F450482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 470 | 291 | 427 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300046683|Ga0495658_0299781|Ga0495658_0299781_117_947 |
| Length | 276 |
| Sequence | MAPHRRADRRTPRPQLTVELAAGYDRVFLNSIRLSEKTMKLAPHLHRLGNDVVASYLVDTADGITLIDAGLPGHWRDLQRELGVLGKSVDDIRGVVLTHGDSDHIGFAERLRSEHGVPVFVHAADAVRTRTGEKPKVPFGPAKLGPTLGFFGYSLRKNGLRTRYVREVVEIGDGDVLDLPGKPVIVGMPGHSPGSVAVHVPLADAVFVGDALTTRHVLTGRTGPQAAPFTDDPAMALSSLDRIAGLFASWILPGHGAPWRVSPGDVETWVRSEAVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 2 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 3 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 4 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 5 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 6 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 7 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 8 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 9 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 10 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 11 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 12 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 13 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 14 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 15 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 16 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 17 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 18 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 19 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 20 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 21 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 22 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 23 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 24 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 25 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 26 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 27 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 28 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 29 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 30 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 31 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 32 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 33 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 34 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 35 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 36 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 37 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 38 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 39 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 40 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 41 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 178 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 179 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 180 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 188 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 235 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 236 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 237 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 238 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 239 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 240 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 241 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 242 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 279 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 280 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 281 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 282 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 283 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 284 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 288 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 289 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 290 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 291 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90 |
| Metatranscriptomes | 0.85 |
| Isolates | 9.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 4.68 |
| Nodule | 0 |
| Rhizoplane | 7.45 |
| Rhizosphere | 74.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1005749 | 3300002738 | Bacteria | 1924 |
| 2 | rootH2_10035408 | 3300003320 | Bacteria | 2088 |
| 3 | rootL2_10279124 | 3300003322 | Bacteria | 1573 |
| 4 | Ga0006562J51391_1026926 | 3300003578 | Bacteria | 7025 |
| 5 | Ga0006562J51391_1026931 | 3300003578 | Bacteria | 5380 |
| 6 | Ga0070658_10010239 | 3300005327 | Bacteria | 7519 |
| 7 | Ga0070658_10032539 | 3300005327 | Bacteria | 4192 |
| 8 | Ga0070658_10058294 | 3300005327 | Bacteria | 3142 |
| 9 | Ga0070683_100477724 | 3300005329 | Bacteria | 1190 |
| 10 | Ga0068868_100010682 | 3300005338 | Bacteria | 6653 |
| 11 | Ga0070660_100479915 | 3300005339 | Bacteria | 1033 |
| 12 | Ga0070689_100282369 | 3300005340 | Bacteria | 1378 |
| 13 | Ga0070661_100350234 | 3300005344 | Bacteria | 1158 |
| 14 | Ga0070692_10071287 | 3300005345 | Bacteria | 1852 |
| 15 | Ga0070675_100439656 | 3300005354 | Bacteria | 1168 |
| 16 | Ga0070671_100046268 | 3300005355 | Bacteria | 3618 |
| 17 | Ga0070674_100155622 | 3300005356 | Bacteria | 1729 |
| 18 | Ga0070674_100166059 | 3300005356 | Bacteria | 1679 |
| 19 | Ga0070688_100028574 | 3300005365 | Bacteria | 3331 |
| 20 | Ga0070659_100000468 | 3300005366 | Bacteria | 29797 |
| 21 | Ga0070667_100170491 | 3300005367 | Bacteria | 1921 |
| 22 | Ga0070709_10001367 | 3300005434 | Bacteria | 13322 |
| 23 | Ga0070714_100020381 | 3300005435 | Bacteria | 5414 |
| 24 | Ga0070710_10003338 | 3300005437 | Bacteria | 7612 |
| 25 | Ga0070711_100033408 | 3300005439 | Bacteria | 3426 |
| 26 | Ga0070700_100100555 | 3300005441 | Bacteria | 1904 |
| 27 | Ga0070694_100840600 | 3300005444 | Bacteria | 755 |
| 28 | Ga0070663_100789365 | 3300005455 | Bacteria | 814 |
| 29 | Ga0068867_100153703 | 3300005459 | Bacteria | 1809 |
| 30 | Ga0068867_100348933 | 3300005459 | Bacteria | 1234 |
| 31 | Ga0070685_10000654 | 3300005466 | Bacteria | 18932 |
| 32 | Ga0070679_100529705 | 3300005530 | Bacteria | 1122 |
| 33 | Ga0070684_100359226 | 3300005535 | Bacteria | 1340 |
| 34 | Ga0068853_100017331 | 3300005539 | Bacteria | 5946 |
| 35 | Ga0070672_100058814 | 3300005543 | Bacteria | 3022 |
| 36 | Ga0070686_100057302 | 3300005544 | Bacteria | 2502 |
| 37 | Ga0070665_100346632 | 3300005548 | Bacteria | 1490 |
| 38 | Ga0068855_100033650 | 3300005563 | Bacteria | 6115 |
| 39 | Ga0068855_100133317 | 3300005563 | Bacteria | 2835 |
| 40 | Ga0068855_100181869 | 3300005563 | Bacteria | 2376 |
| 41 | Ga0068855_100445115 | 3300005563 | Bacteria | 1414 |
| 42 | Ga0068855_100490305 | 3300005563 | Bacteria | 1336 |
| 43 | Ga0068855_100822610 | 3300005563 | Bacteria | 986 |
| 44 | Ga0070664_100041887 | 3300005564 | Bacteria | 3865 |
| 45 | Ga0068857_100006718 | 3300005577 | Bacteria | 9891 |
| 46 | Ga0068854_100451210 | 3300005578 | Bacteria | 1074 |
| 47 | Ga0068856_100052177 | 3300005614 | Bacteria | 4032 |
| 48 | Ga0068856_100550896 | 3300005614 | Bacteria | 1174 |
| 49 | Ga0070702_100166490 | 3300005615 | Bacteria | 1430 |
| 50 | Ga0068852_100008145 | 3300005616 | Bacteria | 7697 |
| 51 | Ga0068852_100018621 | 3300005616 | Bacteria | 5473 |
| 52 | Ga0068852_100063387 | 3300005616 | Bacteria | 3218 |
| 53 | Ga0068852_100195241 | 3300005616 | Bacteria | 1912 |
| 54 | Ga0068859_100644218 | 3300005617 | Bacteria | 1152 |
| 55 | Ga0068864_100025808 | 3300005618 | Bacteria | 4952 |
| 56 | Ga0068864_100104172 | 3300005618 | Bacteria | 2520 |
| 57 | Ga0068851_10000001 | 3300005834 | Bacteria | 495512 |
| 58 | Ga0068863_100213458 | 3300005841 | Bacteria | 1858 |
| 59 | Ga0068858_100000016 | 3300005842 | Bacteria | 193130 |
| 60 | Ga0068858_100188320 | 3300005842 | Bacteria | 1950 |
| 61 | Ga0081455_10001637 | 3300005937 | Bacteria | 27271 |
| 62 | Ga0081455_10012836 | 3300005937 | Bacteria | 8320 |
| 63 | Ga0075365_10016678 | 3300006038 | Bacteria | 4474 |
| 64 | Ga0075365_10329304 | 3300006038 | Bacteria | 1076 |
| 65 | Ga0075364_10008851 | 3300006051 | Bacteria | 6027 |
| 66 | Ga0075364_10093030 | 3300006051 | Bacteria | 2002 |
| 67 | Ga0075364_10195910 | 3300006051 | Bacteria | 1369 |
| 68 | Ga0075364_10374642 | 3300006051 | Bacteria | 971 |
| 69 | Ga0070715_10051517 | 3300006163 | Bacteria | 1772 |
| 70 | Ga0070716_100004107 | 3300006173 | Bacteria | 6906 |
| 71 | Ga0070712_100018022 | 3300006175 | Bacteria | 4580 |
| 72 | Ga0075369_10007022 | 3300006186 | Bacteria | 4278 |
| 73 | Ga0068865_100668275 | 3300006881 | Bacteria | 885 |
| 74 | Ga0097620_100644209 | 3300006931 | Bacteria | 1152 |
| 75 | Ga0075435_100434546 | 3300007076 | Bacteria | 1131 |
| 76 | Ga0105240_10021811 | 3300009093 | Bacteria | 8511 |
| 77 | Ga0111539_10023778 | 3300009094 | Bacteria | 7528 |
| 78 | Ga0105247_10012472 | 3300009101 | Bacteria | 5105 |
| 79 | Ga0105243_10097892 | 3300009148 | Bacteria | 2429 |
| 80 | Ga0105243_10108490 | 3300009148 | Bacteria | 2317 |
| 81 | Ga0105243_10160738 | 3300009148 | Bacteria | 1936 |
| 82 | Ga0105241_10132132 | 3300009174 | Bacteria | 2022 |
| 83 | Ga0105241_10482387 | 3300009174 | Bacteria | 1102 |
| 84 | Ga0105248_10000366 | 3300009177 | Bacteria | 52614 |
| 85 | Ga0105248_10042104 | 3300009177 | Bacteria | 5122 |
| 86 | Ga0105237_10006078 | 3300009545 | Bacteria | 13507 |
| 87 | Ga0105237_10207383 | 3300009545 | Bacteria | 1960 |
| 88 | Ga0105237_10435028 | 3300009545 | Bacteria | 1317 |
| 89 | Ga0105238_10002701 | 3300009551 | Bacteria | 17645 |
| 90 | Ga0105238_10270739 | 3300009551 | Bacteria | 1679 |
| 91 | Ga0105238_10373666 | 3300009551 | Bacteria | 1416 |
| 92 | Ga0105249_10478526 | 3300009553 | Bacteria | 1288 |
| 93 | Ga0105239_10129234 | 3300010375 | Bacteria | 2809 |
| 94 | Ga0105239_10174532 | 3300010375 | Bacteria | 2404 |
| 95 | Ga0105239_10231826 | 3300010375 | Bacteria | 2071 |
| 96 | Ga0105239_10408799 | 3300010375 | Bacteria | 1536 |
| 97 | Ga0105246_10078550 | 3300011119 | Bacteria | 2344 |
| 98 | Ga0105246_10776099 | 3300011119 | Bacteria | 848 |
| 99 | Ga0157369_10072382 | 3300013105 | Bacteria | 3699 |
| 100 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 101 | Ga0157374_10021634 | 3300013296 | Bacteria | 5727 |
| 102 | Ga0157374_10504184 | 3300013296 | Bacteria | 1215 |
| 103 | Ga0157378_10117333 | 3300013297 | Bacteria | 2448 |
| 104 | Ga0163162_10037398 | 3300013306 | Bacteria | 4844 |
| 105 | Ga0163162_10444438 | 3300013306 | Bacteria | 1429 |
| 106 | Ga0157375_10276059 | 3300013308 | Bacteria | 1843 |
| 107 | Ga0157375_10573957 | 3300013308 | Bacteria | 1288 |
| 108 | Ga0163163_10023270 | 3300014325 | Bacteria | 5878 |
| 109 | Ga0163163_10023605 | 3300014325 | Bacteria | 5838 |
| 110 | Ga0163163_10250958 | 3300014325 | Bacteria | 1820 |
| 111 | Ga0157380_10041942 | 3300014326 | Bacteria | 3574 |
| 112 | Ga0157380_10182890 | 3300014326 | Bacteria | 1843 |
| 113 | Ga0157377_10057778 | 3300014745 | Bacteria | 2207 |
| 114 | Ga0157379_10015256 | 3300014968 | Bacteria | 6739 |
| 115 | Ga0157379_10027288 | 3300014968 | Bacteria | 5084 |
| 116 | Ga0157379_10880716 | 3300014968 | Bacteria | 848 |
| 117 | Ga0157376_10628913 | 3300014969 | Bacteria | 1071 |
| 118 | Ga0206351_11016496 | 3300020077 | Bacteria | 1705 |
| 119 | Ga0206353_10652235 | 3300020082 | Bacteria | 1139 |
| 120 | Ga0209646_1000013 | 3300025246 | Bacteria | 565830 |
| 121 | Ga0209646_1000014 | 3300025246 | Bacteria | 550484 |
| 122 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 123 | Ga0207692_10014149 | 3300025898 | Bacteria | 3480 |
| 124 | Ga0207710_10012760 | 3300025900 | Bacteria | 3538 |
| 125 | Ga0207688_10324349 | 3300025901 | Bacteria | 945 |
| 126 | Ga0207643_10187581 | 3300025908 | Bacteria | 1254 |
| 127 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 128 | Ga0207705_10021833 | 3300025909 | Bacteria | 4567 |
| 129 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 130 | Ga0207695_10003316 | 3300025913 | Bacteria | 22816 |
| 131 | Ga0207695_10023069 | 3300025913 | Bacteria | 7044 |
| 132 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 133 | Ga0207662_10121337 | 3300025918 | Bacteria | 1640 |
| 134 | Ga0207657_10064263 | 3300025919 | Bacteria | 3133 |
| 135 | Ga0207649_10121904 | 3300025920 | Bacteria | 1759 |
| 136 | Ga0207694_10000022 | 3300025924 | Bacteria | 288900 |
| 137 | Ga0207694_10241389 | 3300025924 | Bacteria | 1477 |
| 138 | Ga0207694_10260068 | 3300025924 | Bacteria | 1422 |
| 139 | Ga0207659_10215771 | 3300025926 | Bacteria | 1540 |
| 140 | Ga0207700_10006078 | 3300025928 | Bacteria | 7272 |
| 141 | Ga0207664_10002462 | 3300025929 | Bacteria | 12261 |
| 142 | Ga0207690_10007391 | 3300025932 | Bacteria | 6522 |
| 143 | Ga0207690_10325392 | 3300025932 | Bacteria | 1209 |
| 144 | Ga0207709_10054722 | 3300025935 | Bacteria | 2461 |
| 145 | Ga0207709_10306009 | 3300025935 | Bacteria | 1184 |
| 146 | Ga0207669_10069499 | 3300025937 | Bacteria | 2204 |
| 147 | Ga0207704_10601256 | 3300025938 | Bacteria | 900 |
| 148 | Ga0207665_10006662 | 3300025939 | Bacteria | 7663 |
| 149 | Ga0207665_10040177 | 3300025939 | Bacteria | 3120 |
| 150 | Ga0207691_10254213 | 3300025940 | Bacteria | 1516 |
| 151 | Ga0207691_10696537 | 3300025940 | Bacteria | 857 |
| 152 | Ga0207711_10002007 | 3300025941 | Bacteria | 18405 |
| 153 | Ga0207711_10024716 | 3300025941 | Bacteria | 5037 |
| 154 | Ga0207711_10053568 | 3300025941 | Bacteria | 3460 |
| 155 | Ga0207661_10344203 | 3300025944 | Bacteria | 1344 |
| 156 | Ga0207667_10009682 | 3300025949 | Bacteria | 11336 |
| 157 | Ga0207667_10032898 | 3300025949 | Bacteria | 5581 |
| 158 | Ga0207667_10152150 | 3300025949 | Bacteria | 2381 |
| 159 | Ga0207667_10186489 | 3300025949 | Bacteria | 2129 |
| 160 | Ga0207667_11002724 | 3300025949 | Bacteria | 822 |
| 161 | Ga0207640_10252296 | 3300025981 | Bacteria | 1370 |
| 162 | Ga0207658_10146872 | 3300025986 | Bacteria | 1916 |
| 163 | Ga0207658_10631032 | 3300025986 | Bacteria | 965 |
| 164 | Ga0207677_10042805 | 3300026023 | Bacteria | 3006 |
| 165 | Ga0207703_10000075 | 3300026035 | Bacteria | 118422 |
| 166 | Ga0207639_10011644 | 3300026041 | Bacteria | 6112 |
| 167 | Ga0207678_10234599 | 3300026067 | Bacteria | 1571 |
| 168 | Ga0207678_10237972 | 3300026067 | Bacteria | 1559 |
| 169 | Ga0207708_10091905 | 3300026075 | Bacteria | 2341 |
| 170 | Ga0207702_10047043 | 3300026078 | Bacteria | 3634 |
| 171 | Ga0207641_10192067 | 3300026088 | Bacteria | 1877 |
| 172 | Ga0207648_10104417 | 3300026089 | Bacteria | 2485 |
| 173 | Ga0207676_10034966 | 3300026095 | Bacteria | 3808 |
| 174 | Ga0207676_10057373 | 3300026095 | Bacteria | 3066 |
| 175 | Ga0207674_10017568 | 3300026116 | Bacteria | 7803 |
| 176 | Ga0207674_10023075 | 3300026116 | Bacteria | 6673 |
| 177 | Ga0207674_10218618 | 3300026116 | Bacteria | 1854 |
| 178 | Ga0207674_10606866 | 3300026116 | Bacteria | 1057 |
| 179 | Ga0207675_100129741 | 3300026118 | Bacteria | 2390 |
| 180 | Ga0207675_100318926 | 3300026118 | Bacteria | 1517 |
| 181 | Ga0207698_10001420 | 3300026142 | Bacteria | 13905 |
| 182 | Ga0207698_10001474 | 3300026142 | Bacteria | 13682 |
| 183 | Ga0207698_10064674 | 3300026142 | Bacteria | 2868 |
| 184 | Ga0207428_10260880 | 3300027907 | Bacteria | 1291 |
| 185 | Ga0268266_10291866 | 3300028379 | Bacteria | 1519 |
| 186 | Ga0268266_10297371 | 3300028379 | Bacteria | 1505 |
| 187 | Ga0268266_10540317 | 3300028379 | Bacteria | 1116 |
| 188 | Ga0265340_10006120 | 3300031247 | Bacteria | 6635 |
| 189 | Ga0307513_10116836 | 3300031456 | Bacteria | 2645 |
| 190 | Ga0307509_10122663 | 3300031507 | Bacteria | 2573 |
| 191 | Ga0307408_100050562 | 3300031548 | Unclassified | 2990 |
| 192 | Ga0307413_10479384 | 3300031824 | Bacteria | 994 |
| 193 | Ga0307406_10000031 | 3300031901 | Bacteria | 87391 |
| 194 | Ga0307406_10012526 | 3300031901 | Bacteria | 4834 |
| 195 | Ga0307406_10025710 | 3300031901 | Bacteria | 3526 |
| 196 | Ga0307406_10095157 | 3300031901 | Bacteria | 2015 |
| 197 | Ga0307406_10171807 | 3300031901 | Bacteria | 1569 |
| 198 | Ga0307406_10379541 | 3300031901 | Bacteria | 1114 |
| 199 | Ga0307406_10558964 | 3300031901 | Bacteria | 937 |
| 200 | Ga0307406_10736705 | 3300031901 | Bacteria | 826 |
| 201 | Ga0307412_10067849 | 3300031911 | Bacteria | 2423 |
| 202 | Ga0307409_100458519 | 3300031995 | Bacteria | 1232 |
| 203 | Ga0307416_100108211 | 3300032002 | Bacteria | 2442 |
| 204 | Ga0307416_100595526 | 3300032002 | Bacteria | 1185 |
| 205 | Ga0307416_100729854 | 3300032002 | Bacteria | 1082 |
| 206 | Ga0307414_10007544 | 3300032004 | Bacteria | 6115 |
| 207 | Ga0307414_10467091 | 3300032004 | Bacteria | 1110 |
| 208 | Ga0307415_100291146 | 3300032126 | Bacteria | 1348 |
| 209 | Ga0373947_0230350 | 3300035725 | Bacteria | 1220 |
| 210 | Ga0395900_0039612 | 3300037418 | Bacteria | 4855 |
| 211 | Ga0395900_0635351 | 3300037418 | Bacteria | 1005 |
| 212 | Ga0395898_0133714 | 3300037466 | Bacteria | 2375 |
| 213 | Ga0395905_0178811 | 3300037471 | Bacteria | 1992 |
| 214 | Ga0451791_0451102 | 3300041451 | Bacteria | 3944 |
| 215 | Ga0451853_1463364 | 3300041512 | Bacteria | 1562 |
| 216 | Ga0439449_0112764 | 3300042007 | Bacteria | 1008 |
| 217 | Ga0439450_014019 | 3300042008 | Bacteria | 1620 |
| 218 | Ga0439463_001677 | 3300042016 | Bacteria | 5803 |
| 219 | Ga0450905_017826 | 3300042142 | Bacteria | 1032 |
| 220 | Ga0466965_0167350 | 3300044683 | Bacteria | 1155 |
| 221 | Ga0466963_0342207 | 3300044694 | Bacteria | 1053 |
| 222 | Ga0466964_0311265 | 3300044706 | Bacteria | 797 |
| 223 | Ga0466970_0005495 | 3300044765 | Bacteria | 6290 |
| 224 | Ga0466957_0051899 | 3300044842 | Bacteria | 2496 |
| 225 | Ga0466960_0077498 | 3300044901 | Bacteria | 1667 |
| 226 | Ga0466960_0103863 | 3300044901 | Bacteria | 1467 |
| 227 | Ga0466960_0235615 | 3300044901 | Bacteria | 1012 |
| 228 | Ga0466960_0290263 | 3300044901 | Bacteria | 919 |
| 229 | Ga0466967_0175139 | 3300045976 | Bacteria | 2021 |
| 230 | Ga0466967_0190544 | 3300045976 | Bacteria | 1938 |
| 231 | Ga0466967_0739432 | 3300045976 | Bacteria | 975 |
| 232 | Ga0495627_000261 | 3300046453 | Bacteria | 54087 |
| 233 | Ga0495592_0124568 | 3300046454 | Bacteria | 1809 |
| 234 | Ga0495629_0157939 | 3300046459 | Bacteria | 1575 |
| 235 | Ga0495638_0200690 | 3300046460 | Bacteria | 1126 |
| 236 | Ga0495651_0008171 | 3300046462 | Bacteria | 8025 |
| 237 | Ga0495653_0073472 | 3300046463 | Bacteria | 2551 |
| 238 | Ga0495580_0201312 | 3300046472 | Bacteria | 1372 |
| 239 | Ga0495662_0000835 | 3300046476 | Bacteria | 14966 |
| 240 | Ga0495664_0069796 | 3300046477 | Bacteria | 2097 |
| 241 | Ga0495608_0023207 | 3300046511 | Bacteria | 4253 |
| 242 | Ga0495610_0089488 | 3300046512 | Bacteria | 1398 |
| 243 | Ga0495618_0197244 | 3300046514 | Bacteria | 1275 |
| 244 | Ga0495630_0016342 | 3300046517 | Bacteria | 5421 |
| 245 | Ga0495666_0001138 | 3300046526 | Bacteria | 12749 |
| 246 | Ga0495652_0069465 | 3300046529 | Bacteria | 2948 |
| 247 | Ga0495665_0006538 | 3300046531 | Bacteria | 6295 |
| 248 | Ga0495640_0021254 | 3300046533 | Bacteria | 4765 |
| 249 | Ga0495640_0028693 | 3300046533 | Bacteria | 4004 |
| 250 | Ga0495586_0005335 | 3300046535 | Bacteria | 6876 |
| 251 | Ga0495645_0027019 | 3300046543 | Bacteria | 4168 |
| 252 | Ga0495634_0038965 | 3300046642 | Bacteria | 3238 |
| 253 | Ga0495657_0017803 | 3300046675 | Bacteria | 5152 |
| 254 | Ga0495623_0244261 | 3300046679 | Bacteria | 1012 |
| 255 | Ga0495658_0299781 | 3300046683 | Bacteria | 1016 |
| 256 | Ga0495671_0210313 | 3300046692 | Bacteria | 943 |
| 257 | Ga0495600_0143967 | 3300046809 | Bacteria | 1545 |
| 258 | Ga0495581_0038477 | 3300047315 | Bacteria | 2768 |
| 259 | Ga0495604_0002933 | 3300047317 | Bacteria | 13666 |
| 260 | Ga0495604_0093861 | 3300047317 | Bacteria | 2219 |
| 261 | Ga0495674_0013078 | 3300047319 | Bacteria | 7808 |
| 262 | Ga0495675_0018606 | 3300047444 | Bacteria | 4409 |
| 263 | Ga0495684_0077748 | 3300047471 | Bacteria | 2518 |
| 264 | Ga0495593_0031468 | 3300047673 | Bacteria | 2898 |
| 265 | Ga0495602_0055930 | 3300048088 | Bacteria | 3472 |
| 266 | Ga0496101_0035358 | 3300048904 | Bacteria | 3533 |
| 267 | Ga0496101_0112961 | 3300048904 | Bacteria | 2046 |
| 268 | Ga0496102_0025335 | 3300048905 | Bacteria | 5280 |
| 269 | Ga0496102_0503616 | 3300048905 | Bacteria | 1133 |
| 270 | Ga0496103_0020149 | 3300048906 | Bacteria | 4004 |
| 271 | Ga0496103_0321033 | 3300048906 | Bacteria | 996 |
| 272 | Ga0496104_0005368 | 3300048907 | Bacteria | 11219 |
| 273 | Ga0496104_0174567 | 3300048907 | Bacteria | 2059 |
| 274 | Ga0496105_0289150 | 3300048908 | Bacteria | 1320 |
| 275 | Ga0496106_0154777 | 3300048909 | Bacteria | 1810 |
| 276 | Ga0496106_0196899 | 3300048909 | Bacteria | 1603 |
| 277 | Ga0496107_0121585 | 3300048910 | Bacteria | 1924 |
| 278 | Ga0496108_0013624 | 3300048911 | Bacteria | 6638 |
| 279 | Ga0496108_0031926 | 3300048911 | Bacteria | 4371 |
| 280 | Ga0496108_0086867 | 3300048911 | Bacteria | 2656 |
| 281 | Ga0496108_0161759 | 3300048911 | Bacteria | 1935 |
| 282 | Ga0496108_0212349 | 3300048911 | Bacteria | 1680 |
| 283 | Ga0496109_0009855 | 3300048912 | Bacteria | 8155 |
| 284 | Ga0496109_0026768 | 3300048912 | Bacteria | 5143 |
| 285 | Ga0496109_0370793 | 3300048912 | Bacteria | 1352 |
| 286 | Ga0496109_0763553 | 3300048912 | Bacteria | 905 |
| 287 | Ga0496110_0001722 | 3300048913 | Bacteria | 16109 |
| 288 | Ga0496110_0003665 | 3300048913 | Bacteria | 11818 |
| 289 | Ga0496111_0003973 | 3300048914 | Bacteria | 9283 |
| 290 | Ga0496111_0030068 | 3300048914 | Bacteria | 3861 |
| 291 | Ga0496111_0046827 | 3300048914 | Bacteria | 3114 |
| 292 | Ga0496111_0308735 | 3300048914 | Bacteria | 1172 |
| 293 | Ga0496112_0023186 | 3300048915 | Bacteria | 5924 |
| 294 | Ga0496112_0090699 | 3300048915 | Bacteria | 3025 |
| 295 | Ga0496113_0011584 | 3300048916 | Bacteria | 5892 |
| 296 | Ga0496113_0607895 | 3300048916 | Bacteria | 875 |
| 297 | Ga0496114_0001454 | 3300048917 | Bacteria | 17979 |
| 298 | Ga0496114_0111033 | 3300048917 | Bacteria | 2349 |
| 299 | Ga0496114_0151910 | 3300048917 | Bacteria | 2009 |
| 300 | Ga0496117_0000466 | 3300048920 | Bacteria | 67525 |
| 301 | Ga0496117_0047699 | 3300048920 | Bacteria | 3068 |
| 302 | Ga0496117_0094734 | 3300048920 | Bacteria | 1910 |
| 303 | Ga0496118_0012162 | 3300048921 | Bacteria | 8301 |
| 304 | Ga0496118_0037745 | 3300048921 | Bacteria | 3883 |
| 305 | Ga0496118_0054555 | 3300048921 | Bacteria | 3026 |
| 306 | Ga0496119_0002891 | 3300048922 | Bacteria | 18335 |
| 307 | Ga0496119_0002893 | 3300048922 | Bacteria | 18324 |
| 308 | Ga0496119_0009534 | 3300048922 | Bacteria | 8314 |
| 309 | Ga0496119_0040161 | 3300048922 | Bacteria | 2997 |
| 310 | Ga0496119_0117176 | 3300048922 | Bacteria | 1469 |
| 311 | Ga0496120_0000257 | 3300048923 | Bacteria | 88760 |
| 312 | Ga0496120_0067147 | 3300048923 | Bacteria | 1982 |
| 313 | Ga0496122_0090309 | 3300048925 | Bacteria | 2091 |
| 314 | Ga0496122_0145953 | 3300048925 | Bacteria | 1470 |
| 315 | Ga0496124_0436737 | 3300048927 | Bacteria | 897 |
| 316 | Ga0496125_0011379 | 3300048928 | Bacteria | 8906 |
| 317 | Ga0496125_0016046 | 3300048928 | Bacteria | 7211 |
| 318 | Ga0496125_0021871 | 3300048928 | Bacteria | 5952 |
| 319 | Ga0496125_0232904 | 3300048928 | Bacteria | 1176 |
| 320 | Ga0496126_0001669 | 3300048929 | Bacteria | 33303 |
| 321 | Ga0496126_0001734 | 3300048929 | Bacteria | 32346 |
| 322 | Ga0496126_0158651 | 3300048929 | Bacteria | 1934 |
| 323 | Ga0496126_0377401 | 3300048929 | Bacteria | 1155 |
| 324 | Ga0501031_0016322 | 3300049568 | Bacteria | 4821 |
| 325 | Ga0501031_0108469 | 3300049568 | Bacteria | 1813 |
| 326 | Ga0501032_0049337 | 3300049569 | Bacteria | 2839 |
| 327 | Ga0501032_0147707 | 3300049569 | Bacteria | 1547 |
| 328 | Ga0501032_0233252 | 3300049569 | Bacteria | 1196 |
| 329 | Ga0501033_0009770 | 3300049570 | Bacteria | 7369 |
| 330 | Ga0501033_0026929 | 3300049570 | Bacteria | 4325 |
| 331 | Ga0501033_0127299 | 3300049570 | Bacteria | 1846 |
| 332 | Ga0501033_0249776 | 3300049570 | Bacteria | 1257 |
| 333 | Ga0501034_0008188 | 3300049571 | Bacteria | 11085 |
| 334 | Ga0501034_0161596 | 3300049571 | Bacteria | 2210 |
| 335 | Ga0501034_0197438 | 3300049571 | Bacteria | 1971 |
| 336 | Ga0501036_0115830 | 3300049572 | Bacteria | 2263 |
| 337 | Ga0501036_0170899 | 3300049572 | Bacteria | 1831 |
| 338 | Ga0501036_0218188 | 3300049572 | Bacteria | 1602 |
| 339 | Ga0501037_0009202 | 3300049573 | Bacteria | 7239 |
| 340 | Ga0501037_0105652 | 3300049573 | Bacteria | 2029 |
| 341 | Ga0501037_0236669 | 3300049573 | Bacteria | 1281 |
| 342 | Ga0501037_0280449 | 3300049573 | Bacteria | 1161 |
| 343 | Ga0501038_0066240 | 3300049574 | Bacteria | 3076 |
| 344 | Ga0501038_0143376 | 3300049574 | Bacteria | 1952 |
| 345 | Ga0501038_0146406 | 3300049574 | Bacteria | 1928 |
| 346 | Ga0501038_0166765 | 3300049574 | Bacteria | 1786 |
| 347 | Ga0501039_0493678 | 3300049575 | Unclassified | 961 |
| 348 | Ga0501039_0533491 | 3300049575 | Bacteria | 921 |
| 349 | Ga0501040_0417833 | 3300049576 | Bacteria | 964 |
| 350 | Ga0501041_0321087 | 3300049577 | Bacteria | 977 |
| 351 | Ga0501042_0407694 | 3300049578 | Bacteria | 985 |
| 352 | Ga0501043_0070893 | 3300049579 | Bacteria | 2737 |
| 353 | Ga0501043_0120617 | 3300049579 | Bacteria | 2056 |
| 354 | Ga0501046_0011498 | 3300049580 | Bacteria | 7568 |
| 355 | Ga0501046_0105154 | 3300049580 | Bacteria | 2162 |
| 356 | Ga0501046_0118813 | 3300049580 | Bacteria | 2013 |
| 357 | Ga0501046_0229223 | 3300049580 | Bacteria | 1373 |
| 358 | Ga0501047_0001859 | 3300049581 | Bacteria | 20320 |
| 359 | Ga0501047_0006372 | 3300049581 | Bacteria | 11098 |
| 360 | Ga0501047_0079831 | 3300049581 | Bacteria | 3145 |
| 361 | Ga0501047_0135623 | 3300049581 | Bacteria | 2341 |
| 362 | Ga0501048_0005523 | 3300049582 | Bacteria | 9620 |
| 363 | Ga0501048_0208004 | 3300049582 | Bacteria | 1388 |
| 364 | Ga0501069_0106228 | 3300049585 | Bacteria | 1596 |
| 365 | Ga0501070_0077037 | 3300049586 | Bacteria | 2760 |
| 366 | Ga0501070_0228625 | 3300049586 | Bacteria | 1524 |
| 367 | Ga0501070_0354245 | 3300049586 | Bacteria | 1191 |
| 368 | Ga0501071_0041248 | 3300049587 | Bacteria | 3305 |
| 369 | Ga0501072_0008500 | 3300049588 | Bacteria | 7791 |
| 370 | Ga0501072_0600126 | 3300049588 | Bacteria | 868 |
| 371 | Ga0501073_0000030 | 3300049589 | Bacteria | 115949 |
| 372 | Ga0501073_0131270 | 3300049589 | Bacteria | 1736 |
| 373 | Ga0501073_0198510 | 3300049589 | Bacteria | 1387 |
| 374 | Ga0501074_0017719 | 3300049590 | Bacteria | 5173 |
| 375 | Ga0501074_0121422 | 3300049590 | Bacteria | 1869 |
| 376 | Ga0501074_0142935 | 3300049590 | Bacteria | 1711 |
| 377 | Ga0501075_0088543 | 3300049591 | Bacteria | 2347 |
| 378 | Ga0501075_0096317 | 3300049591 | Bacteria | 2246 |
| 379 | Ga0501076_0145792 | 3300049592 | Bacteria | 1925 |
| 380 | Ga0501076_0357917 | 3300049592 | Bacteria | 1199 |
| 381 | Ga0501076_0480384 | 3300049592 | Bacteria | 1024 |
| 382 | Ga0501077_0082382 | 3300049593 | Bacteria | 2039 |
| 383 | Ga0501079_0265129 | 3300049741 | Bacteria | 1343 |
| 384 | Ga0501080_0086845 | 3300049742 | Bacteria | 2907 |
| 385 | Ga0501083_0038608 | 3300049744 | Bacteria | 3245 |
| 386 | Ga0501035_0020822 | 3300049822 | Bacteria | 6026 |
| 387 | Ga0501035_0025378 | 3300049822 | Bacteria | 5434 |
| 388 | Ga0501035_0118938 | 3300049822 | Bacteria | 2311 |
| 389 | Ga0501035_0130254 | 3300049822 | Bacteria | 2193 |
| 390 | Ga0501035_0152121 | 3300049822 | Bacteria | 2007 |
| 391 | Ga0501035_0168090 | 3300049822 | Bacteria | 1895 |
| 392 | Ga0501044_0014885 | 3300049823 | Bacteria | 8386 |
| 393 | Ga0501044_0023642 | 3300049823 | Bacteria | 6534 |
| 394 | Ga0501044_0059103 | 3300049823 | Bacteria | 3929 |
| 395 | Ga0501044_0180869 | 3300049823 | Bacteria | 2075 |
| 396 | Ga0501044_0182997 | 3300049823 | Bacteria | 2061 |
| 397 | Ga0501044_0189754 | 3300049823 | Bacteria | 2018 |
| 398 | Ga0501044_0283285 | 3300049823 | Bacteria | 1590 |
| 399 | Ga0501044_0892045 | 3300049823 | Bacteria | 764 |
| 400 | Ga0501045_0049970 | 3300049824 | Bacteria | 3050 |
| 401 | Ga0501045_0295295 | 3300049824 | Bacteria | 1206 |
| 402 | Ga0501045_0373786 | 3300049824 | Bacteria | 1061 |
| 403 | Ga0501045_0428054 | 3300049824 | Bacteria | 984 |
| 404 | nmdc:mga00v17_16050_c1 | 3300050491 | Bacteria | 4216 |
| 405 | nmdc:mga00v17_28713_c1 | 3300050491 | Bacteria | 3260 |
| 406 | nmdc:mga00v17_375834_c1 | 3300050491 | Bacteria | 924 |
| 407 | nmdc:mga0yw44_26725_c1 | 3300050492 | Bacteria | 3300 |
| 408 | nmdc:mga08y16_608601_c1 | 3300050511 | Bacteria | 1101 |
| 409 | nmdc:mga0sz30_18584_c1 | 3300050516 | Bacteria | 2783 |
| 410 | Ga0495601_0051946 | 3300053077 | Bacteria | 2587 |
| 411 | Ga0495619_0143132 | 3300053085 | Bacteria | 1647 |
| 412 | Ga0500643_000325 | 3300053087 | Bacteria | 38363 |
| 413 | Ga0500651_0000383 | 3300053093 | Bacteria | 24162 |
| 414 | Ga0500559_0000736 | 3300053136 | Bacteria | 21465 |
| 415 | Ga0500559_0001408 | 3300053136 | Bacteria | 13667 |
| 416 | Ga0500573_0000031 | 3300053140 | Bacteria | 134098 |
| 417 | Ga0500573_0036783 | 3300053140 | Bacteria | 2827 |
| 418 | Ga0500573_0053588 | 3300053140 | Bacteria | 2318 |
| 419 | Ga0500577_0001521 | 3300053142 | Bacteria | 5905 |
| 420 | Ga0500590_040928 | 3300053148 | Bacteria | 2385 |
| 421 | Ga0500620_001788 | 3300053155 | Bacteria | 4102 |
| 422 | Ga0501084_0242360 | 3300054114 | Bacteria | 1522 |
| 423 | Ga0501084_0277307 | 3300054114 | Bacteria | 1416 |
| 424 | Ga0501082_0135219 | 3300060353 | Bacteria | 2139 |
| 425 | Ga0501082_0158948 | 3300060353 | Bacteria | 1964 |
| 426 | Ga0501082_0495924 | 3300060353 | Bacteria | 1067 |
| 427 | Ga0530510_0281136 | 3300061734 | Bacteria | 1243 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0600126 | Ga0501072_0600126_283_858 | 190 |
| 2 | 3300049577 | Ga0501041_0321087 | Ga0501041_0321087_329_964 | 210 |
| 3 | 3300049593 | Ga0501077_0082382 | Ga0501077_0082382_20_655 | 210 |
| 4 | 3300025924 | Ga0207694_10241389 | Ga0207694_102413893 | 212 |
| 5 | 3300049580 | Ga0501046_0118813 | Ga0501046_0118813_842_1510 | 221 |
| 6 | 3300049590 | Ga0501074_0121422 | Ga0501074_0121422_164_832 | 221 |
| 7 | 3300049591 | Ga0501075_0096317 | Ga0501075_0096317_710_1378 | 221 |
| 8 | 3300054114 | Ga0501084_0242360 | Ga0501084_0242360_382_1050 | 221 |
| 9 | 3300060353 | Ga0501082_0135219 | Ga0501082_0135219_1373_2041 | 221 |
| 10 | 3300053136 | Ga0500559_0000736 | Ga0500559_0000736_7810_8526 | 223 |
| 11 | 3300048929 | Ga0496126_0158651 | Ga0496126_0158651_62_790 | 224 |
| 12 | 3300044765 | Ga0466970_0005495 | Ga0466970_0005495_4498_5220 | 226 |
| 13 | 3300044842 | Ga0466957_0051899 | Ga0466957_0051899_72_791 | 227 |
| 14 | 3300049741 | Ga0501079_0265129 | Ga0501079_0265129_624_1316 | 227 |
| 15 | 3300049588 | Ga0501072_0008500 | Ga0501072_0008500_6953_7663 | 228 |
| 16 | 3300005563 | Ga0068855_100181869 | Ga0068855_1001818693 | 231 |
| 17 | 3300025949 | Ga0207667_10152150 | Ga0207667_101521503 | 231 |
| 18 | 3300031901 | Ga0307406_10558964 | Ga0307406_105589642 | 231 |
| 19 | 3300044901 | Ga0466960_0290263 | Ga0466960_0290263_131_841 | 231 |
| 20 | iso_pu_bacteria | 2767802112 | 2768645565 | 231 |
| 21 | iso_pu_bacteria | 2773857758 | 2774378821 | 231 |
| 22 | iso_pu_bacteria | 2808606306 | 2808629491 | 231 |
| 23 | iso_pu_bacteria | 2852646457 | 2852647706 | 231 |
| 24 | iso_pu_bacteria | 2884693830 | 2884702131 | 231 |
| 25 | iso_pu_bacteria | 2895442618 | 2895445327 | 231 |
| 26 | iso_pu_bacteria | 2908678064 | 2908678504 | 231 |
| 27 | iso_pu_bacteria | 2919069694 | 2919070825 | 231 |
| 28 | iso_pu_bacteria | 2977264416 | 2977265628 | 231 |
| 29 | iso_pu_bacteria | 2984580707 | 2984581648 | 231 |
| 30 | iso_pu_bacteria | 2995463766 | 2995464371 | 231 |
| 31 | iso_pu_bacteria | 3002998708 | 3003005711 | 231 |
| 32 | iso_pu_bacteria | 2643221542 | 2643732693 | 232 |
| 33 | iso_pu_bacteria | 2643221549 | 2643769359 | 232 |
| 34 | iso_pu_bacteria | 2643221553 | 2643785025 | 232 |
| 35 | iso_pu_bacteria | 2643221572 | 2643874861 | 232 |
| 36 | iso_pu_bacteria | 2643221619 | 2644113977 | 232 |
| 37 | iso_pu_bacteria | 2643221630 | 2644171496 | 232 |
| 38 | iso_pu_bacteria | 2643221649 | 2644277079 | 232 |
| 39 | iso_pu_bacteria | 2643221669 | 2644381917 | 232 |
| 40 | iso_pu_bacteria | 2643221724 | 2644680931 | 232 |
| 41 | iso_pu_bacteria | 2643221961 | 2645722503 | 232 |
| 42 | iso_pu_bacteria | 2675903059 | 2676483649 | 232 |
| 43 | iso_pu_bacteria | 2721755702 | 2723642656 | 232 |
| 44 | iso_pu_bacteria | 2728369380 | 2730230636 | 232 |
| 45 | iso_pu_bacteria | 2773857763 | 2774398543 | 232 |
| 46 | iso_pu_bacteria | 2808606368 | 2808886235 | 232 |
| 47 | iso_pu_bacteria | 2811994872 | 2812322868 | 232 |
| 48 | iso_pu_bacteria | 2821268502 | 2821269773 | 232 |
| 49 | iso_pu_bacteria | 2833709550 | 2833710694 | 232 |
| 50 | iso_pu_bacteria | 2852663356 | 2852663954 | 232 |
| 51 | iso_pu_bacteria | 2857723135 | 2857726199 | 232 |
| 52 | iso_pu_bacteria | 2895660088 | 2895660956 | 232 |
| 53 | iso_pu_bacteria | 2919051321 | 2919054576 | 232 |
| 54 | iso_pu_bacteria | 2919443155 | 2919443229 | 232 |
| 55 | iso_pu_bacteria | 2929219909 | 2929221902 | 232 |
| 56 | iso_pu_bacteria | 2935409751 | 2935413190 | 232 |
| 57 | iso_pu_bacteria | 2946080515 | 2946083920 | 232 |
| 58 | iso_pu_bacteria | 2966924647 | 2966925713 | 232 |
| 59 | iso_pu_bacteria | 8003870546 | 8003874046 | 232 |
| 60 | iso_pu_bacteria | 8004182704 | 8004184418 | 232 |
| 61 | iso_pu_bacteria | 8045830549 | 8045834284 | 232 |
| 62 | iso_pu_bacteria | 8057345674 | 8057346901 | 232 |
| 63 | 3300005548 | Ga0070665_100346632 | Ga0070665_1003466322 | 233 |
| 64 | 3300025932 | Ga0207690_10325392 | Ga0207690_103253921 | 233 |
| 65 | 3300028379 | Ga0268266_10297371 | Ga0268266_102973712 | 233 |
| 66 | 3300005340 | Ga0070689_100282369 | Ga0070689_1002823692 | 235 |
| 67 | 3300005345 | Ga0070692_10071287 | Ga0070692_100712873 | 235 |
| 68 | 3300005354 | Ga0070675_100439656 | Ga0070675_1004396561 | 235 |
| 69 | 3300005356 | Ga0070674_100155622 | Ga0070674_1001556222 | 235 |
| 70 | 3300005356 | Ga0070674_100166059 | Ga0070674_1001660592 | 235 |
| 71 | 3300005365 | Ga0070688_100028574 | Ga0070688_1000285745 | 235 |
| 72 | 3300005441 | Ga0070700_100100555 | Ga0070700_1001005552 | 235 |
| 73 | 3300005444 | Ga0070694_100840600 | Ga0070694_1008406001 | 235 |
| 74 | 3300005455 | Ga0070663_100789365 | Ga0070663_1007893651 | 235 |
| 75 | 3300005459 | Ga0068867_100153703 | Ga0068867_1001537033 | 235 |
| 76 | 3300005530 | Ga0070679_100529705 | Ga0070679_1005297052 | 235 |
| 77 | 3300005535 | Ga0070684_100359226 | Ga0070684_1003592262 | 235 |
| 78 | 3300005543 | Ga0070672_100058814 | Ga0070672_1000588142 | 235 |
| 79 | 3300005544 | Ga0070686_100057302 | Ga0070686_1000573022 | 235 |
| 80 | 3300005564 | Ga0070664_100041887 | Ga0070664_1000418873 | 235 |
| 81 | 3300005616 | Ga0068852_100195241 | Ga0068852_1001952412 | 235 |
| 82 | 3300005617 | Ga0068859_100644218 | Ga0068859_1006442182 | 235 |
| 83 | 3300005842 | Ga0068858_100188320 | Ga0068858_1001883202 | 235 |
| 84 | 3300006051 | Ga0075364_10195910 | Ga0075364_101959102 | 235 |
| 85 | 3300006881 | Ga0068865_100668275 | Ga0068865_1006682751 | 235 |
| 86 | 3300006931 | Ga0097620_100644209 | Ga0097620_1006442092 | 235 |
| 87 | 3300009094 | Ga0111539_10023778 | Ga0111539_100237786 | 235 |
| 88 | 3300009148 | Ga0105243_10108490 | Ga0105243_101084902 | 235 |
| 89 | 3300009148 | Ga0105243_10160738 | Ga0105243_101607381 | 235 |
| 90 | 3300009551 | Ga0105238_10270739 | Ga0105238_102707392 | 235 |
| 91 | 3300009553 | Ga0105249_10478526 | Ga0105249_104785262 | 235 |
| 92 | 3300010375 | Ga0105239_10231826 | Ga0105239_102318261 | 235 |
| 93 | 3300011119 | Ga0105246_10776099 | Ga0105246_107760991 | 235 |
| 94 | 3300013296 | Ga0157374_10504184 | Ga0157374_105041842 | 235 |
| 95 | 3300013297 | Ga0157378_10117333 | Ga0157378_101173332 | 235 |
| 96 | 3300013306 | Ga0163162_10444438 | Ga0163162_104444382 | 235 |
| 97 | 3300013308 | Ga0157375_10573957 | Ga0157375_105739571 | 235 |
| 98 | 3300014325 | Ga0163163_10250958 | Ga0163163_102509582 | 235 |
| 99 | 3300014326 | Ga0157380_10182890 | Ga0157380_101828902 | 235 |
| 100 | 3300014745 | Ga0157377_10057778 | Ga0157377_100577783 | 235 |
| 101 | 3300014968 | Ga0157379_10880716 | Ga0157379_108807161 | 235 |
| 102 | 3300025901 | Ga0207688_10324349 | Ga0207688_103243492 | 235 |
| 103 | 3300025908 | Ga0207643_10187581 | Ga0207643_101875812 | 235 |
| 104 | 3300025918 | Ga0207662_10121337 | Ga0207662_101213372 | 235 |
| 105 | 3300025935 | Ga0207709_10306009 | Ga0207709_103060091 | 235 |
| 106 | 3300025937 | Ga0207669_10069499 | Ga0207669_100694993 | 235 |
| 107 | 3300025938 | Ga0207704_10601256 | Ga0207704_106012561 | 235 |
| 108 | 3300025944 | Ga0207661_10344203 | Ga0207661_103442032 | 235 |
| 109 | 3300025986 | Ga0207658_10631032 | Ga0207658_106310322 | 235 |
| 110 | 3300026067 | Ga0207678_10237972 | Ga0207678_102379722 | 235 |
| 111 | 3300026075 | Ga0207708_10091905 | Ga0207708_100919054 | 235 |
| 112 | 3300026089 | Ga0207648_10104417 | Ga0207648_101044172 | 235 |
| 113 | 3300026116 | Ga0207674_10017568 | Ga0207674_100175688 | 235 |
| 114 | 3300026118 | Ga0207675_100318926 | Ga0207675_1003189262 | 235 |
| 115 | 3300027907 | Ga0207428_10260880 | Ga0207428_102608802 | 235 |
| 116 | 3300028379 | Ga0268266_10540317 | Ga0268266_105403172 | 235 |
| 117 | 3300031456 | Ga0307513_10116836 | Ga0307513_101168363 | 235 |
| 118 | 3300042008 | Ga0439450_014019 | Ga0439450_014019_819_1538 | 235 |
| 119 | 3300045976 | Ga0466967_0190544 | Ga0466967_0190544_1174_1881 | 235 |
| 120 | 3300045976 | Ga0466967_0739432 | Ga0466967_0739432_237_944 | 235 |
| 121 | 3300048911 | Ga0496108_0161759 | Ga0496108_0161759_289_1002 | 235 |
| 122 | 3300048912 | Ga0496109_0370793 | Ga0496109_0370793_274_987 | 235 |
| 123 | 3300048921 | Ga0496118_0012162 | Ga0496118_0012162_5713_6420 | 235 |
| 124 | 3300048922 | Ga0496119_0117176 | Ga0496119_0117176_573_1286 | 235 |
| 125 | 3300049582 | Ga0501048_0208004 | Ga0501048_0208004_192_905 | 235 |
| 126 | 3300049824 | Ga0501045_0373786 | Ga0501045_0373786_127_840 | 235 |
| 127 | 3300050511 | nmdc:mga08y16_608601_c1 | nmdc:mga08y16_608601_c1_61_774 | 235 |
| 128 | 3300053140 | Ga0500573_0000031 | Ga0500573_0000031_48112_48819 | 235 |
| 129 | 3300002738 | JGI25154J39366_1005749 | JGI25154J39366_10057492 | 236 |
| 130 | 3300003320 | rootH2_10035408 | rootH2_100354082 | 236 |
| 131 | 3300003322 | rootL2_10279124 | rootL2_102791242 | 236 |
| 132 | 3300003578 | Ga0006562J51391_1026926 | Ga0006562J51391_10269267 | 236 |
| 133 | 3300003578 | Ga0006562J51391_1026931 | Ga0006562J51391_10269313 | 236 |
| 134 | 3300005327 | Ga0070658_10010239 | Ga0070658_100102392 | 236 |
| 135 | 3300005327 | Ga0070658_10032539 | Ga0070658_100325395 | 236 |
| 136 | 3300005327 | Ga0070658_10058294 | Ga0070658_100582942 | 236 |
| 137 | 3300005329 | Ga0070683_100477724 | Ga0070683_1004777242 | 236 |
| 138 | 3300005338 | Ga0068868_100010682 | Ga0068868_1000106822 | 236 |
| 139 | 3300005339 | Ga0070660_100479915 | Ga0070660_1004799152 | 236 |
| 140 | 3300005344 | Ga0070661_100350234 | Ga0070661_1003502342 | 236 |
| 141 | 3300005355 | Ga0070671_100046268 | Ga0070671_1000462682 | 236 |
| 142 | 3300005366 | Ga0070659_100000468 | Ga0070659_10000046823 | 236 |
| 143 | 3300005367 | Ga0070667_100170491 | Ga0070667_1001704911 | 236 |
| 144 | 3300005434 | Ga0070709_10001367 | Ga0070709_1000136711 | 236 |
| 145 | 3300005435 | Ga0070714_100020381 | Ga0070714_1000203812 | 236 |
| 146 | 3300005437 | Ga0070710_10003338 | Ga0070710_100033386 | 236 |
| 147 | 3300005439 | Ga0070711_100033408 | Ga0070711_1000334083 | 236 |
| 148 | 3300005459 | Ga0068867_100348933 | Ga0068867_1003489331 | 236 |
| 149 | 3300005466 | Ga0070685_10000654 | Ga0070685_100006545 | 236 |
| 150 | 3300005539 | Ga0068853_100017331 | Ga0068853_1000173313 | 236 |
| 151 | 3300005563 | Ga0068855_100033650 | Ga0068855_1000336502 | 236 |
| 152 | 3300005563 | Ga0068855_100133317 | Ga0068855_1001333174 | 236 |
| 153 | 3300005563 | Ga0068855_100445115 | Ga0068855_1004451152 | 236 |
| 154 | 3300005563 | Ga0068855_100490305 | Ga0068855_1004903052 | 236 |
| 155 | 3300005563 | Ga0068855_100822610 | Ga0068855_1008226101 | 236 |
| 156 | 3300005577 | Ga0068857_100006718 | Ga0068857_1000067188 | 236 |
| 157 | 3300005578 | Ga0068854_100451210 | Ga0068854_1004512102 | 236 |
| 158 | 3300005614 | Ga0068856_100052177 | Ga0068856_1000521772 | 236 |
| 159 | 3300005614 | Ga0068856_100550896 | Ga0068856_1005508962 | 236 |
| 160 | 3300005615 | Ga0070702_100166490 | Ga0070702_1001664902 | 236 |
| 161 | 3300005616 | Ga0068852_100008145 | Ga0068852_1000081453 | 236 |
| 162 | 3300005616 | Ga0068852_100018621 | Ga0068852_1000186214 | 236 |
| 163 | 3300005616 | Ga0068852_100063387 | Ga0068852_1000633872 | 236 |
| 164 | 3300005618 | Ga0068864_100025808 | Ga0068864_1000258084 | 236 |
| 165 | 3300005618 | Ga0068864_100104172 | Ga0068864_1001041722 | 236 |
| 166 | 3300005834 | Ga0068851_10000001 | Ga0068851_1000000155 | 236 |
| 167 | 3300005841 | Ga0068863_100213458 | Ga0068863_1002134583 | 236 |
| 168 | 3300005842 | Ga0068858_100000016 | Ga0068858_100000016114 | 236 |
| 169 | 3300005937 | Ga0081455_10001637 | Ga0081455_1000163718 | 236 |
| 170 | 3300005937 | Ga0081455_10012836 | Ga0081455_100128362 | 236 |
| 171 | 3300006038 | Ga0075365_10016678 | Ga0075365_100166784 | 236 |
| 172 | 3300006038 | Ga0075365_10329304 | Ga0075365_103293041 | 236 |
| 173 | 3300006051 | Ga0075364_10008851 | Ga0075364_100088514 | 236 |
| 174 | 3300006051 | Ga0075364_10093030 | Ga0075364_100930302 | 236 |
| 175 | 3300006051 | Ga0075364_10374642 | Ga0075364_103746422 | 236 |
| 176 | 3300006163 | Ga0070715_10051517 | Ga0070715_100515172 | 236 |
| 177 | 3300006173 | Ga0070716_100004107 | Ga0070716_1000041075 | 236 |
| 178 | 3300006175 | Ga0070712_100018022 | Ga0070712_1000180224 | 236 |
| 179 | 3300006186 | Ga0075369_10007022 | Ga0075369_100070224 | 236 |
| 180 | 3300007076 | Ga0075435_100434546 | Ga0075435_1004345462 | 236 |
| 181 | 3300009093 | Ga0105240_10021811 | Ga0105240_100218117 | 236 |
| 182 | 3300009101 | Ga0105247_10012472 | Ga0105247_100124725 | 236 |
| 183 | 3300009148 | Ga0105243_10097892 | Ga0105243_100978922 | 236 |
| 184 | 3300009174 | Ga0105241_10132132 | Ga0105241_101321322 | 236 |
| 185 | 3300009174 | Ga0105241_10482387 | Ga0105241_104823872 | 236 |
| 186 | 3300009177 | Ga0105248_10000366 | Ga0105248_1000036642 | 236 |
| 187 | 3300009177 | Ga0105248_10042104 | Ga0105248_100421044 | 236 |
| 188 | 3300009545 | Ga0105237_10006078 | Ga0105237_1000607814 | 236 |
| 189 | 3300009545 | Ga0105237_10207383 | Ga0105237_102073832 | 236 |
| 190 | 3300009545 | Ga0105237_10435028 | Ga0105237_104350282 | 236 |
| 191 | 3300009551 | Ga0105238_10002701 | Ga0105238_100027013 | 236 |
| 192 | 3300009551 | Ga0105238_10373666 | Ga0105238_103736662 | 236 |
| 193 | 3300010375 | Ga0105239_10129234 | Ga0105239_101292342 | 236 |
| 194 | 3300010375 | Ga0105239_10174532 | Ga0105239_101745322 | 236 |
| 195 | 3300010375 | Ga0105239_10408799 | Ga0105239_104087991 | 236 |
| 196 | 3300011119 | Ga0105246_10078550 | Ga0105246_100785502 | 236 |
| 197 | 3300013105 | Ga0157369_10072382 | Ga0157369_100723823 | 236 |
| 198 | 3300013250 | Ga0171462_1004 | Ga0171462_1004465 | 236 |
| 199 | 3300013296 | Ga0157374_10021634 | Ga0157374_100216347 | 236 |
| 200 | 3300013306 | Ga0163162_10037398 | Ga0163162_100373982 | 236 |
| 201 | 3300013308 | Ga0157375_10276059 | Ga0157375_102760592 | 236 |
| 202 | 3300014325 | Ga0163163_10023270 | Ga0163163_100232704 | 236 |
| 203 | 3300014325 | Ga0163163_10023605 | Ga0163163_100236053 | 236 |
| 204 | 3300014326 | Ga0157380_10041942 | Ga0157380_100419422 | 236 |
| 205 | 3300014968 | Ga0157379_10015256 | Ga0157379_100152568 | 236 |
| 206 | 3300014968 | Ga0157379_10027288 | Ga0157379_100272882 | 236 |
| 207 | 3300014969 | Ga0157376_10628913 | Ga0157376_106289131 | 236 |
| 208 | 3300020077 | Ga0206351_11016496 | Ga0206351_110164962 | 236 |
| 209 | 3300020082 | Ga0206353_10652235 | Ga0206353_106522351 | 236 |
| 210 | 3300025246 | Ga0209646_1000013 | Ga0209646_1000013399 | 236 |
| 211 | 3300025246 | Ga0209646_1000014 | Ga0209646_1000014192 | 236 |
| 212 | 3300025321 | Ga0207656_10000005 | Ga0207656_10000005444 | 236 |
| 213 | 3300025898 | Ga0207692_10014149 | Ga0207692_100141493 | 236 |
| 214 | 3300025900 | Ga0207710_10012760 | Ga0207710_100127605 | 236 |
| 215 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011681 | 236 |
| 216 | 3300025909 | Ga0207705_10021833 | Ga0207705_100218333 | 236 |
| 217 | 3300025911 | Ga0207654_10000001 | Ga0207654_100000011004 | 236 |
| 218 | 3300025913 | Ga0207695_10003316 | Ga0207695_1000331612 | 236 |
| 219 | 3300025913 | Ga0207695_10023069 | Ga0207695_100230695 | 236 |
| 220 | 3300025914 | Ga0207671_10000016 | Ga0207671_1000001614 | 236 |
| 221 | 3300025919 | Ga0207657_10064263 | Ga0207657_100642634 | 236 |
| 222 | 3300025920 | Ga0207649_10121904 | Ga0207649_101219042 | 236 |
| 223 | 3300025924 | Ga0207694_10000022 | Ga0207694_1000002216 | 236 |
| 224 | 3300025924 | Ga0207694_10260068 | Ga0207694_102600681 | 236 |
| 225 | 3300025926 | Ga0207659_10215771 | Ga0207659_102157712 | 236 |
| 226 | 3300025928 | Ga0207700_10006078 | Ga0207700_100060786 | 236 |
| 227 | 3300025929 | Ga0207664_10002462 | Ga0207664_100024622 | 236 |
| 228 | 3300025932 | Ga0207690_10007391 | Ga0207690_100073918 | 236 |
| 229 | 3300025935 | Ga0207709_10054722 | Ga0207709_100547223 | 236 |
| 230 | 3300025939 | Ga0207665_10006662 | Ga0207665_100066626 | 236 |
| 231 | 3300025939 | Ga0207665_10040177 | Ga0207665_100401774 | 236 |
| 232 | 3300025940 | Ga0207691_10254213 | Ga0207691_102542132 | 236 |
| 233 | 3300025940 | Ga0207691_10696537 | Ga0207691_106965371 | 236 |
| 234 | 3300025941 | Ga0207711_10002007 | Ga0207711_1000200716 | 236 |
| 235 | 3300025941 | Ga0207711_10024716 | Ga0207711_100247165 | 236 |
| 236 | 3300025941 | Ga0207711_10053568 | Ga0207711_100535685 | 236 |
| 237 | 3300025949 | Ga0207667_10009682 | Ga0207667_100096824 | 236 |
| 238 | 3300025949 | Ga0207667_10032898 | Ga0207667_100328985 | 236 |
| 239 | 3300025949 | Ga0207667_10186489 | Ga0207667_101864892 | 236 |
| 240 | 3300025949 | Ga0207667_11002724 | Ga0207667_110027241 | 236 |
| 241 | 3300025981 | Ga0207640_10252296 | Ga0207640_102522962 | 236 |
| 242 | 3300025986 | Ga0207658_10146872 | Ga0207658_101468723 | 236 |
| 243 | 3300026023 | Ga0207677_10042805 | Ga0207677_100428053 | 236 |
| 244 | 3300026035 | Ga0207703_10000075 | Ga0207703_1000007550 | 236 |
| 245 | 3300026041 | Ga0207639_10011644 | Ga0207639_100116448 | 236 |
| 246 | 3300026067 | Ga0207678_10234599 | Ga0207678_102345992 | 236 |
| 247 | 3300026078 | Ga0207702_10047043 | Ga0207702_100470432 | 236 |
| 248 | 3300026088 | Ga0207641_10192067 | Ga0207641_101920674 | 236 |
| 249 | 3300026095 | Ga0207676_10034966 | Ga0207676_100349664 | 236 |
| 250 | 3300026095 | Ga0207676_10057373 | Ga0207676_100573735 | 236 |
| 251 | 3300026116 | Ga0207674_10023075 | Ga0207674_100230754 | 236 |
| 252 | 3300026116 | Ga0207674_10218618 | Ga0207674_102186183 | 236 |
| 253 | 3300026116 | Ga0207674_10606866 | Ga0207674_106068662 | 236 |
| 254 | 3300026118 | Ga0207675_100129741 | Ga0207675_1001297412 | 236 |
| 255 | 3300026142 | Ga0207698_10001420 | Ga0207698_100014209 | 236 |
| 256 | 3300026142 | Ga0207698_10001474 | Ga0207698_1000147412 | 236 |
| 257 | 3300026142 | Ga0207698_10064674 | Ga0207698_100646745 | 236 |
| 258 | 3300028379 | Ga0268266_10291866 | Ga0268266_102918662 | 236 |
| 259 | 3300031247 | Ga0265340_10006120 | Ga0265340_100061206 | 236 |
| 260 | 3300031507 | Ga0307509_10122663 | Ga0307509_101226632 | 236 |
| 261 | 3300031548 | Ga0307408_100050562 | Ga0307408_1000505622 | 236 |
| 262 | 3300031824 | Ga0307413_10479384 | Ga0307413_104793842 | 236 |
| 263 | 3300031901 | Ga0307406_10000031 | Ga0307406_1000003130 | 236 |
| 264 | 3300031901 | Ga0307406_10012526 | Ga0307406_100125264 | 236 |
| 265 | 3300031901 | Ga0307406_10025710 | Ga0307406_100257104 | 236 |
| 266 | 3300031901 | Ga0307406_10095157 | Ga0307406_100951571 | 236 |
| 267 | 3300031901 | Ga0307406_10171807 | Ga0307406_101718072 | 236 |
| 268 | 3300031901 | Ga0307406_10379541 | Ga0307406_103795411 | 236 |
| 269 | 3300031901 | Ga0307406_10736705 | Ga0307406_107367051 | 236 |
| 270 | 3300031911 | Ga0307412_10067849 | Ga0307412_100678492 | 236 |
| 271 | 3300031995 | Ga0307409_100458519 | Ga0307409_1004585192 | 236 |
| 272 | 3300032002 | Ga0307416_100108211 | Ga0307416_1001082112 | 236 |
| 273 | 3300032002 | Ga0307416_100595526 | Ga0307416_1005955262 | 236 |
| 274 | 3300032002 | Ga0307416_100729854 | Ga0307416_1007298542 | 236 |
| 275 | 3300032004 | Ga0307414_10007544 | Ga0307414_100075444 | 236 |
| 276 | 3300032004 | Ga0307414_10467091 | Ga0307414_104670911 | 236 |
| 277 | 3300032126 | Ga0307415_100291146 | Ga0307415_1002911461 | 236 |
| 278 | 3300035725 | Ga0373947_0230350 | Ga0373947_0230350_424_1140 | 236 |
| 279 | 3300037418 | Ga0395900_0039612 | Ga0395900_0039612_199_918 | 236 |
| 280 | 3300037418 | Ga0395900_0635351 | Ga0395900_0635351_32_781 | 236 |
| 281 | 3300037466 | Ga0395898_0133714 | Ga0395898_0133714_200_913 | 236 |
| 282 | 3300037471 | Ga0395905_0178811 | Ga0395905_0178811_560_1309 | 236 |
| 283 | 3300041451 | Ga0451791_0451102 | Ga0451791_0451102_1044_1763 | 236 |
| 284 | 3300041512 | Ga0451853_1463364 | Ga0451853_1463364_498_1217 | 236 |
| 285 | 3300042007 | Ga0439449_0112764 | Ga0439449_0112764_83_796 | 236 |
| 286 | 3300042016 | Ga0439463_001677 | Ga0439463_001677_2965_3687 | 236 |
| 287 | 3300042142 | Ga0450905_017826 | Ga0450905_017826_177_899 | 236 |
| 288 | 3300044683 | Ga0466965_0167350 | Ga0466965_0167350_235_996 | 236 |
| 289 | 3300044694 | Ga0466963_0342207 | Ga0466963_0342207_272_991 | 236 |
| 290 | 3300044706 | Ga0466964_0311265 | Ga0466964_0311265_11_736 | 236 |
| 291 | 3300044901 | Ga0466960_0077498 | Ga0466960_0077498_111_836 | 236 |
| 292 | 3300044901 | Ga0466960_0103863 | Ga0466960_0103863_206_919 | 236 |
| 293 | 3300044901 | Ga0466960_0235615 | Ga0466960_0235615_236_946 | 236 |
| 294 | 3300045976 | Ga0466967_0175139 | Ga0466967_0175139_751_1470 | 236 |
| 295 | 3300046453 | Ga0495627_000261 | Ga0495627_000261_46721_47437 | 236 |
| 296 | 3300046454 | Ga0495592_0124568 | Ga0495592_0124568_614_1327 | 236 |
| 297 | 3300046459 | Ga0495629_0157939 | Ga0495629_0157939_214_930 | 236 |
| 298 | 3300046460 | Ga0495638_0200690 | Ga0495638_0200690_22_747 | 236 |
| 299 | 3300046462 | Ga0495651_0008171 | Ga0495651_0008171_4222_4935 | 236 |
| 300 | 3300046463 | Ga0495653_0073472 | Ga0495653_0073472_347_1060 | 236 |
| 301 | 3300046472 | Ga0495580_0201312 | Ga0495580_0201312_255_971 | 236 |
| 302 | 3300046476 | Ga0495662_0000835 | Ga0495662_0000835_2989_3702 | 236 |
| 303 | 3300046477 | Ga0495664_0069796 | Ga0495664_0069796_68_781 | 236 |
| 304 | 3300046511 | Ga0495608_0023207 | Ga0495608_0023207_1911_2624 | 236 |
| 305 | 3300046512 | Ga0495610_0089488 | Ga0495610_0089488_127_852 | 236 |
| 306 | 3300046514 | Ga0495618_0197244 | Ga0495618_0197244_453_1166 | 236 |
| 307 | 3300046517 | Ga0495630_0016342 | Ga0495630_0016342_1492_2205 | 236 |
| 308 | 3300046526 | Ga0495666_0001138 | Ga0495666_0001138_11289_12002 | 236 |
| 309 | 3300046529 | Ga0495652_0069465 | Ga0495652_0069465_632_1345 | 236 |
| 310 | 3300046531 | Ga0495665_0006538 | Ga0495665_0006538_3545_4258 | 236 |
| 311 | 3300046533 | Ga0495640_0021254 | Ga0495640_0021254_2060_2773 | 236 |
| 312 | 3300046533 | Ga0495640_0028693 | Ga0495640_0028693_1031_1744 | 236 |
| 313 | 3300046535 | Ga0495586_0005335 | Ga0495586_0005335_1861_2574 | 236 |
| 314 | 3300046543 | Ga0495645_0027019 | Ga0495645_0027019_3000_3713 | 236 |
| 315 | 3300046642 | Ga0495634_0038965 | Ga0495634_0038965_1237_1950 | 236 |
| 316 | 3300046675 | Ga0495657_0017803 | Ga0495657_0017803_2836_3549 | 236 |
| 317 | 3300046679 | Ga0495623_0244261 | Ga0495623_0244261_80_793 | 236 |
| 318 | 3300046683 | Ga0495658_0299781 | Ga0495658_0299781_117_947 | 236 |
| 319 | 3300046692 | Ga0495671_0210313 | Ga0495671_0210313_144_854 | 236 |
| 320 | 3300046809 | Ga0495600_0143967 | Ga0495600_0143967_484_1197 | 236 |
| 321 | 3300047315 | Ga0495581_0038477 | Ga0495581_0038477_1773_2486 | 236 |
| 322 | 3300047317 | Ga0495604_0002933 | Ga0495604_0002933_7392_8105 | 236 |
| 323 | 3300047317 | Ga0495604_0093861 | Ga0495604_0093861_1461_2174 | 236 |
| 324 | 3300047319 | Ga0495674_0013078 | Ga0495674_0013078_2219_2932 | 236 |
| 325 | 3300047444 | Ga0495675_0018606 | Ga0495675_0018606_2945_3658 | 236 |
| 326 | 3300047471 | Ga0495684_0077748 | Ga0495684_0077748_202_915 | 236 |
| 327 | 3300047673 | Ga0495593_0031468 | Ga0495593_0031468_2145_2858 | 236 |
| 328 | 3300048088 | Ga0495602_0055930 | Ga0495602_0055930_1732_2445 | 236 |
| 329 | 3300048904 | Ga0496101_0035358 | Ga0496101_0035358_1502_2251 | 236 |
| 330 | 3300048904 | Ga0496101_0112961 | Ga0496101_0112961_443_1156 | 236 |
| 331 | 3300048905 | Ga0496102_0025335 | Ga0496102_0025335_4020_4733 | 236 |
| 332 | 3300048905 | Ga0496102_0503616 | Ga0496102_0503616_19_738 | 236 |
| 333 | 3300048906 | Ga0496103_0020149 | Ga0496103_0020149_2246_2995 | 236 |
| 334 | 3300048906 | Ga0496103_0321033 | Ga0496103_0321033_133_846 | 236 |
| 335 | 3300048907 | Ga0496104_0005368 | Ga0496104_0005368_4555_5268 | 236 |
| 336 | 3300048907 | Ga0496104_0174567 | Ga0496104_0174567_13_762 | 236 |
| 337 | 3300048908 | Ga0496105_0289150 | Ga0496105_0289150_460_1173 | 236 |
| 338 | 3300048909 | Ga0496106_0154777 | Ga0496106_0154777_864_1583 | 236 |
| 339 | 3300048909 | Ga0496106_0196899 | Ga0496106_0196899_769_1482 | 236 |
| 340 | 3300048910 | Ga0496107_0121585 | Ga0496107_0121585_746_1495 | 236 |
| 341 | 3300048911 | Ga0496108_0013624 | Ga0496108_0013624_3346_4059 | 236 |
| 342 | 3300048911 | Ga0496108_0031926 | Ga0496108_0031926_2322_3035 | 236 |
| 343 | 3300048911 | Ga0496108_0086867 | Ga0496108_0086867_1684_2403 | 236 |
| 344 | 3300048911 | Ga0496108_0212349 | Ga0496108_0212349_688_1437 | 236 |
| 345 | 3300048912 | Ga0496109_0009855 | Ga0496109_0009855_2970_3683 | 236 |
| 346 | 3300048912 | Ga0496109_0026768 | Ga0496109_0026768_52_765 | 236 |
| 347 | 3300048912 | Ga0496109_0763553 | Ga0496109_0763553_146_871 | 236 |
| 348 | 3300048913 | Ga0496110_0001722 | Ga0496110_0001722_11574_12287 | 236 |
| 349 | 3300048913 | Ga0496110_0003665 | Ga0496110_0003665_8532_9245 | 236 |
| 350 | 3300048914 | Ga0496111_0003973 | Ga0496111_0003973_6366_7079 | 236 |
| 351 | 3300048914 | Ga0496111_0030068 | Ga0496111_0030068_2142_2891 | 236 |
| 352 | 3300048914 | Ga0496111_0046827 | Ga0496111_0046827_970_1689 | 236 |
| 353 | 3300048914 | Ga0496111_0308735 | Ga0496111_0308735_310_1023 | 236 |
| 354 | 3300048915 | Ga0496112_0023186 | Ga0496112_0023186_3017_3730 | 236 |
| 355 | 3300048915 | Ga0496112_0090699 | Ga0496112_0090699_2176_2925 | 236 |
| 356 | 3300048916 | Ga0496113_0011584 | Ga0496113_0011584_4768_5481 | 236 |
| 357 | 3300048916 | Ga0496113_0607895 | Ga0496113_0607895_79_798 | 236 |
| 358 | 3300048917 | Ga0496114_0001454 | Ga0496114_0001454_14124_14843 | 236 |
| 359 | 3300048917 | Ga0496114_0111033 | Ga0496114_0111033_669_1388 | 236 |
| 360 | 3300048917 | Ga0496114_0151910 | Ga0496114_0151910_304_1020 | 236 |
| 361 | 3300048920 | Ga0496117_0000466 | Ga0496117_0000466_42279_42989 | 236 |
| 362 | 3300048920 | Ga0496117_0047699 | Ga0496117_0047699_495_1214 | 236 |
| 363 | 3300048920 | Ga0496117_0094734 | Ga0496117_0094734_203_925 | 236 |
| 364 | 3300048921 | Ga0496118_0037745 | Ga0496118_0037745_913_1635 | 236 |
| 365 | 3300048921 | Ga0496118_0054555 | Ga0496118_0054555_427_1146 | 236 |
| 366 | 3300048922 | Ga0496119_0002891 | Ga0496119_0002891_11086_11808 | 236 |
| 367 | 3300048922 | Ga0496119_0002893 | Ga0496119_0002893_15498_16211 | 236 |
| 368 | 3300048922 | Ga0496119_0009534 | Ga0496119_0009534_7174_7896 | 236 |
| 369 | 3300048922 | Ga0496119_0040161 | Ga0496119_0040161_65_814 | 236 |
| 370 | 3300048923 | Ga0496120_0000257 | Ga0496120_0000257_32954_33676 | 236 |
| 371 | 3300048923 | Ga0496120_0067147 | Ga0496120_0067147_62_784 | 236 |
| 372 | 3300048925 | Ga0496122_0090309 | Ga0496122_0090309_91_801 | 236 |
| 373 | 3300048925 | Ga0496122_0145953 | Ga0496122_0145953_330_1049 | 236 |
| 374 | 3300048927 | Ga0496124_0436737 | Ga0496124_0436737_105_824 | 236 |
| 375 | 3300048928 | Ga0496125_0011379 | Ga0496125_0011379_7408_8118 | 236 |
| 376 | 3300048928 | Ga0496125_0016046 | Ga0496125_0016046_4224_4934 | 236 |
| 377 | 3300048928 | Ga0496125_0021871 | Ga0496125_0021871_1862_2572 | 236 |
| 378 | 3300048928 | Ga0496125_0232904 | Ga0496125_0232904_375_1097 | 236 |
| 379 | 3300048929 | Ga0496126_0001669 | Ga0496126_0001669_231_956 | 236 |
| 380 | 3300048929 | Ga0496126_0001734 | Ga0496126_0001734_11259_11969 | 236 |
| 381 | 3300048929 | Ga0496126_0377401 | Ga0496126_0377401_195_917 | 236 |
| 382 | 3300049568 | Ga0501031_0016322 | Ga0501031_0016322_160_879 | 236 |
| 383 | 3300049568 | Ga0501031_0108469 | Ga0501031_0108469_736_1455 | 236 |
| 384 | 3300049569 | Ga0501032_0049337 | Ga0501032_0049337_441_1160 | 236 |
| 385 | 3300049569 | Ga0501032_0147707 | Ga0501032_0147707_652_1371 | 236 |
| 386 | 3300049569 | Ga0501032_0233252 | Ga0501032_0233252_10_729 | 236 |
| 387 | 3300049570 | Ga0501033_0009770 | Ga0501033_0009770_6210_6929 | 236 |
| 388 | 3300049570 | Ga0501033_0026929 | Ga0501033_0026929_135_857 | 236 |
| 389 | 3300049570 | Ga0501033_0127299 | Ga0501033_0127299_923_1642 | 236 |
| 390 | 3300049570 | Ga0501033_0249776 | Ga0501033_0249776_345_1064 | 236 |
| 391 | 3300049571 | Ga0501034_0008188 | Ga0501034_0008188_10_729 | 236 |
| 392 | 3300049571 | Ga0501034_0161596 | Ga0501034_0161596_612_1331 | 236 |
| 393 | 3300049571 | Ga0501034_0197438 | Ga0501034_0197438_879_1598 | 236 |
| 394 | 3300049572 | Ga0501036_0115830 | Ga0501036_0115830_624_1343 | 236 |
| 395 | 3300049572 | Ga0501036_0170899 | Ga0501036_0170899_923_1642 | 236 |
| 396 | 3300049572 | Ga0501036_0218188 | Ga0501036_0218188_438_1157 | 236 |
| 397 | 3300049573 | Ga0501037_0009202 | Ga0501037_0009202_1280_1999 | 236 |
| 398 | 3300049573 | Ga0501037_0105652 | Ga0501037_0105652_844_1563 | 236 |
| 399 | 3300049573 | Ga0501037_0236669 | Ga0501037_0236669_296_1015 | 236 |
| 400 | 3300049573 | Ga0501037_0280449 | Ga0501037_0280449_246_956 | 236 |
| 401 | 3300049574 | Ga0501038_0066240 | Ga0501038_0066240_1977_2696 | 236 |
| 402 | 3300049574 | Ga0501038_0143376 | Ga0501038_0143376_219_938 | 236 |
| 403 | 3300049574 | Ga0501038_0146406 | Ga0501038_0146406_598_1317 | 236 |
| 404 | 3300049574 | Ga0501038_0166765 | Ga0501038_0166765_511_1227 | 236 |
| 405 | 3300049575 | Ga0501039_0493678 | Ga0501039_0493678_71_790 | 236 |
| 406 | 3300049575 | Ga0501039_0533491 | Ga0501039_0533491_121_834 | 236 |
| 407 | 3300049576 | Ga0501040_0417833 | Ga0501040_0417833_43_783 | 236 |
| 408 | 3300049578 | Ga0501042_0407694 | Ga0501042_0407694_13_729 | 236 |
| 409 | 3300049579 | Ga0501043_0070893 | Ga0501043_0070893_42_761 | 236 |
| 410 | 3300049579 | Ga0501043_0120617 | Ga0501043_0120617_412_1134 | 236 |
| 411 | 3300049580 | Ga0501046_0011498 | Ga0501046_0011498_1568_2287 | 236 |
| 412 | 3300049580 | Ga0501046_0105154 | Ga0501046_0105154_54_776 | 236 |
| 413 | 3300049580 | Ga0501046_0229223 | Ga0501046_0229223_277_996 | 236 |
| 414 | 3300049581 | Ga0501047_0001859 | Ga0501047_0001859_14665_15384 | 236 |
| 415 | 3300049581 | Ga0501047_0006372 | Ga0501047_0006372_7413_8135 | 236 |
| 416 | 3300049581 | Ga0501047_0079831 | Ga0501047_0079831_1809_2528 | 236 |
| 417 | 3300049581 | Ga0501047_0135623 | Ga0501047_0135623_880_1599 | 236 |
| 418 | 3300049582 | Ga0501048_0005523 | Ga0501048_0005523_3001_3720 | 236 |
| 419 | 3300049585 | Ga0501069_0106228 | Ga0501069_0106228_160_879 | 236 |
| 420 | 3300049586 | Ga0501070_0077037 | Ga0501070_0077037_279_998 | 236 |
| 421 | 3300049586 | Ga0501070_0228625 | Ga0501070_0228625_721_1440 | 236 |
| 422 | 3300049586 | Ga0501070_0354245 | Ga0501070_0354245_29_751 | 236 |
| 423 | 3300049587 | Ga0501071_0041248 | Ga0501071_0041248_48_806 | 236 |
| 424 | 3300049589 | Ga0501073_0000030 | Ga0501073_0000030_49040_49753 | 236 |
| 425 | 3300049589 | Ga0501073_0131270 | Ga0501073_0131270_433_1152 | 236 |
| 426 | 3300049589 | Ga0501073_0198510 | Ga0501073_0198510_127_846 | 236 |
| 427 | 3300049590 | Ga0501074_0017719 | Ga0501074_0017719_242_961 | 236 |
| 428 | 3300049590 | Ga0501074_0142935 | Ga0501074_0142935_597_1313 | 236 |
| 429 | 3300049591 | Ga0501075_0088543 | Ga0501075_0088543_1205_1915 | 236 |
| 430 | 3300049592 | Ga0501076_0145792 | Ga0501076_0145792_1009_1719 | 236 |
| 431 | 3300049592 | Ga0501076_0357917 | Ga0501076_0357917_456_1175 | 236 |
| 432 | 3300049592 | Ga0501076_0480384 | Ga0501076_0480384_259_969 | 236 |
| 433 | 3300049742 | Ga0501080_0086845 | Ga0501080_0086845_181_897 | 236 |
| 434 | 3300049744 | Ga0501083_0038608 | Ga0501083_0038608_2461_3183 | 236 |
| 435 | 3300049822 | Ga0501035_0020822 | Ga0501035_0020822_1512_2231 | 236 |
| 436 | 3300049822 | Ga0501035_0025378 | Ga0501035_0025378_3945_4667 | 236 |
| 437 | 3300049822 | Ga0501035_0118938 | Ga0501035_0118938_505_1224 | 236 |
| 438 | 3300049822 | Ga0501035_0130254 | Ga0501035_0130254_853_1572 | 236 |
| 439 | 3300049822 | Ga0501035_0152121 | Ga0501035_0152121_419_1138 | 236 |
| 440 | 3300049822 | Ga0501035_0168090 | Ga0501035_0168090_238_957 | 236 |
| 441 | 3300049823 | Ga0501044_0014885 | Ga0501044_0014885_3932_4654 | 236 |
| 442 | 3300049823 | Ga0501044_0023642 | Ga0501044_0023642_879_1598 | 236 |
| 443 | 3300049823 | Ga0501044_0059103 | Ga0501044_0059103_1747_2466 | 236 |
| 444 | 3300049823 | Ga0501044_0180869 | Ga0501044_0180869_1212_1928 | 236 |
| 445 | 3300049823 | Ga0501044_0182997 | Ga0501044_0182997_912_1631 | 236 |
| 446 | 3300049823 | Ga0501044_0189754 | Ga0501044_0189754_880_1599 | 236 |
| 447 | 3300049823 | Ga0501044_0283285 | Ga0501044_0283285_571_1293 | 236 |
| 448 | 3300049823 | Ga0501044_0892045 | Ga0501044_0892045_35_748 | 236 |
| 449 | 3300049824 | Ga0501045_0049970 | Ga0501045_0049970_435_1154 | 236 |
| 450 | 3300049824 | Ga0501045_0295295 | Ga0501045_0295295_89_805 | 236 |
| 451 | 3300049824 | Ga0501045_0428054 | Ga0501045_0428054_84_794 | 236 |
| 452 | 3300050491 | nmdc:mga00v17_16050_c1 | nmdc:mga00v17_16050_c1_1032_1742 | 236 |
| 453 | 3300050491 | nmdc:mga00v17_28713_c1 | nmdc:mga00v17_28713_c1_1370_2083 | 236 |
| 454 | 3300050491 | nmdc:mga00v17_375834_c1 | nmdc:mga00v17_375834_c1_161_871 | 236 |
| 455 | 3300050492 | nmdc:mga0yw44_26725_c1 | nmdc:mga0yw44_26725_c1_749_1462 | 236 |
| 456 | 3300050516 | nmdc:mga0sz30_18584_c1 | nmdc:mga0sz30_18584_c1_775_1488 | 236 |
| 457 | 3300053077 | Ga0495601_0051946 | Ga0495601_0051946_1216_1929 | 236 |
| 458 | 3300053085 | Ga0495619_0143132 | Ga0495619_0143132_736_1449 | 236 |
| 459 | 3300053087 | Ga0500643_000325 | Ga0500643_000325_26375_27103 | 236 |
| 460 | 3300053093 | Ga0500651_0000383 | Ga0500651_0000383_21548_22270 | 236 |
| 461 | 3300053136 | Ga0500559_0001408 | Ga0500559_0001408_10439_11149 | 236 |
| 462 | 3300053140 | Ga0500573_0036783 | Ga0500573_0036783_983_1693 | 236 |
| 463 | 3300053140 | Ga0500573_0053588 | Ga0500573_0053588_824_1540 | 236 |
| 464 | 3300053142 | Ga0500577_0001521 | Ga0500577_0001521_273_995 | 236 |
| 465 | 3300053148 | Ga0500590_040928 | Ga0500590_040928_823_1536 | 236 |
| 466 | 3300053155 | Ga0500620_001788 | Ga0500620_001788_202_924 | 236 |
| 467 | 3300054114 | Ga0501084_0277307 | Ga0501084_0277307_584_1294 | 236 |
| 468 | 3300060353 | Ga0501082_0158948 | Ga0501082_0158948_411_1121 | 236 |
| 469 | 3300060353 | Ga0501082_0495924 | Ga0501082_0495924_20_739 | 236 |
| 470 | 3300061734 | Ga0530510_0281136 | Ga0530510_0281136_221_973 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qed-assembly1.cif.gz_A | crystal structure of salmonella thyphimurium lt2 glyoxalase ii | 0.7789 | 7 | 217 |
| 6dq2-assembly1.cif.gz_A | cronobacter sakazakii (enterobacter sakazakii) metallo-beta-lactamse harldq motif mutant s60 | 0.7785 | 1 | 216 |
| 2xf4-assembly1.cif.gz_A-2 | crystal structure of salmonella enterica serovar typhimurium ycbl | 0.7767 | 15 | 222 |
| 1qh5-assembly1.cif.gz_B | human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione | 0.7742 | 1 | 217 |
| 6s0i-assembly1.cif.gz_A | crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site | 0.7732 | 7 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O86336_13_270_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8682 | 1 | 235 | 3.60.15.10 |
| af_O86336_13_270_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8613 | 1 | 235 | 3.60.15.10 |
| af_Q9UT36_7_256_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7851 | 11 | 217 | 3.60.15.10 |
| af_Q95Q18_3_200_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7773 | 1 | 220 | 3.60.15.10 |
| af_Q8N490_119_385_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7773 | 7 | 217 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Y9AQV1-F1-model_v4 | Glyoxylase, beta-lactamase superfamily II | 1.002 | 1 | 234 |
|
| AF-A0A7W9CAV4-F1-model_v4 | Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) | 1 | 1 | 233 |
GO:0016787
|
| AF-A0A5C4VN22-F1-model_v4 | MBL fold metallo-hydrolase | 0.9974 | 1 | 234 |
GO:0016787
|
| AF-A0A5J6L196-F1-model_v4 | MBL fold metallo-hydrolase | 0.997 | 1 | 234 |
GO:0016787
|
| AF-D6M5Z0-F1-model_v4 | Metallo-beta-lactamase | 0.9953 | 1 | 206 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar