005336 Bacteria 1624
20 Ga0070680_100246481 3300005336 Bacteria 1510
21 Ga0070680_100261879 3300005336 Bacteria 1463
22 Ga0070682_100005636 3300005337 Bacteria 6979
23 Ga0070660_100042263 3300005339 Bacteria 3478
24 Ga0070660_100089320 3300005339 Bacteria 2428
25 Ga0070660_100706490 3300005339 Bacteria 845
26 Ga0070691_10013025 3300005341 Bacteria 3809
27 Ga0070661_100206920 3300005344 Bacteria 1501
28 Ga0070661_100379046 3300005344 Bacteria 1115
29 Ga0070692_10005595 3300005345 Bacteria 5378
30 Ga0070668_100090836 3300005347 Bacteria 2406
31 Ga0070668_100198435 3300005347 Bacteria 1647
32 Ga0070668_100300030 3300005347 Bacteria 1347
33 Ga0070668_100323566 3300005347 Bacteria 1299
34 Ga0070669_100037279 3300005353 Bacteria 3527
35 Ga0070669_100254765 3300005353 Bacteria 1398
36 Ga0070669_100332682 3300005353 Bacteria 1229
37 Ga0070671_100475823 3300005355 Bacteria 1073
38 Ga0070671_100534630 3300005355 Bacteria 1010
39 Ga0070673_100135604 3300005364 Bacteria 2071
40 Ga0070659_100001161 3300005366 Bacteria 19244
41 Ga0070659_100094938 3300005366 Bacteria 2395
42 Ga0070659_100243311 3300005366 Bacteria 1489
43 Ga0070667_100005167 3300005367 Bacteria 10917
44 Ga0070667_100557331 3300005367 Bacteria 1054
45 Ga0070713_100248823 3300005436 Bacteria 1621
46 Ga0070710_10533871 3300005437 Bacteria 808
47 Ga0070678_100392393 3300005456 Bacteria 1204
48 Ga0070662_100429098 3300005457 Bacteria 1094
49 Ga0070662_100504075 3300005457 Bacteria 1010
50 Ga0070681_10053949 3300005458 Bacteria 4005
51 Ga0070681_10069173 3300005458 Bacteria 3497
52 Ga0070681_10909315 3300005458 Bacteria 799
53 Ga0070698_100265919 3300005471 Bacteria 1647
54 Ga0070679_100069326 3300005530 Bacteria 3517
55 Ga0070679_100071264 3300005530 Bacteria 3466
56 Ga0070679_100111707 3300005530 Bacteria 2719
57 Ga0070679_100144915 3300005530 Bacteria 2353
58 Ga0070679_100185173 3300005530 Bacteria 2053
59 Ga0070679_100469520 3300005530 Bacteria 1203
60 Ga0070684_100495036 3300005535 Bacteria 1132
61 Ga0068853_100053110 3300005539 Bacteria 3490
62 Ga0068853_100100287 3300005539 Bacteria 2560
63 Ga0068853_100115853 3300005539 Bacteria 2386
64 Ga0068853_100168513 3300005539 Bacteria 1980
65 Ga0070693_100088631 3300005547 Bacteria 1861
66 Ga0070693_100629437 3300005547 Bacteria 778
67 Ga0070665_100002021 3300005548 Bacteria 22808
68 Ga0068855_100091562 3300005563 Bacteria 3507
69 Ga0068855_100100905 3300005563 Bacteria 3322
70 Ga0068855_100128888 3300005563 Bacteria 2890
71 Ga0068855_100169074 3300005563 Bacteria 2476
72 Ga0068855_100340310 3300005563 Bacteria 1654
73 Ga0068855_100431448 3300005563 Bacteria 1440
74 Ga0068855_102077705 3300005563 Bacteria 572
75 Ga0070664_100386288 3300005564 Bacteria 1279
76 Ga0070664_100742798 3300005564 Bacteria 916
77 Ga0068857_100196294 3300005577 Bacteria 1839
78 Ga0068857_100735173 3300005577 Bacteria 939
79 Ga0068856_100180523 3300005614 Bacteria 2124
80 Ga0068856_101031476 3300005614 Bacteria 841
81 Ga0068856_101064057 3300005614 Bacteria 827
82 Ga0068852_100111802 3300005616 Bacteria 2484
83 Ga0068852_100115782 3300005616 Bacteria 2444
84 Ga0068852_101044139 3300005616 Bacteria 836
85 Ga0068859_100083263 3300005617 Bacteria 3242
86 Ga0068859_100277059 3300005617 Bacteria 1770
87 Ga0068864_100006635 3300005618 Bacteria 9474
88 Ga0068866_10589344 3300005718 Bacteria 749
89 Ga0068861_100796488 3300005719 Bacteria 887
90 Ga0068851_10032348 3300005834 Bacteria 2603
91 Ga0068863_100027950 3300005841 Bacteria 5384
92 Ga0068863_100110501 3300005841 Bacteria 2618
93 Ga0068860_100001901 3300005843 Bacteria 22162
94 Ga0068860_100032863 3300005843 Bacteria 4983
95 Ga0068862_100014066 3300005844 Bacteria 6638
96 Ga0068862_100080590 3300005844 Bacteria 2823
97 Ga0081455_10077629 3300005937 Bacteria 2731
98 Ga0070717_10383363 3300006028 Bacteria 1261
99 Ga0075363_100210235 3300006048 Bacteria 1113
100 Ga0075362_10029089 3300006177 Bacteria 2378
101 Ga0075367_10337885 3300006178 Bacteria 950
102 Ga0068871_101263733 3300006358 Bacteria 694
103 Ga0075428_100002292 3300006844 Bacteria 20711
104 Ga0075430_100046368 3300006846 Bacteria 3671
105 Ga0075431_100000098 3300006847 Bacteria 54303
106 Ga0075433_10512945 3300006852 Bacteria 1055
107 Ga0075434_100027339 3300006871 Bacteria 5601
108 Ga0075429_100159825 3300006880 Bacteria 1973
109 Ga0068865_100000389 3300006881 Bacteria 24391
110 Ga0097620_100083262 3300006931 Bacteria 3242
111 Ga0097620_100277083 3300006931 Bacteria 1770
112 Ga0075435_100210639 3300007076 Bacteria 1649
113 Ga0105240_10050780 3300009093 Bacteria 5226
114 Ga0105240_10089805 3300009093 Bacteria 3757
115 Ga0105240_10091829 3300009093 Bacteria 3708
116 Ga0105240_10106061 3300009093 Bacteria 3409
117 Ga0105240_10201150 3300009093 Bacteria 2334
118 Ga0105240_10947857 3300009093 Bacteria 923
119 Ga0111539_10000703 3300009094 Bacteria 43347
120 Ga0111539_10015275 3300009094 Bacteria 9563
121 Ga0105245_11033971 3300009098 Bacteria 867
122 Ga0114129_10000057 3300009147 Bacteria 99258
123 Ga0114129_11798760 3300009147 Bacteria 745
124 Ga0105241_10031728 3300009174 Bacteria 3956
125 Ga0105241_11359594 3300009174 Bacteria 678
126 Ga0105242_10023812 3300009176 Bacteria 4831
127 Ga0105242_10069818 3300009176 Bacteria 2911
128 Ga0105242_10758045 3300009176 Bacteria 956
129 Ga0105248_10000170 3300009177 Bacteria 75642
130 Ga0105248_10079570 3300009177 Bacteria 3684
131 Ga0105248_10404334 3300009177 Bacteria 1537
132 Ga0105237_10384941 3300009545 Bacteria 1407
133 Ga0105237_10416576 3300009545 Bacteria 1349
134 Ga0105238_10040354 3300009551 Bacteria 4730
135 Ga0105238_10068325 3300009551 Bacteria 3555
136 Ga0105238_10156771 3300009551 Bacteria 2252
137 Ga0105239_10152896 3300010375 Bacteria 2575
138 Ga0105239_10163573 3300010375 Bacteria 2488
139 Ga0105239_12483731 3300010375 Bacteria 604
140 Ga0105246_10865158 3300011119 Bacteria 808
141 Ga0157371_10023507 3300013102 Bacteria 4507
142 Ga0157371_10378446 3300013102 Bacteria 1033
143 Ga0157370_10050452 3300013104 Bacteria 3977
144 Ga0157370_10119404 3300013104 Bacteria 2462
145 Ga0157370_10200744 3300013104 Bacteria 1850
146 Ga0157370_10319716 3300013104 Bacteria 1431
147 Ga0157370_11271995 3300013104 Bacteria 663
148 Ga0157369_10012217 3300013105 Bacteria 9751
149 Ga0157369_10401014 3300013105 Bacteria 1423
150 Ga0157369_10417756 3300013105 Bacteria 1390
151 Ga0157369_10766946 3300013105 Bacteria 992
152 Ga0157374_10624750 3300013296 Bacteria 1088
153 Ga0157372_10021864 3300013307 Bacteria 6914
154 Ga0157372_10630011 3300013307 Bacteria 1249
155 Ga0163163_10081481 3300014325 Bacteria 3238
156 Ga0163163_10127535 3300014325 Bacteria 2583
157 Ga0163163_11448706 3300014325 Bacteria 748
158 Ga0157377_10074885 3300014745 Bacteria 1965
159 Ga0157379_10698787 3300014968 Bacteria 952
160 Ga0157376_10826543 3300014969 Bacteria 940
161 Ga0207425_1045985 3300025245 Bacteria 814
162 Ga0209026_1007923 3300025250 Bacteria 2296
163 Ga0209148_1028471 3300025254 Bacteria 850
164 Ga0209025_1000200 3300025294 Bacteria 146048
165 Ga0209758_1000852 3300025297 Bacteria 42442
166 Ga0209758_1016488 3300025297 Bacteria 3749
167 Ga0209050_1000053 3300025298 Bacteria 349521
168 Ga0209257_1000289 3300025304 Bacteria 110882
169 Ga0209257_1003844 3300025304 Bacteria 12300
170 Ga0207645_10390831 3300025907 Bacteria 935
171 Ga0207705_10003453 3300025909 Bacteria 12024
172 Ga0207705_10097102 3300025909 Bacteria 2163
173 Ga0207705_10106784 3300025909 Bacteria 2065
174 Ga0207707_10068309 3300025912 Bacteria 3096
175 Ga0207707_10072198 3300025912 Bacteria 3008
176 Ga0207707_10111406 3300025912 Bacteria 2392
177 Ga0207695_10011899 3300025913 Bacteria 10484
178 Ga0207695_10018076 3300025913 Bacteria 8160
179 Ga0207695_10046261 3300025913 Bacteria 4613
180 Ga0207695_10153521 3300025913 Bacteria 2239
181 Ga0207695_10250926 3300025913 Bacteria 1669
182 Ga0207660_10002946 3300025917 Bacteria 11127
183 Ga0207660_10006933 3300025917 Bacteria 7337
184 Ga0207660_10036734 3300025917 Bacteria 3407
185 Ga0207660_10092115 3300025917 Bacteria 2249
186 Ga0207660_10129999 3300025917 Bacteria 1916
187 Ga0207662_10099913 3300025918 Bacteria 1797
188 Ga0207657_10019320 3300025919 Bacteria 6475
189 Ga0207657_10020604 3300025919 Bacteria 6227
190 Ga0207657_10132655 3300025919 Bacteria 2040
191 Ga0207657_10189030 3300025919 Bacteria 1662
192 Ga0207649_10264023 3300025920 Bacteria 1245
193 Ga0207649_10578918 3300025920 Bacteria 862
194 Ga0207652_10004969 3300025921 Bacteria 10765
195 Ga0207652_10010739 3300025921 Bacteria 7373
196 Ga0207652_10124751 3300025921 Bacteria 2293
197 Ga0207652_10245889 3300025921 Bacteria 1613
198 Ga0207652_10505303 3300025921 Bacteria 1088
199 Ga0207681_10010590 3300025923 Bacteria 5652
200 Ga0207681_10084781 3300025923 Bacteria 2247
201 Ga0207681_10576837 3300025923 Bacteria 928
202 Ga0207681_10711335 3300025923 Bacteria 835
203 Ga0207694_10071099 3300025924 Bacteria 2719
204 Ga0207694_10084265 3300025924 Bacteria 2500
205 Ga0207694_10716304 3300025924 Bacteria 844
206 Ga0207650_10093098 3300025925 Bacteria 2306
207 Ga0207650_10189578 3300025925 Bacteria 1642
208 Ga0207664_10269724 3300025929 Bacteria 1491
209 Ga0207644_10020086 3300025931 Bacteria 4538
210 Ga0207644_10761289 3300025931 Bacteria 809
211 Ga0207690_10000142 3300025932 Bacteria 57187
212 Ga0207690_10130356 3300025932 Bacteria 1839
213 Ga0207690_10147701 3300025932 Bacteria 1740
214 Ga0207690_10625938 3300025932 Bacteria 880
215 Ga0207706_10470254 3300025933 Bacteria 1087
216 Ga0207686_10386602 3300025934 Bacteria 1062
217 Ga0207670_10144959 3300025936 Bacteria 1755
218 Ga0207704_10011550 3300025938 Bacteria 4351
219 Ga0207691_10288317 3300025940 Bacteria 1412
220 Ga0207711_10000374 3300025941 Bacteria 47567
221 Ga0207711_10055342 3300025941 Bacteria 3406
222 Ga0207689_10226427 3300025942 Bacteria 1545
223 Ga0207661_10693081 3300025944 Bacteria 937
224 Ga0207661_10930014 3300025944 Bacteria 801
225 Ga0207679_10552192 3300025945 Bacteria 1033
226 Ga0207667_10018510 3300025949 Bacteria 7809
227 Ga0207667_10020344 3300025949 Bacteria 7386
228 Ga0207667_10031236 3300025949 Bacteria 5751
229 Ga0207667_10054171 3300025949 Bacteria 4219
230 Ga0207667_10079532 3300025949 Bacteria 3398
231 Ga0207667_10124014 3300025949 Bacteria 2661
232 Ga0207667_10158166 3300025949 Bacteria 2331
233 Ga0207651_10140428 3300025960 Bacteria 1865
234 Ga0207668_10223540 3300025972 Bacteria 1513
235 Ga0207668_10273121 3300025972 Bacteria 1383
236 Ga0207640_10070181 3300025981 Bacteria 2355
237 Ga0207703_10304047 3300026035 Bacteria 1456
238 Ga0207639_10006672 3300026041 Bacteria 7850
239 Ga0207639_10050622 3300026041 Bacteria 3155
240 Ga0207639_10211760 3300026041 Bacteria 1669
241 Ga0207639_10652065 3300026041 Bacteria 974
242 Ga0207678_10189701 3300026067 Bacteria 1756
243 Ga0207702_10149159 3300026078 Bacteria 2125
244 Ga0207702_11015777 3300026078 Bacteria 823
245 Ga0207641_10013559 3300026088 Bacteria 6685
246 Ga0207641_10097001 3300026088 Bacteria 2590
247 Ga0207641_10586110 3300026088 Bacteria 1090
248 Ga0207676_10003035 3300026095 Bacteria 11983
249 Ga0207676_10108339 3300026095 Bacteria 2319
250 Ga0207674_10103587 3300026116 Bacteria 2825
251 Ga0207674_10230310 3300026116 Bacteria 1800
252 Ga0207674_10644737 3300026116 Bacteria 1023
253 Ga0207674_11004338 3300026116 Bacteria 804
254 Ga0207683_10082124 3300026121 Bacteria 2862
255 Ga0207698_10062341 3300026142 Bacteria 2911
256 Ga0207698_10230515 3300026142 Bacteria 1681
257 Ga0207698_10742893 3300026142 Bacteria 979
258 Ga0207698_10986862 3300026142 Bacteria 852
259 Ga0209981_1000452 3300027378 Bacteria 5175
260 Ga0209999_1000706 3300027543 Bacteria 5404
261 Ga0207428_10003301 3300027907 Bacteria 15690
262 Ga0268266_10000003 3300028379 Bacteria 1701703
263 Ga0268265_10002265 3300028380 Bacteria 14691
264 Ga0268265_10010508 3300028380 Bacteria 6250
265 Ga0268265_10072276 3300028380 Bacteria 2690
266 Ga0268264_10000014 3300028381 Bacteria 509962
267 Ga0268264_10062924 3300028381 Bacteria 3117
268 Ga0307517_10003957 3300028786 Bacteria 22943
269 Ga0307517_10063627 3300028786 Bacteria 3446
270 Ga0307511_10032016 3300030521 Bacteria 4684
271 Ga0316181_1232900 3300030744 Bacteria 2817
272 Ga0265340_10137734 3300031247 Bacteria 1117
273 Ga0265339_10118915 3300031249 Bacteria 1360
274 Ga0265331_10035122 3300031250 Bacteria 2468
275 Ga0265327_10001598 3300031251 Bacteria 27550
276 Ga0265327_10038068 3300031251 Bacteria 2628
277 Ga0265316_10066524 3300031344 Bacteria 2789
278 Ga0307513_10000100 3300031456 Bacteria 125183
279 Ga0307513_10000649 3300031456 Bacteria 50063
280 Ga0307513_10003278 3300031456 Bacteria 22053
281 Ga0307513_10005039 3300031456 Bacteria 17496
282 Ga0307513_10337828 3300031456 Bacteria 1258
283 Ga0307408_101289197 3300031548 Bacteria 684
284 Ga0265313_10004810 3300031595 Bacteria 10169
285 Ga0265314_10002027 3300031711 Bacteria 21464
286 Ga0265314_10038801 3300031711 Bacteria 3438
287 Ga0265342_10000182 3300031712 Bacteria 70252
288 Ga0265342_10041039 3300031712 Bacteria 2804
289 Ga0316576_10228162 3300031727 Bacteria 1400
290 Ga0316578_10016348 3300031728 Bacteria 4013
291 Ga0307412_10306388 3300031911 Bacteria 1258
292 Ga0307416_101318400 3300032002 Bacteria 828
293 Ga0307414_10369213 3300032004 Bacteria 1237
294 Ga0307414_10910531 3300032004 Bacteria 806
295 Ga0307510_10018167 3300033180 Bacteria 8278
296 Ga0307510_10268635 3300033180 Bacteria 1183
297 Ga0373950_0003277 3300034818 Bacteria 2301
298 Ga0373936_0001631 3300035113 Bacteria 8220
299 Ga0373945_0227688 3300035116 Bacteria 781
300 Ga0316574_0000621 3300035398 Bacteria 14822
301 Ga0373931_0005624 3300035691 Bacteria 5814
302 Ga0373931_0121290 3300035691 Bacteria 1495
303 Ga0373927_0058247 3300035695 Bacteria 2498
304 Ga0373927_0461572 3300035695 Bacteria 839
305 Ga0373937_1125812 3300036401 Bacteria 734
306 Ga0316584_0036608 3300036712 Bacteria 3643
307 Ga0316584_0110880 3300036712 Bacteria 2053
308 Ga0373925_0000199 3300037068 Bacteria 65400
309 Ga0395900_0794993 3300037418 Bacteria 874
310 Ga0395898_0958250 3300037466 Bacteria 792
311 Ga0395905_0192884 3300037471 Bacteria 1911
312 Ga0395905_0273190 3300037471 Bacteria 1576
313 Ga0395905_0450225 3300037471 Bacteria 1185
314 Ga0400483_190821 3300039062 Bacteria 11217
315 Ga0400483_216147 3300039062 Bacteria 3646
316 Ga0436365_0758529 3300039437 Bacteria 646
317 Ga0436360_0338142 3300039438 Bacteria 2673
318 Ga0436360_1010647 3300039438 Bacteria 1759
319 Ga0451791_0873445 3300041451 Bacteria 884
320 Ga0451795_1488464 3300041456 Bacteria 721
321 Ga0439448_0025080 3300042005 Bacteria 1868
322 Ga0439449_0079095 3300042007 Bacteria 1212
323 Ga0450901_003112 3300042533 Bacteria 1739
324 Ga0451576_0000081 3300045051 Bacteria 239875
325 Ga0495638_0098272 3300046460 Bacteria 1754
326 Ga0495620_0183328 3300046515 Bacteria 809
327 Ga0495628_0020975 3300046516 Bacteria 5382
328 Ga0495642_0045402 3300046528 Bacteria 1796
329 Ga0495621_0002366 3300046539 Bacteria 5067
330 Ga0495621_0053297 3300046539 Bacteria 1452
331 Ga0495645_0029498 3300046543 Bacteria 3990
332 Ga0495633_0001100 3300046558 Bacteria 21817
333 Ga0495668_0041392 3300046616 Bacteria 2566
334 Ga0495668_0076684 3300046616 Bacteria 1835
335 Ga0495625_0154907 3300046660 Bacteria 1538
336 Ga0495661_0381153 3300046665 Bacteria 689
337 Ga0495599_0480374 3300046678 Bacteria 733
338 Ga0495636_0079056 3300047318 Bacteria 1414
339 Ga0495672_0055534 3300047320 Bacteria 2311
340 Ga0495672_0138062 3300047320 Bacteria 1276
341 Ga0495686_0484614 3300047472 Bacteria 653
342 Ga0496100_0233955 3300048903 Bacteria 1353
343 Ga0496100_0309967 3300048903 Bacteria 1183
344 Ga0496101_0047602 3300048904 Bacteria 3079
345 Ga0496101_0248983 3300048904 Bacteria 1384
346 Ga0496101_0756780 3300048904 Bacteria 766
347 Ga0496102_0003298 3300048905 Bacteria 13683
348 Ga0496102_0285492 3300048905 Bacteria 1556
349 Ga0496103_0508814 3300048906 Bacteria 770
350 Ga0496104_0001385 3300048907 Bacteria 20962
351 Ga0496105_0109321 3300048908 Bacteria 2282
352 Ga0496107_0029308 3300048910 Bacteria 3915
353 Ga0496108_0036030 3300048911 Bacteria 4115
354 Ga0496108_0501342 3300048911 Bacteria 1060
355 Ga0496110_1321971 3300048913 Bacteria 630
356 Ga0496111_0199657 3300048914 Bacteria 1487
357 Ga0496111_0287707 3300048914 Bacteria 1219
358 Ga0496112_0015115 3300048915 Bacteria 7191
359 Ga0496112_0442821 3300048915 Bacteria 1237
360 Ga0496112_0496603 3300048915 Bacteria 1156
361 Ga0496113_0044630 3300048916 Bacteria 3285
362 Ga0496114_0534019 3300048917 Bacteria 1037
363 Ga0496115_0006365 3300048918 Bacteria 8648
364 Ga0496115_0349404 3300048918 Bacteria 1206
365 Ga0496115_0605915 3300048918 Bacteria 870
366 Ga0496115_0722075 3300048918 Bacteria 782
367 Ga0496116_0049318 3300048919 Bacteria 2817
368 Ga0496122_0002580 3300048925 Bacteria 25418
369 Ga0496123_0001918 3300048926 Bacteria 27142
370 Ga0501032_0071948 3300049569 Bacteria 2304
371 Ga0501033_0083120 3300049570 Bacteria 2347
372 Ga0501034_0093363 3300049571 Bacteria 3005
373 Ga0501034_0498951 3300049571 Bacteria 1131
374 Ga0501036_0024566 3300049572 Bacteria 5081
375 Ga0501036_0810495 3300049572 Bacteria 771
376 Ga0501037_0074956 3300049573 Bacteria 2458
377 Ga0501038_0028356 3300049574 Bacteria 4974
378 Ga0501043_0036405 3300049579 Bacteria 3871
379 Ga0501043_0112002 3300049579 Bacteria 2143
380 Ga0501046_0064844 3300049580 Bacteria 2851
381 Ga0501047_0004654 3300049581 Bacteria 12909
382 Ga0501047_0014298 3300049581 Bacteria 7548
383 Ga0501047_0027394 3300049581 Bacteria 5490
384 Ga0501047_0113927 3300049581 Bacteria 2586
385 Ga0501047_0194151 3300049581 Bacteria 1893
386 Ga0501047_0462373 3300049581 Bacteria 1097
387 Ga0501067_0039811 3300049583 Bacteria 2610
388 Ga0501070_0403696 3300049586 Bacteria 1105
389 Ga0501071_0169768 3300049587 Bacteria 1633
390 Ga0501071_0522706 3300049587 Bacteria 911
391 Ga0501072_0015798 3300049588 Bacteria 5788
392 Ga0501073_0015667 3300049589 Bacteria 5497
393 Ga0501073_0507998 3300049589 Bacteria 833
394 Ga0501074_0211061 3300049590 Bacteria 1383
395 Ga0501257_028928 3300049686 Bacteria 1330
396 Ga0501225_0128413 3300049705 Bacteria 758
397 Ga0501080_0003639 3300049742 Bacteria 13597
398 Ga0501080_0024919 3300049742 Bacteria 5549
399 Ga0501080_0389924 3300049742 Bacteria 1254
400 Ga0501083_0066894 3300049744 Bacteria 2393
401 Ga0501083_0233612 3300049744 Bacteria 1197
402 Ga0501035_0592094 3300049822 Bacteria 905
403 Ga0501044_0006807 3300049823 Bacteria 12597
404 Ga0501044_0013059 3300049823 Bacteria 8988
405 Ga0501044_0050407 3300049823 Bacteria 4295
406 Ga0501044_0364973 3300049823 Bacteria 1361
407 Ga0501044_0425438 3300049823 Bacteria 1238
408 nmdc:mga03n38_72192_c1 3300050490 Bacteria 1600
409 nmdc:mga05p37_2362_c1 3300050507 Bacteria 21952
410 nmdc:mga09592_110085_c1 3300050508 Bacteria 2363
411 nmdc:mga0qj67_82207_c1 3300050509 Bacteria 2583
412 nmdc:mga06r32_1073_c1 3300050510 Bacteria 24549
413 nmdc:mga08y16_107_c1 3300050511 Bacteria 69847
414 nmdc:mga08y16_370642_c1 3300050511 Bacteria 1469
415 nmdc:mga0n895_155591_c1 3300050512 Bacteria 2316
416 Ga0500643_001329 3300053087 Bacteria 14438
417 Ga0500644_0000378 3300053088 Bacteria 21752
418 Ga0500651_0027880 3300053093 Bacteria 3552
419 Ga0500566_0177859 3300053094 Bacteria 1094
420 Ga0500650_0208416 3300053098 Bacteria 888
421 Ga0500562_005916 3300053108 Bacteria 3079
422 Ga0500595_000006 3300053119 Bacteria 300857
423 Ga0500595_024243 3300053119 Bacteria 2120
424 Ga0500652_034902 3300053131 Bacteria 1994
425 Ga0500655_022442 3300053133 Bacteria 1188
426 Ga0500616_0000001 3300053153 Bacteria 1986011
427 Ga0500645_000937 3300053730 Bacteria 16649
428 Ga0500645_002789 3300053730 Bacteria 7538
429 Ga0500587_015250 3300053739 Bacteria 977
430 Ga0501084_0634074 3300054114 Bacteria 902
431 Ga0501082_0010833 3300060353 Bacteria 7852
432 Ga0501082_0679380 3300060353 Bacteria 901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2928972540 2928974126 172
2 iso_pu_bacteria 2977240413 2977240910 172
3 3300006844 Ga0075428_100002292 Ga0075428_10000229220 173
4 3300006846 Ga0075430_100046368 Ga0075430_1000463683 173
5 3300006847 Ga0075431_100000098 Ga0075431_10000009822 173
6 3300006880 Ga0075429_100159825 Ga0075429_1001598251 173
7 3300027907 Ga0207428_10003301 Ga0207428_1000330116 173
8 iso_pu_bacteria 2513237094 2513642102 173
9 iso_pu_bacteria 2513237104 2513718145 173
10 iso_pu_bacteria 2517093001 2517107188 173
11 iso_pu_bacteria 2524023205 2524442434 173
12 iso_pu_bacteria 2643221593 2643977591 173
13 iso_pu_bacteria 2671180139 2671694977 173
14 iso_pu_bacteria 2744054633 2745078027 173
15 iso_pu_bacteria 2791355196 2793062131 173
16 iso_pu_bacteria 2842038055 2842043423 173
17 iso_pu_bacteria 2842045827 2842052587 173
18 iso_pu_bacteria 2874620515 2874624875 173
19 iso_pu_bacteria 2876761206 2876771003 173
20 iso_pu_bacteria 2885409591 2885414134 173
21 iso_pu_bacteria 2895498888 2895499661 173
22 iso_pu_bacteria 2895511927 2895512685 173
23 iso_pu_bacteria 2904666416 2904670170 173
24 iso_pu_bacteria 2932794094 2932794233 173
25 iso_pu_bacteria 2932801729 2932808172 173
26 iso_pu_bacteria 2935608549 2935615618 173
27 iso_pu_bacteria 2935769743 2935772956 173
28 iso_pu_bacteria 2935777560 2935783253 173
29 iso_pu_bacteria 2935785616 2935788056 173
30 iso_pu_bacteria 2935793552 2935796368 173
31 iso_pu_bacteria 2935819856 2935825581 173
32 iso_pu_bacteria 2935847175 2935853345 173
33 iso_pu_bacteria 2935883170 2935890010 173
34 iso_pu_bacteria 8006926726 8006933287 173
35 iso_pu_bacteria 8016522445 8016526231 173
36 iso_pu_bacteria 8016530956 8016539848 173
37 iso_pu_bacteria 8016539877 8016544152 173
38 iso_pu_bacteria 8016566248 8016569557 173
39 iso_pu_bacteria 8016595262 8016595620 173
40 iso_pu_bacteria 8016613128 8016618371 173
41 iso_pu_bacteria 8016622563 8016623015 173
42 iso_pu_bacteria 8019530166 8019531125 173
43 iso_pu_bacteria 8019538911 8019540428 173
44 iso_pu_bacteria 8019547302 8019550018 173
45 3300005329 Ga0070683_100228587 Ga0070683_1002285872 174
46 3300005530 Ga0070679_100469520 Ga0070679_1004695202 174
47 3300005535 Ga0070684_100495036 Ga0070684_1004950362 174
48 3300005539 Ga0068853_100100287 Ga0068853_1001002873 174
49 3300005577 Ga0068857_100735173 Ga0068857_1007351732 174
50 3300009176 Ga0105242_10023812 Ga0105242_100238126 174
51 3300009551 Ga0105238_10068325 Ga0105238_100683253 174
52 3300013307 Ga0157372_10630011 Ga0157372_106300112 174
53 3300025924 Ga0207694_10071099 Ga0207694_100710993 174
54 3300025932 Ga0207690_10625938 Ga0207690_106259382 174
55 3300025934 Ga0207686_10386602 Ga0207686_103866022 174
56 3300025942 Ga0207689_10226427 Ga0207689_102264272 174
57 3300025949 Ga0207667_10018510 Ga0207667_100185107 174
58 3300026041 Ga0207639_10211760 Ga0207639_102117602 174
59 3300026078 Ga0207702_10149159 Ga0207702_101491592 174
60 3300026116 Ga0207674_10644737 Ga0207674_106447371 174
61 3300026142 Ga0207698_10986862 Ga0207698_109868622 174
62 3300028380 Ga0268265_10010508 Ga0268265_100105083 174
63 3300028381 Ga0268264_10062924 Ga0268264_100629243 174
64 3300032002 Ga0307416_101318400 Ga0307416_1013184002 174
65 3300035691 Ga0373931_0005624 Ga0373931_0005624_959_1483 174
66 3300046516 Ga0495628_0020975 Ga0495628_0020975_3917_4441 174
67 3300046543 Ga0495645_0029498 Ga0495645_0029498_2711_3235 174
68 3300049589 Ga0501073_0507998 Ga0501073_0507998_57_581 174
69 3300053739 Ga0500587_015250 Ga0500587_015250_171_695 174
70 3300005335 Ga0070666_10357605 Ga0070666_103576052 175
71 3300005341 Ga0070691_10013025 Ga0070691_100130252 175
72 3300005344 Ga0070661_100206920 Ga0070661_1002069201 175
73 3300005355 Ga0070671_100534630 Ga0070671_1005346302 175
74 3300005364 Ga0070673_100135604 Ga0070673_1001356043 175
75 3300005471 Ga0070698_100265919 Ga0070698_1002659192 175
76 3300005530 Ga0070679_100185173 Ga0070679_1001851732 175
77 3300005563 Ga0068855_100128888 Ga0068855_1001288882 175
78 3300005563 Ga0068855_100169074 Ga0068855_1001690742 175
79 3300005564 Ga0070664_100742798 Ga0070664_1007427982 175
80 3300005618 Ga0068864_100006635 Ga0068864_1000066359 175
81 3300005718 Ga0068866_10589344 Ga0068866_105893442 175
82 3300005834 Ga0068851_10032348 Ga0068851_100323482 175
83 3300006358 Ga0068871_101263733 Ga0068871_1012637331 175
84 3300009177 Ga0105248_10079570 Ga0105248_100795703 175
85 3300010375 Ga0105239_10152896 Ga0105239_101528964 175
86 3300014325 Ga0163163_10081481 Ga0163163_100814814 175
87 3300025907 Ga0207645_10390831 Ga0207645_103908312 175
88 3300025913 Ga0207695_10018076 Ga0207695_100180765 175
89 3300025920 Ga0207649_10578918 Ga0207649_105789181 175
90 3300025921 Ga0207652_10245889 Ga0207652_102458891 175
91 3300025923 Ga0207681_10576837 Ga0207681_105768371 175
92 3300025925 Ga0207650_10189578 Ga0207650_101895782 175
93 3300025931 Ga0207644_10020086 Ga0207644_100200864 175
94 3300025931 Ga0207644_10761289 Ga0207644_107612891 175
95 3300025940 Ga0207691_10288317 Ga0207691_102883172 175
96 3300025941 Ga0207711_10055342 Ga0207711_100553423 175
97 3300025949 Ga0207667_10054171 Ga0207667_100541714 175
98 3300025960 Ga0207651_10140428 Ga0207651_101404281 175
99 3300026078 Ga0207702_11015777 Ga0207702_110157772 175
100 3300026095 Ga0207676_10003035 Ga0207676_1000303511 175
101 3300026116 Ga0207674_11004338 Ga0207674_110043382 175
102 3300026121 Ga0207683_10082124 Ga0207683_100821243 175
103 3300030521 Ga0307511_10032016 Ga0307511_100320162 175
104 3300031344 Ga0265316_10066524 Ga0265316_100665242 175
105 3300035691 Ga0373931_0121290 Ga0373931_0121290_40_708 175
106 3300037466 Ga0395898_0958250 Ga0395898_0958250_217_747 175
107 3300037471 Ga0395905_0273190 Ga0395905_0273190_575_1102 175
108 3300046539 Ga0495621_0002366 Ga0495621_0002366_3619_4146 175
109 3300046616 Ga0495668_0041392 Ga0495668_0041392_757_1284 175
110 3300047318 Ga0495636_0079056 Ga0495636_0079056_367_894 175
111 3300048903 Ga0496100_0309967 Ga0496100_0309967_161_688 175
112 3300048904 Ga0496101_0047602 Ga0496101_0047602_583_1110 175
113 3300048905 Ga0496102_0003298 Ga0496102_0003298_3475_4002 175
114 3300048906 Ga0496103_0508814 Ga0496103_0508814_131_658 175
115 3300048910 Ga0496107_0029308 Ga0496107_0029308_1933_2460 175
116 3300048911 Ga0496108_0036030 Ga0496108_0036030_2561_3088 175
117 3300048915 Ga0496112_0015115 Ga0496112_0015115_1295_1822 175
118 3300048915 Ga0496112_0442821 Ga0496112_0442821_73_600 175
119 3300049569 Ga0501032_0071948 Ga0501032_0071948_1350_1877 175
120 3300049570 Ga0501033_0083120 Ga0501033_0083120_660_1187 175
121 3300049571 Ga0501034_0093363 Ga0501034_0093363_233_760 175
122 3300049572 Ga0501036_0024566 Ga0501036_0024566_1668_2195 175
123 3300049574 Ga0501038_0028356 Ga0501038_0028356_4241_4768 175
124 3300049579 Ga0501043_0036405 Ga0501043_0036405_314_841 175
125 3300049579 Ga0501043_0112002 Ga0501043_0112002_1319_1846 175
126 3300049580 Ga0501046_0064844 Ga0501046_0064844_616_1143 175
127 3300049581 Ga0501047_0004654 Ga0501047_0004654_10862_11389 175
128 3300049581 Ga0501047_0014298 Ga0501047_0014298_3535_4062 175
129 3300049581 Ga0501047_0027394 Ga0501047_0027394_4617_5144 175
130 3300049581 Ga0501047_0113927 Ga0501047_0113927_1715_2242 175
131 3300049583 Ga0501067_0039811 Ga0501067_0039811_1996_2523 175
132 3300049586 Ga0501070_0403696 Ga0501070_0403696_166_768 175
133 3300049587 Ga0501071_0522706 Ga0501071_0522706_189_716 175
134 3300049588 Ga0501072_0015798 Ga0501072_0015798_429_956 175
135 3300049589 Ga0501073_0015667 Ga0501073_0015667_2145_2672 175
136 3300049742 Ga0501080_0003639 Ga0501080_0003639_4540_5067 175
137 3300049742 Ga0501080_0024919 Ga0501080_0024919_142_669 175
138 3300049823 Ga0501044_0006807 Ga0501044_0006807_9825_10352 175
139 3300049823 Ga0501044_0013059 Ga0501044_0013059_5474_6001 175
140 3300049823 Ga0501044_0364973 Ga0501044_0364973_324_851 175
141 3300053098 Ga0500650_0208416 Ga0500650_0208416_28_555 175
142 3300053119 Ga0500595_024243 Ga0500595_024243_541_1068 175
143 3300060353 Ga0501082_0010833 Ga0501082_0010833_7265_7792 175
144 3300060353 Ga0501082_0679380 Ga0501082_0679380_362_889 175
145 3300005327 Ga0070658_10017547 Ga0070658_100175473 176
146 3300005327 Ga0070658_10140049 Ga0070658_101400492 176
147 3300005329 Ga0070683_100747977 Ga0070683_1007479771 176
148 3300005336 Ga0070680_100024503 Ga0070680_1000245032 176
149 3300005336 Ga0070680_100033104 Ga0070680_1000331043 176
150 3300005336 Ga0070680_100261879 Ga0070680_1002618792 176
151 3300005339 Ga0070660_100042263 Ga0070660_1000422634 176
152 3300005339 Ga0070660_100089320 Ga0070660_1000893202 176
153 3300005344 Ga0070661_100379046 Ga0070661_1003790461 176
154 3300005347 Ga0070668_100323566 Ga0070668_1003235662 176
155 3300005366 Ga0070659_100243311 Ga0070659_1002433112 176
156 3300005458 Ga0070681_10053949 Ga0070681_100539492 176
157 3300005530 Ga0070679_100071264 Ga0070679_1000712643 176
158 3300005530 Ga0070679_100111707 Ga0070679_1001117072 176
159 3300005539 Ga0068853_100115853 Ga0068853_1001158533 176
160 3300005563 Ga0068855_100091562 Ga0068855_1000915622 176
161 3300005563 Ga0068855_100100905 Ga0068855_1001009053 176
162 3300005563 Ga0068855_100431448 Ga0068855_1004314483 176
163 3300005614 Ga0068856_100180523 Ga0068856_1001805232 176
164 3300005614 Ga0068856_101064057 Ga0068856_1010640572 176
165 3300005616 Ga0068852_100111802 Ga0068852_1001118024 176
166 3300005616 Ga0068852_100115782 Ga0068852_1001157822 176
167 3300005616 Ga0068852_101044139 Ga0068852_1010441391 176
168 3300005617 Ga0068859_100277059 Ga0068859_1002770593 176
169 3300005719 Ga0068861_100796488 Ga0068861_1007964881 176
170 3300005843 Ga0068860_100001901 Ga0068860_10000190120 176
171 3300005844 Ga0068862_100014066 Ga0068862_1000140666 176
172 3300006048 Ga0075363_100210235 Ga0075363_1002102352 176
173 3300006931 Ga0097620_100277083 Ga0097620_1002770832 176
174 3300009093 Ga0105240_10050780 Ga0105240_100507804 176
175 3300009093 Ga0105240_10201150 Ga0105240_102011502 176
176 3300009093 Ga0105240_10947857 Ga0105240_109478572 176
177 3300009174 Ga0105241_11359594 Ga0105241_113595941 176
178 3300009545 Ga0105237_10416576 Ga0105237_104165761 176
179 3300009551 Ga0105238_10040354 Ga0105238_100403543 176
180 3300009551 Ga0105238_10156771 Ga0105238_101567714 176
181 3300010375 Ga0105239_10163573 Ga0105239_101635733 176
182 3300010375 Ga0105239_12483731 Ga0105239_124837311 176
183 3300013102 Ga0157371_10023507 Ga0157371_100235073 176
184 3300013102 Ga0157371_10378446 Ga0157371_103784462 176
185 3300013104 Ga0157370_10050452 Ga0157370_100504524 176
186 3300013104 Ga0157370_10319716 Ga0157370_103197162 176
187 3300013105 Ga0157369_10012217 Ga0157369_1001221711 176
188 3300013105 Ga0157369_10401014 Ga0157369_104010141 176
189 3300013105 Ga0157369_10417756 Ga0157369_104177562 176
190 3300013105 Ga0157369_10766946 Ga0157369_107669461 176
191 3300014968 Ga0157379_10698787 Ga0157379_106987872 176
192 3300025909 Ga0207705_10097102 Ga0207705_100971022 176
193 3300025909 Ga0207705_10106784 Ga0207705_101067842 176
194 3300025912 Ga0207707_10068309 Ga0207707_100683093 176
195 3300025912 Ga0207707_10111406 Ga0207707_101114062 176
196 3300025913 Ga0207695_10046261 Ga0207695_100462612 176
197 3300025913 Ga0207695_10250926 Ga0207695_102509262 176
198 3300025917 Ga0207660_10036734 Ga0207660_100367343 176
199 3300025917 Ga0207660_10092115 Ga0207660_100921151 176
200 3300025917 Ga0207660_10129999 Ga0207660_101299993 176
201 3300025919 Ga0207657_10019320 Ga0207657_100193202 176
202 3300025919 Ga0207657_10020604 Ga0207657_100206044 176
203 3300025920 Ga0207649_10264023 Ga0207649_102640232 176
204 3300025921 Ga0207652_10010739 Ga0207652_100107394 176
205 3300025921 Ga0207652_10505303 Ga0207652_105053032 176
206 3300025924 Ga0207694_10084265 Ga0207694_100842653 176
207 3300025924 Ga0207694_10716304 Ga0207694_107163041 176
208 3300025929 Ga0207664_10269724 Ga0207664_102697242 176
209 3300025932 Ga0207690_10147701 Ga0207690_101477012 176
210 3300025944 Ga0207661_10930014 Ga0207661_109300141 176
211 3300025949 Ga0207667_10020344 Ga0207667_100203441 176
212 3300025949 Ga0207667_10031236 Ga0207667_100312364 176
213 3300025949 Ga0207667_10079532 Ga0207667_100795323 176
214 3300025981 Ga0207640_10070181 Ga0207640_100701812 176
215 3300026041 Ga0207639_10050622 Ga0207639_100506224 176
216 3300026041 Ga0207639_10652065 Ga0207639_106520652 176
217 3300026142 Ga0207698_10062341 Ga0207698_100623412 176
218 3300026142 Ga0207698_10230515 Ga0207698_102305153 176
219 3300026142 Ga0207698_10742893 Ga0207698_107428932 176
220 3300028380 Ga0268265_10002265 Ga0268265_100022651 176
221 3300028381 Ga0268264_10000014 Ga0268264_10000014298 176
222 3300031249 Ga0265339_10118915 Ga0265339_101189152 176
223 3300031251 Ga0265327_10038068 Ga0265327_100380683 176
224 3300031456 Ga0307513_10005039 Ga0307513_1000503911 176
225 3300031595 Ga0265313_10004810 Ga0265313_100048107 176
226 3300031712 Ga0265342_10000182 Ga0265342_1000018224 176
227 3300031911 Ga0307412_10306388 Ga0307412_103063882 176
228 3300035116 Ga0373945_0227688 Ga0373945_0227688_165_695 176
229 3300035695 Ga0373927_0058247 Ga0373927_0058247_1055_1585 176
230 3300035695 Ga0373927_0461572 Ga0373927_0461572_284_814 176
231 3300036401 Ga0373937_1125812 Ga0373937_1125812_129_659 176
232 3300037068 Ga0373925_0000199 Ga0373925_0000199_4304_4834 176
233 3300037418 Ga0395900_0794993 Ga0395900_0794993_19_549 176
234 3300039062 Ga0400483_190821 Ga0400483_190821_1101_1631 176
235 3300039062 Ga0400483_216147 Ga0400483_216147_2784_3314 176
236 3300039437 Ga0436365_0758529 Ga0436365_0758529_60_590 176
237 3300041451 Ga0451791_0873445 Ga0451791_0873445_104_664 176
238 3300042533 Ga0450901_003112 Ga0450901_003112_436_993 176
239 3300046558 Ga0495633_0001100 Ga0495633_0001100_20860_21420 176
240 3300046678 Ga0495599_0480374 Ga0495599_0480374_93_623 176
241 3300047320 Ga0495672_0138062 Ga0495672_0138062_643_1173 176
242 3300048904 Ga0496101_0756780 Ga0496101_0756780_47_577 176
243 3300048914 Ga0496111_0287707 Ga0496111_0287707_310_870 176
244 3300048919 Ga0496116_0049318 Ga0496116_0049318_42_599 176
245 3300048925 Ga0496122_0002580 Ga0496122_0002580_17850_18410 176
246 3300048926 Ga0496123_0001918 Ga0496123_0001918_17843_18403 176
247 3300049581 Ga0501047_0462373 Ga0501047_0462373_374_904 176
248 3300049590 Ga0501074_0211061 Ga0501074_0211061_37_567 176
249 3300049822 Ga0501035_0592094 Ga0501035_0592094_199_729 176
250 3300049823 Ga0501044_0050407 Ga0501044_0050407_1202_1732 176
251 3300053094 Ga0500566_0177859 Ga0500566_0177859_256_786 176
252 3300053108 Ga0500562_005916 Ga0500562_005916_561_1091 176
253 3300002741 JGI25157J39369_1010668 JGI25157J39369_10106682 177
254 3300003791 Ga0055530_10000586 Ga0055530_100005865 177
255 3300003791 Ga0055530_10016357 Ga0055530_100163573 177
256 3300003794 Ga0055531_10000968 Ga0055531_1000096823 177
257 3300003794 Ga0055531_10026269 Ga0055531_100262693 177
258 3300004625 Ga0055543_1016794 Ga0055543_10167942 177
259 3300005262 Ga0065165_1000941 Ga0065165_10009413 177
260 3300005288 Ga0065714_10327071 Ga0065714_103270711 177
261 3300005328 Ga0070676_10660779 Ga0070676_106607791 177
262 3300005335 Ga0070666_10152253 Ga0070666_101522533 177
263 3300005336 Ga0070680_100092198 Ga0070680_1000921982 177
264 3300005336 Ga0070680_100214420 Ga0070680_1002144203 177
265 3300005336 Ga0070680_100246481 Ga0070680_1002464811 177
266 3300005337 Ga0070682_100005636 Ga0070682_1000056362 177
267 3300005339 Ga0070660_100706490 Ga0070660_1007064901 177
268 3300005345 Ga0070692_10005595 Ga0070692_100055952 177
269 3300005347 Ga0070668_100090836 Ga0070668_1000908361 177
270 3300005347 Ga0070668_100198435 Ga0070668_1001984352 177
271 3300005347 Ga0070668_100300030 Ga0070668_1003000302 177
272 3300005353 Ga0070669_100037279 Ga0070669_1000372791 177
273 3300005353 Ga0070669_100254765 Ga0070669_1002547652 177
274 3300005353 Ga0070669_100332682 Ga0070669_1003326821 177
275 3300005355 Ga0070671_100475823 Ga0070671_1004758231 177
276 3300005366 Ga0070659_100001161 Ga0070659_1000011613 177
277 3300005366 Ga0070659_100094938 Ga0070659_1000949382 177
278 3300005367 Ga0070667_100005167 Ga0070667_1000051678 177
279 3300005367 Ga0070667_100557331 Ga0070667_1005573312 177
280 3300005436 Ga0070713_100248823 Ga0070713_1002488231 177
281 3300005437 Ga0070710_10533871 Ga0070710_105338711 177
282 3300005456 Ga0070678_100392393 Ga0070678_1003923931 177
283 3300005457 Ga0070662_100429098 Ga0070662_1004290982 177
284 3300005457 Ga0070662_100504075 Ga0070662_1005040752 177
285 3300005458 Ga0070681_10069173 Ga0070681_100691733 177
286 3300005458 Ga0070681_10909315 Ga0070681_109093151 177
287 3300005530 Ga0070679_100069326 Ga0070679_1000693262 177
288 3300005530 Ga0070679_100144915 Ga0070679_1001449151 177
289 3300005539 Ga0068853_100053110 Ga0068853_1000531102 177
290 3300005539 Ga0068853_100168513 Ga0068853_1001685133 177
291 3300005547 Ga0070693_100088631 Ga0070693_1000886312 177
292 3300005547 Ga0070693_100629437 Ga0070693_1006294371 177
293 3300005548 Ga0070665_100002021 Ga0070665_1000020213 177
294 3300005563 Ga0068855_100340310 Ga0068855_1003403103 177
295 3300005563 Ga0068855_102077705 Ga0068855_1020777051 177
296 3300005564 Ga0070664_100386288 Ga0070664_1003862882 177
297 3300005577 Ga0068857_100196294 Ga0068857_1001962942 177
298 3300005614 Ga0068856_101031476 Ga0068856_1010314761 177
299 3300005617 Ga0068859_100083263 Ga0068859_1000832634 177
300 3300005841 Ga0068863_100027950 Ga0068863_1000279503 177
301 3300005841 Ga0068863_100110501 Ga0068863_1001105013 177
302 3300005843 Ga0068860_100032863 Ga0068860_1000328633 177
303 3300005844 Ga0068862_100080590 Ga0068862_1000805902 177
304 3300005937 Ga0081455_10077629 Ga0081455_100776293 177
305 3300006028 Ga0070717_10383363 Ga0070717_103833631 177
306 3300006177 Ga0075362_10029089 Ga0075362_100290892 177
307 3300006178 Ga0075367_10337885 Ga0075367_103378852 177
308 3300006852 Ga0075433_10512945 Ga0075433_105129451 177
309 3300006871 Ga0075434_100027339 Ga0075434_1000273393 177
310 3300006881 Ga0068865_100000389 Ga0068865_10000038922 177
311 3300006931 Ga0097620_100083262 Ga0097620_1000832624 177
312 3300007076 Ga0075435_100210639 Ga0075435_1002106391 177
313 3300009093 Ga0105240_10089805 Ga0105240_100898053 177
314 3300009093 Ga0105240_10091829 Ga0105240_100918292 177
315 3300009093 Ga0105240_10106061 Ga0105240_101060612 177
316 3300009094 Ga0111539_10000703 Ga0111539_1000070328 177
317 3300009094 Ga0111539_10015275 Ga0111539_100152752 177
318 3300009098 Ga0105245_11033971 Ga0105245_110339712 177
319 3300009147 Ga0114129_10000057 Ga0114129_1000005713 177
320 3300009147 Ga0114129_11798760 Ga0114129_117987602 177
321 3300009174 Ga0105241_10031728 Ga0105241_100317283 177
322 3300009176 Ga0105242_10069818 Ga0105242_100698183 177
323 3300009176 Ga0105242_10758045 Ga0105242_107580452 177
324 3300009177 Ga0105248_10000170 Ga0105248_1000017084 177
325 3300009177 Ga0105248_10404334 Ga0105248_104043342 177
326 3300009545 Ga0105237_10384941 Ga0105237_103849412 177
327 3300011119 Ga0105246_10865158 Ga0105246_108651581 177
328 3300013104 Ga0157370_10119404 Ga0157370_101194042 177
329 3300013104 Ga0157370_10200744 Ga0157370_102007443 177
330 3300013104 Ga0157370_11271995 Ga0157370_112719951 177
331 3300013296 Ga0157374_10624750 Ga0157374_106247502 177
332 3300013307 Ga0157372_10021864 Ga0157372_100218645 177
333 3300014325 Ga0163163_10127535 Ga0163163_101275353 177
334 3300014325 Ga0163163_11448706 Ga0163163_114487061 177
335 3300014745 Ga0157377_10074885 Ga0157377_100748853 177
336 3300014969 Ga0157376_10826543 Ga0157376_108265432 177
337 3300025245 Ga0207425_1045985 Ga0207425_10459851 177
338 3300025250 Ga0209026_1007923 Ga0209026_10079233 177
339 3300025254 Ga0209148_1028471 Ga0209148_10284712 177
340 3300025294 Ga0209025_1000200 Ga0209025_100020020 177
341 3300025297 Ga0209758_1000852 Ga0209758_10008526 177
342 3300025297 Ga0209758_1016488 Ga0209758_10164882 177
343 3300025298 Ga0209050_1000053 Ga0209050_1000053235 177
344 3300025304 Ga0209257_1000289 Ga0209257_100028940 177
345 3300025304 Ga0209257_1003844 Ga0209257_10038443 177
346 3300025909 Ga0207705_10003453 Ga0207705_100034534 177
347 3300025912 Ga0207707_10072198 Ga0207707_100721982 177
348 3300025913 Ga0207695_10011899 Ga0207695_100118993 177
349 3300025913 Ga0207695_10153521 Ga0207695_101535213 177
350 3300025917 Ga0207660_10002946 Ga0207660_100029465 177
351 3300025917 Ga0207660_10006933 Ga0207660_100069332 177
352 3300025918 Ga0207662_10099913 Ga0207662_100999133 177
353 3300025919 Ga0207657_10132655 Ga0207657_101326553 177
354 3300025919 Ga0207657_10189030 Ga0207657_101890303 177
355 3300025921 Ga0207652_10004969 Ga0207652_100049691 177
356 3300025921 Ga0207652_10124751 Ga0207652_101247512 177
357 3300025923 Ga0207681_10010590 Ga0207681_100105903 177
358 3300025923 Ga0207681_10084781 Ga0207681_100847812 177
359 3300025923 Ga0207681_10711335 Ga0207681_107113351 177
360 3300025925 Ga0207650_10093098 Ga0207650_100930983 177
361 3300025932 Ga0207690_10000142 Ga0207690_100001423 177
362 3300025932 Ga0207690_10130356 Ga0207690_101303562 177
363 3300025933 Ga0207706_10470254 Ga0207706_104702542 177
364 3300025936 Ga0207670_10144959 Ga0207670_101449592 177
365 3300025938 Ga0207704_10011550 Ga0207704_100115502 177
366 3300025941 Ga0207711_10000374 Ga0207711_100003748 177
367 3300025944 Ga0207661_10693081 Ga0207661_106930811 177
368 3300025945 Ga0207679_10552192 Ga0207679_105521922 177
369 3300025949 Ga0207667_10124014 Ga0207667_101240142 177
370 3300025949 Ga0207667_10158166 Ga0207667_101581661 177
371 3300025972 Ga0207668_10223540 Ga0207668_102235401 177
372 3300025972 Ga0207668_10273121 Ga0207668_102731212 177
373 3300026035 Ga0207703_10304047 Ga0207703_103040472 177
374 3300026041 Ga0207639_10006672 Ga0207639_100066724 177
375 3300026067 Ga0207678_10189701 Ga0207678_101897012 177
376 3300026088 Ga0207641_10013559 Ga0207641_100135597 177
377 3300026088 Ga0207641_10097001 Ga0207641_100970013 177
378 3300026088 Ga0207641_10586110 Ga0207641_105861102 177
379 3300026095 Ga0207676_10108339 Ga0207676_101083393 177
380 3300026116 Ga0207674_10103587 Ga0207674_101035871 177
381 3300026116 Ga0207674_10230310 Ga0207674_102303102 177
382 3300027378 Ga0209981_1000452 Ga0209981_10004523 177
383 3300027543 Ga0209999_1000706 Ga0209999_10007066 177
384 3300028379 Ga0268266_10000003 Ga0268266_100000031313 177
385 3300028380 Ga0268265_10072276 Ga0268265_100722763 177
386 3300028786 Ga0307517_10003957 Ga0307517_1000395718 177
387 3300028786 Ga0307517_10063627 Ga0307517_100636275 177
388 3300030744 Ga0316181_1232900 Ga0316181_12329002 177
389 3300031247 Ga0265340_10137734 Ga0265340_101377342 177
390 3300031250 Ga0265331_10035122 Ga0265331_100351222 177
391 3300031251 Ga0265327_10001598 Ga0265327_1000159815 177
392 3300031456 Ga0307513_10000100 Ga0307513_1000010056 177
393 3300031456 Ga0307513_10000649 Ga0307513_100006493 177
394 3300031456 Ga0307513_10003278 Ga0307513_1000327818 177
395 3300031456 Ga0307513_10337828 Ga0307513_103378282 177
396 3300031548 Ga0307408_101289197 Ga0307408_1012891971 177
397 3300031711 Ga0265314_10002027 Ga0265314_1000202715 177
398 3300031711 Ga0265314_10038801 Ga0265314_100388012 177
399 3300031712 Ga0265342_10041039 Ga0265342_100410392 177
400 3300031727 Ga0316576_10228162 Ga0316576_102281621 177
401 3300031728 Ga0316578_10016348 Ga0316578_100163485 177
402 3300032004 Ga0307414_10369213 Ga0307414_103692132 177
403 3300032004 Ga0307414_10910531 Ga0307414_109105311 177
404 3300033180 Ga0307510_10018167 Ga0307510_100181675 177
405 3300033180 Ga0307510_10268635 Ga0307510_102686352 177
406 3300034818 Ga0373950_0003277 Ga0373950_0003277_1065_1634 177
407 3300035113 Ga0373936_0001631 Ga0373936_0001631_518_1051 177
408 3300035398 Ga0316574_0000621 Ga0316574_0000621_10838_11374 177
409 3300036712 Ga0316584_0036608 Ga0316584_0036608_165_701 177
410 3300036712 Ga0316584_0110880 Ga0316584_0110880_698_1234 177
411 3300037471 Ga0395905_0192884 Ga0395905_0192884_927_1460 177
412 3300037471 Ga0395905_0450225 Ga0395905_0450225_354_887 177
413 3300039438 Ga0436360_0338142 Ga0436360_0338142_205_741 177
414 3300039438 Ga0436360_1010647 Ga0436360_1010647_823_1362 177
415 3300041456 Ga0451795_1488464 Ga0451795_1488464_125_658 177
416 3300042005 Ga0439448_0025080 Ga0439448_0025080_351_884 177
417 3300042007 Ga0439449_0079095 Ga0439449_0079095_320_874 177
418 3300045051 Ga0451576_0000081 Ga0451576_0000081_41572_42120 177
419 3300046460 Ga0495638_0098272 Ga0495638_0098272_455_1024 177
420 3300046515 Ga0495620_0183328 Ga0495620_0183328_257_790 177
421 3300046528 Ga0495642_0045402 Ga0495642_0045402_316_855 177
422 3300046539 Ga0495621_0053297 Ga0495621_0053297_662_1195 177
423 3300046616 Ga0495668_0076684 Ga0495668_0076684_589_1122 177
424 3300046660 Ga0495625_0154907 Ga0495625_0154907_932_1465 177
425 3300046665 Ga0495661_0381153 Ga0495661_0381153_86_619 177
426 3300047320 Ga0495672_0055534 Ga0495672_0055534_442_975 177
427 3300047472 Ga0495686_0484614 Ga0495686_0484614_17_550 177
428 3300048903 Ga0496100_0233955 Ga0496100_0233955_705_1238 177
429 3300048904 Ga0496101_0248983 Ga0496101_0248983_592_1125 177
430 3300048905 Ga0496102_0285492 Ga0496102_0285492_938_1486 177
431 3300048907 Ga0496104_0001385 Ga0496104_0001385_11265_11798 177
432 3300048908 Ga0496105_0109321 Ga0496105_0109321_988_1521 177
433 3300048911 Ga0496108_0501342 Ga0496108_0501342_29_562 177
434 3300048913 Ga0496110_1321971 Ga0496110_1321971_76_609 177
435 3300048914 Ga0496111_0199657 Ga0496111_0199657_333_866 177
436 3300048915 Ga0496112_0496603 Ga0496112_0496603_229_762 177
437 3300048916 Ga0496113_0044630 Ga0496113_0044630_706_1239 177
438 3300048917 Ga0496114_0534019 Ga0496114_0534019_383_916 177
439 3300048918 Ga0496115_0006365 Ga0496115_0006365_1513_2046 177
440 3300048918 Ga0496115_0349404 Ga0496115_0349404_60_593 177
441 3300048918 Ga0496115_0605915 Ga0496115_0605915_310_843 177
442 3300048918 Ga0496115_0722075 Ga0496115_0722075_168_701 177
443 3300049571 Ga0501034_0498951 Ga0501034_0498951_583_1116 177
444 3300049572 Ga0501036_0810495 Ga0501036_0810495_15_560 177
445 3300049573 Ga0501037_0074956 Ga0501037_0074956_1638_2177 177
446 3300049581 Ga0501047_0194151 Ga0501047_0194151_224_769 177
447 3300049587 Ga0501071_0169768 Ga0501071_0169768_875_1414 177
448 3300049686 Ga0501257_028928 Ga0501257_028928_334_867 177
449 3300049705 Ga0501225_0128413 Ga0501225_0128413_99_632 177
450 3300049742 Ga0501080_0389924 Ga0501080_0389924_525_1064 177
451 3300049744 Ga0501083_0066894 Ga0501083_0066894_435_992 177
452 3300049744 Ga0501083_0233612 Ga0501083_0233612_372_908 177
453 3300049823 Ga0501044_0425438 Ga0501044_0425438_48_593 177
454 3300050490 nmdc:mga03n38_72192_c1 nmdc:mga03n38_72192_c1_822_1355 177
455 3300050507 nmdc:mga05p37_2362_c1 nmdc:mga05p37_2362_c1_3781_4314 177
456 3300050508 nmdc:mga09592_110085_c1 nmdc:mga09592_110085_c1_588_1121 177
457 3300050509 nmdc:mga0qj67_82207_c1 nmdc:mga0qj67_82207_c1_1097_1630 177
458 3300050510 nmdc:mga06r32_1073_c1 nmdc:mga06r32_1073_c1_8246_8779 177
459 3300050511 nmdc:mga08y16_107_c1 nmdc:mga08y16_107_c1_5642_6175 177
460 3300050511 nmdc:mga08y16_370642_c1 nmdc:mga08y16_370642_c1_51_584 177
461 3300050512 nmdc:mga0n895_155591_c1 nmdc:mga0n895_155591_c1_891_1424 177
462 3300053087 Ga0500643_001329 Ga0500643_001329_9891_10457 177
463 3300053088 Ga0500644_0000378 Ga0500644_0000378_5032_5601 177
464 3300053093 Ga0500651_0027880 Ga0500651_0027880_1684_2253 177
465 3300053119 Ga0500595_000006 Ga0500595_000006_82142_82708 177
466 3300053131 Ga0500652_034902 Ga0500652_034902_852_1421 177
467 3300053133 Ga0500655_022442 Ga0500655_022442_456_1025 177
468 3300053153 Ga0500616_0000001 Ga0500616_0000001_424709_425278 177
469 3300053730 Ga0500645_000937 Ga0500645_000937_4002_4571 177
470 3300053730 Ga0500645_002789 Ga0500645_002789_2790_3323 177
471 3300054114 Ga0501084_0634074 Ga0501084_0634074_18_554 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

57

213

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fq3-assembly1.cif.gz_A crystal structure of inorganic phosphatase from brucella melitensis 0.9894 1 173
6k21-assembly1.cif.gz_A pyrophosphatase from acinetobacter baumannii 0.9788 3 173
3fq3-assembly1.cif.gz_A crystal structure of inorganic phosphatase from brucella melitensis 0.9782 1 173
4um4-assembly1.cif.gz_B structure of inorganic pyrophosphatase from escherichia coli in complex with sulfate 0.9751 3 173
1mjw-assembly1.cif.gz_A structure of inorganic pyrophosphatase mutant d42n 0.9734 3 175
ID Description Score Start End Superfamily
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9648 3 175 3.90.80.10
3emjE00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9541 17 171 3.90.80.10
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9488 3 175 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9467 14 176 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9455 1 176 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A2M8TYQ3-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9927 73 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3D5Q6T3-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.99 50 174 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3M6FPT4-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9899 73 174 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A512DWB7-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9898 1 176 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-W6K545-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9881 1 176 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Feature Viewer

pLDDT pTM Quality
93.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map