F450482

General Info

Members Datasets Scaffolds Average Seq Length
470 291 427 238

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0299781|Ga0495658_0299781_117_947
Length 276
Sequence MAPHRRADRRTPRPQLTVELAAGYDRVFLNSIRLSEKTMKLAPHLHRLGNDVVASYLVDTADGITLIDAGLPGHWRDLQRELGVLGKSVDDIRGVVLTHGDSDHIGFAERLRSEHGVPVFVHAADAVRTRTGEKPKVPFGPAKLGPTLGFFGYSLRKNGLRTRYVREVVEIGDGDVLDLPGKPVIVGMPGHSPGSVAVHVPLADAVFVGDALTTRHVLTGRTGPQAAPFTDDPAMALSSLDRIAGLFASWILPGHGAPWRVSPGDVETWVRSEAVE

Samples

Sample ID Description Type Environment
1 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221572 Leifsonia sp. Root60 Isolate Unclassified
5 2643221619 Agromyces sp. Root81 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221649 Leifsonia sp. Root4 Isolate Unclassified
8 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
11 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
12 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
13 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
14 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
15 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
16 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
17 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
18 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
19 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
20 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
21 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
22 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
23 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
24 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
25 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
26 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
27 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
28 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
29 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
30 2919069694 Microbacterium sp. 1154 Isolate Unclassified
31 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
32 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
33 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
34 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
35 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
36 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
37 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
38 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
39 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
179 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
180 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
282 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
283 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
284 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
289 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
290 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
291 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0.85
Isolates 9.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 4.68
Nodule 0
Rhizoplane 7.45
Rhizosphere 74.89
Stem 0
Stem Tuber 0
Unclassified 12.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1005749 3300002738 Bacteria 1924
2 rootH2_10035408 3300003320 Bacteria 2088
3 rootL2_10279124 3300003322 Bacteria 1573
4 Ga0006562J51391_1026926 3300003578 Bacteria 7025
5 Ga0006562J51391_1026931 3300003578 Bacteria 5380
6 Ga0070658_10010239 3300005327 Bacteria 7519
7 Ga0070658_10032539 3300005327 Bacteria 4192
8 Ga0070658_10058294 3300005327 Bacteria 3142
9 Ga0070683_100477724 3300005329 Bacteria 1190
10 Ga0068868_100010682 3300005338 Bacteria 6653
11 Ga0070660_100479915 3300005339 Bacteria 1033
12 Ga0070689_100282369 3300005340 Bacteria 1378
13 Ga0070661_100350234 3300005344 Bacteria 1158
14 Ga0070692_10071287 3300005345 Bacteria 1852
15 Ga0070675_100439656 3300005354 Bacteria 1168
16 Ga0070671_100046268 3300005355 Bacteria 3618
17 Ga0070674_100155622 3300005356 Bacteria 1729
18 Ga0070674_100166059 3300005356 Bacteria 1679
19 Ga0070688_100028574 3300005365 Bacteria 3331
20 Ga0070659_100000468 3300005366 Bacteria 29797
21 Ga0070667_100170491 3300005367 Bacteria 1921
22 Ga0070709_10001367 3300005434 Bacteria 13322
23 Ga0070714_100020381 3300005435 Bacteria 5414
24 Ga0070710_10003338 3300005437 Bacteria 7612
25 Ga0070711_100033408 3300005439 Bacteria 3426
26 Ga0070700_100100555 3300005441 Bacteria 1904
27 Ga0070694_100840600 3300005444 Bacteria 755
28 Ga0070663_100789365 3300005455 Bacteria 814
29 Ga0068867_100153703 3300005459 Bacteria 1809
30 Ga0068867_100348933 3300005459 Bacteria 1234
31 Ga0070685_10000654 3300005466 Bacteria 18932
32 Ga0070679_100529705 3300005530 Bacteria 1122
33 Ga0070684_100359226 3300005535 Bacteria 1340
34 Ga0068853_100017331 3300005539 Bacteria 5946
35 Ga0070672_100058814 3300005543 Bacteria 3022
36 Ga0070686_100057302 3300005544 Bacteria 2502
37 Ga0070665_100346632 3300005548 Bacteria 1490
38 Ga0068855_100033650 3300005563 Bacteria 6115
39 Ga0068855_100133317 3300005563 Bacteria 2835
40 Ga0068855_100181869 3300005563 Bacteria 2376
41 Ga0068855_100445115 3300005563 Bacteria 1414
42 Ga0068855_100490305 3300005563 Bacteria 1336
43 Ga0068855_100822610 3300005563 Bacteria 986
44 Ga0070664_100041887 3300005564 Bacteria 3865
45 Ga0068857_100006718 3300005577 Bacteria 9891
46 Ga0068854_100451210 3300005578 Bacteria 1074
47 Ga0068856_100052177 3300005614 Bacteria 4032
48 Ga0068856_100550896 3300005614 Bacteria 1174
49 Ga0070702_100166490 3300005615 Bacteria 1430
50 Ga0068852_100008145 3300005616 Bacteria 7697
51 Ga0068852_100018621 3300005616 Bacteria 5473
52 Ga0068852_100063387 3300005616 Bacteria 3218
53 Ga0068852_100195241 3300005616 Bacteria 1912
54 Ga0068859_100644218 3300005617 Bacteria 1152
55 Ga0068864_100025808 3300005618 Bacteria 4952
56 Ga0068864_100104172 3300005618 Bacteria 2520
57 Ga0068851_10000001 3300005834 Bacteria 495512
58 Ga0068863_100213458 3300005841 Bacteria 1858
59 Ga0068858_100000016 3300005842 Bacteria 193130
60 Ga0068858_100188320 3300005842 Bacteria 1950
61 Ga0081455_10001637 3300005937 Bacteria 27271
62 Ga0081455_10012836 3300005937 Bacteria 8320
63 Ga0075365_10016678 3300006038 Bacteria 4474
64 Ga0075365_10329304 3300006038 Bacteria 1076
65 Ga0075364_10008851 3300006051 Bacteria 6027
66 Ga0075364_10093030 3300006051 Bacteria 2002
67 Ga0075364_10195910 3300006051 Bacteria 1369
68 Ga0075364_10374642 3300006051 Bacteria 971
69 Ga0070715_10051517 3300006163 Bacteria 1772
70 Ga0070716_100004107 3300006173 Bacteria 6906
71 Ga0070712_100018022 3300006175 Bacteria 4580
72 Ga0075369_10007022 3300006186 Bacteria 4278
73 Ga0068865_100668275 3300006881 Bacteria 885
74 Ga0097620_100644209 3300006931 Bacteria 1152
75 Ga0075435_100434546 3300007076 Bacteria 1131
76 Ga0105240_10021811 3300009093 Bacteria 8511
77 Ga0111539_10023778 3300009094 Bacteria 7528
78 Ga0105247_10012472 3300009101 Bacteria 5105
79 Ga0105243_10097892 3300009148 Bacteria 2429
80 Ga0105243_10108490 3300009148 Bacteria 2317
81 Ga0105243_10160738 3300009148 Bacteria 1936
82 Ga0105241_10132132 3300009174 Bacteria 2022
83 Ga0105241_10482387 3300009174 Bacteria 1102
84 Ga0105248_10000366 3300009177 Bacteria 52614
85 Ga0105248_10042104 3300009177 Bacteria 5122
86 Ga0105237_10006078 3300009545 Bacteria 13507
87 Ga0105237_10207383 3300009545 Bacteria 1960
88 Ga0105237_10435028 3300009545 Bacteria 1317
89 Ga0105238_10002701 3300009551 Bacteria 17645
90 Ga0105238_10270739 3300009551 Bacteria 1679
91 Ga0105238_10373666 3300009551 Bacteria 1416
92 Ga0105249_10478526 3300009553 Bacteria 1288
93 Ga0105239_10129234 3300010375 Bacteria 2809
94 Ga0105239_10174532 3300010375 Bacteria 2404
95 Ga0105239_10231826 3300010375 Bacteria 2071
96 Ga0105239_10408799 3300010375 Bacteria 1536
97 Ga0105246_10078550 3300011119 Bacteria 2344
98 Ga0105246_10776099 3300011119 Bacteria 848
99 Ga0157369_10072382 3300013105 Bacteria 3699
100 Ga0171462_1004 3300013250 Bacteria 678877
101 Ga0157374_10021634 3300013296 Bacteria 5727
102 Ga0157374_10504184 3300013296 Bacteria 1215
103 Ga0157378_10117333 3300013297 Bacteria 2448
104 Ga0163162_10037398 3300013306 Bacteria 4844
105 Ga0163162_10444438 3300013306 Bacteria 1429
106 Ga0157375_10276059 3300013308 Bacteria 1843
107 Ga0157375_10573957 3300013308 Bacteria 1288
108 Ga0163163_10023270 3300014325 Bacteria 5878
109 Ga0163163_10023605 3300014325 Bacteria 5838
110 Ga0163163_10250958 3300014325 Bacteria 1820
111 Ga0157380_10041942 3300014326 Bacteria 3574
112 Ga0157380_10182890 3300014326 Bacteria 1843
113 Ga0157377_10057778 3300014745 Bacteria 2207
114 Ga0157379_10015256 3300014968 Bacteria 6739
115 Ga0157379_10027288 3300014968 Bacteria 5084
116 Ga0157379_10880716 3300014968 Bacteria 848
117 Ga0157376_10628913 3300014969 Bacteria 1071
118 Ga0206351_11016496 3300020077 Bacteria 1705
119 Ga0206353_10652235 3300020082 Bacteria 1139
120 Ga0209646_1000013 3300025246 Bacteria 565830
121 Ga0209646_1000014 3300025246 Bacteria 550484
122 Ga0207656_10000005 3300025321 Bacteria 490514
123 Ga0207692_10014149 3300025898 Bacteria 3480
124 Ga0207710_10012760 3300025900 Bacteria 3538
125 Ga0207688_10324349 3300025901 Bacteria 945
126 Ga0207643_10187581 3300025908 Bacteria 1254
127 Ga0207705_10000001 3300025909 Bacteria 2061880
128 Ga0207705_10021833 3300025909 Bacteria 4567
129 Ga0207654_10000001 3300025911 Bacteria 1816198
130 Ga0207695_10003316 3300025913 Bacteria 22816
131 Ga0207695_10023069 3300025913 Bacteria 7044
132 Ga0207671_10000016 3300025914 Bacteria 435413
133 Ga0207662_10121337 3300025918 Bacteria 1640
134 Ga0207657_10064263 3300025919 Bacteria 3133
135 Ga0207649_10121904 3300025920 Bacteria 1759
136 Ga0207694_10000022 3300025924 Bacteria 288900
137 Ga0207694_10241389 3300025924 Bacteria 1477
138 Ga0207694_10260068 3300025924 Bacteria 1422
139 Ga0207659_10215771 3300025926 Bacteria 1540
140 Ga0207700_10006078 3300025928 Bacteria 7272
141 Ga0207664_10002462 3300025929 Bacteria 12261
142 Ga0207690_10007391 3300025932 Bacteria 6522
143 Ga0207690_10325392 3300025932 Bacteria 1209
144 Ga0207709_10054722 3300025935 Bacteria 2461
145 Ga0207709_10306009 3300025935 Bacteria 1184
146 Ga0207669_10069499 3300025937 Bacteria 2204
147 Ga0207704_10601256 3300025938 Bacteria 900
148 Ga0207665_10006662 3300025939 Bacteria 7663
149 Ga0207665_10040177 3300025939 Bacteria 3120
150 Ga0207691_10254213 3300025940 Bacteria 1516
151 Ga0207691_10696537 3300025940 Bacteria 857
152 Ga0207711_10002007 3300025941 Bacteria 18405
153 Ga0207711_10024716 3300025941 Bacteria 5037
154 Ga0207711_10053568 3300025941 Bacteria 3460
155 Ga0207661_10344203 3300025944 Bacteria 1344
156 Ga0207667_10009682 3300025949 Bacteria 11336
157 Ga0207667_10032898 3300025949 Bacteria 5581
158 Ga0207667_10152150 3300025949 Bacteria 2381
159 Ga0207667_10186489 3300025949 Bacteria 2129
160 Ga0207667_11002724 3300025949 Bacteria 822
161 Ga0207640_10252296 3300025981 Bacteria 1370
162 Ga0207658_10146872 3300025986 Bacteria 1916
163 Ga0207658_10631032 3300025986 Bacteria 965
164 Ga0207677_10042805 3300026023 Bacteria 3006
165 Ga0207703_10000075 3300026035 Bacteria 118422
166 Ga0207639_10011644 3300026041 Bacteria 6112
167 Ga0207678_10234599 3300026067 Bacteria 1571
168 Ga0207678_10237972 3300026067 Bacteria 1559
169 Ga0207708_10091905 3300026075 Bacteria 2341
170 Ga0207702_10047043 3300026078 Bacteria 3634
171 Ga0207641_10192067 3300026088 Bacteria 1877
172 Ga0207648_10104417 3300026089 Bacteria 2485
173 Ga0207676_10034966 3300026095 Bacteria 3808
174 Ga0207676_10057373 3300026095 Bacteria 3066
175 Ga0207674_10017568 3300026116 Bacteria 7803
176 Ga0207674_10023075 3300026116 Bacteria 6673
177 Ga0207674_10218618 3300026116 Bacteria 1854
178 Ga0207674_10606866 3300026116 Bacteria 1057
179 Ga0207675_100129741 3300026118 Bacteria 2390
180 Ga0207675_100318926 3300026118 Bacteria 1517
181 Ga0207698_10001420 3300026142 Bacteria 13905
182 Ga0207698_10001474 3300026142 Bacteria 13682
183 Ga0207698_10064674 3300026142 Bacteria 2868
184 Ga0207428_10260880 3300027907 Bacteria 1291
185 Ga0268266_10291866 3300028379 Bacteria 1519
186 Ga0268266_10297371 3300028379 Bacteria 1505
187 Ga0268266_10540317 3300028379 Bacteria 1116
188 Ga0265340_10006120 3300031247 Bacteria 6635
189 Ga0307513_10116836 3300031456 Bacteria 2645
190 Ga0307509_10122663 3300031507 Bacteria 2573
191 Ga0307408_100050562 3300031548 Unclassified 2990
192 Ga0307413_10479384 3300031824 Bacteria 994
193 Ga0307406_10000031 3300031901 Bacteria 87391
194 Ga0307406_10012526 3300031901 Bacteria 4834
195 Ga0307406_10025710 3300031901 Bacteria 3526
196 Ga0307406_10095157 3300031901 Bacteria 2015
197 Ga0307406_10171807 3300031901 Bacteria 1569
198 Ga0307406_10379541 3300031901 Bacteria 1114
199 Ga0307406_10558964 3300031901 Bacteria 937
200 Ga0307406_10736705 3300031901 Bacteria 826
201 Ga0307412_10067849 3300031911 Bacteria 2423
202 Ga0307409_100458519 3300031995 Bacteria 1232
203 Ga0307416_100108211 3300032002 Bacteria 2442
204 Ga0307416_100595526 3300032002 Bacteria 1185
205 Ga0307416_100729854 3300032002 Bacteria 1082
206 Ga0307414_10007544 3300032004 Bacteria 6115
207 Ga0307414_10467091 3300032004 Bacteria 1110
208 Ga0307415_100291146 3300032126 Bacteria 1348
209 Ga0373947_0230350 3300035725 Bacteria 1220
210 Ga0395900_0039612 3300037418 Bacteria 4855
211 Ga0395900_0635351 3300037418 Bacteria 1005
212 Ga0395898_0133714 3300037466 Bacteria 2375
213 Ga0395905_0178811 3300037471 Bacteria 1992
214 Ga0451791_0451102 3300041451 Bacteria 3944
215 Ga0451853_1463364 3300041512 Bacteria 1562
216 Ga0439449_0112764 3300042007 Bacteria 1008
217 Ga0439450_014019 3300042008 Bacteria 1620
218 Ga0439463_001677 3300042016 Bacteria 5803
219 Ga0450905_017826 3300042142 Bacteria 1032
220 Ga0466965_0167350 3300044683 Bacteria 1155
221 Ga0466963_0342207 3300044694 Bacteria 1053
222 Ga0466964_0311265 3300044706 Bacteria 797
223 Ga0466970_0005495 3300044765 Bacteria 6290
224 Ga0466957_0051899 3300044842 Bacteria 2496
225 Ga0466960_0077498 3300044901 Bacteria 1667
226 Ga0466960_0103863 3300044901 Bacteria 1467
227 Ga0466960_0235615 3300044901 Bacteria 1012
228 Ga0466960_0290263 3300044901 Bacteria 919
229 Ga0466967_0175139 3300045976 Bacteria 2021
230 Ga0466967_0190544 3300045976 Bacteria 1938
231 Ga0466967_0739432 3300045976 Bacteria 975
232 Ga0495627_000261 3300046453 Bacteria 54087
233 Ga0495592_0124568 3300046454 Bacteria 1809
234 Ga0495629_0157939 3300046459 Bacteria 1575
235 Ga0495638_0200690 3300046460 Bacteria 1126
236 Ga0495651_0008171 3300046462 Bacteria 8025
237 Ga0495653_0073472 3300046463 Bacteria 2551
238 Ga0495580_0201312 3300046472 Bacteria 1372
239 Ga0495662_0000835 3300046476 Bacteria 14966
240 Ga0495664_0069796 3300046477 Bacteria 2097
241 Ga0495608_0023207 3300046511 Bacteria 4253
242 Ga0495610_0089488 3300046512 Bacteria 1398
243 Ga0495618_0197244 3300046514 Bacteria 1275
244 Ga0495630_0016342 3300046517 Bacteria 5421
245 Ga0495666_0001138 3300046526 Bacteria 12749
246 Ga0495652_0069465 3300046529 Bacteria 2948
247 Ga0495665_0006538 3300046531 Bacteria 6295
248 Ga0495640_0021254 3300046533 Bacteria 4765
249 Ga0495640_0028693 3300046533 Bacteria 4004
250 Ga0495586_0005335 3300046535 Bacteria 6876
251 Ga0495645_0027019 3300046543 Bacteria 4168
252 Ga0495634_0038965 3300046642 Bacteria 3238
253 Ga0495657_0017803 3300046675 Bacteria 5152
254 Ga0495623_0244261 3300046679 Bacteria 1012
255 Ga0495658_0299781 3300046683 Bacteria 1016
256 Ga0495671_0210313 3300046692 Bacteria 943
257 Ga0495600_0143967 3300046809 Bacteria 1545
258 Ga0495581_0038477 3300047315 Bacteria 2768
259 Ga0495604_0002933 3300047317 Bacteria 13666
260 Ga0495604_0093861 3300047317 Bacteria 2219
261 Ga0495674_0013078 3300047319 Bacteria 7808
262 Ga0495675_0018606 3300047444 Bacteria 4409
263 Ga0495684_0077748 3300047471 Bacteria 2518
264 Ga0495593_0031468 3300047673 Bacteria 2898
265 Ga0495602_0055930 3300048088 Bacteria 3472
266 Ga0496101_0035358 3300048904 Bacteria 3533
267 Ga0496101_0112961 3300048904 Bacteria 2046
268 Ga0496102_0025335 3300048905 Bacteria 5280
269 Ga0496102_0503616 3300048905 Bacteria 1133
270 Ga0496103_0020149 3300048906 Bacteria 4004
271 Ga0496103_0321033 3300048906 Bacteria 996
272 Ga0496104_0005368 3300048907 Bacteria 11219
273 Ga0496104_0174567 3300048907 Bacteria 2059
274 Ga0496105_0289150 3300048908 Bacteria 1320
275 Ga0496106_0154777 3300048909 Bacteria 1810
276 Ga0496106_0196899 3300048909 Bacteria 1603
277 Ga0496107_0121585 3300048910 Bacteria 1924
278 Ga0496108_0013624 3300048911 Bacteria 6638
279 Ga0496108_0031926 3300048911 Bacteria 4371
280 Ga0496108_0086867 3300048911 Bacteria 2656
281 Ga0496108_0161759 3300048911 Bacteria 1935
282 Ga0496108_0212349 3300048911 Bacteria 1680
283 Ga0496109_0009855 3300048912 Bacteria 8155
284 Ga0496109_0026768 3300048912 Bacteria 5143
285 Ga0496109_0370793 3300048912 Bacteria 1352
286 Ga0496109_0763553 3300048912 Bacteria 905
287 Ga0496110_0001722 3300048913 Bacteria 16109
288 Ga0496110_0003665 3300048913 Bacteria 11818
289 Ga0496111_0003973 3300048914 Bacteria 9283
290 Ga0496111_0030068 3300048914 Bacteria 3861
291 Ga0496111_0046827 3300048914 Bacteria 3114
292 Ga0496111_0308735 3300048914 Bacteria 1172
293 Ga0496112_0023186 3300048915 Bacteria 5924
294 Ga0496112_0090699 3300048915 Bacteria 3025
295 Ga0496113_0011584 3300048916 Bacteria 5892
296 Ga0496113_0607895 3300048916 Bacteria 875
297 Ga0496114_0001454 3300048917 Bacteria 17979
298 Ga0496114_0111033 3300048917 Bacteria 2349
299 Ga0496114_0151910 3300048917 Bacteria 2009
300 Ga0496117_0000466 3300048920 Bacteria 67525
301 Ga0496117_0047699 3300048920 Bacteria 3068
302 Ga0496117_0094734 3300048920 Bacteria 1910
303 Ga0496118_0012162 3300048921 Bacteria 8301
304 Ga0496118_0037745 3300048921 Bacteria 3883
305 Ga0496118_0054555 3300048921 Bacteria 3026
306 Ga0496119_0002891 3300048922 Bacteria 18335
307 Ga0496119_0002893 3300048922 Bacteria 18324
308 Ga0496119_0009534 3300048922 Bacteria 8314
309 Ga0496119_0040161 3300048922 Bacteria 2997
310 Ga0496119_0117176 3300048922 Bacteria 1469
311 Ga0496120_0000257 3300048923 Bacteria 88760
312 Ga0496120_0067147 3300048923 Bacteria 1982
313 Ga0496122_0090309 3300048925 Bacteria 2091
314 Ga0496122_0145953 3300048925 Bacteria 1470
315 Ga0496124_0436737 3300048927 Bacteria 897
316 Ga0496125_0011379 3300048928 Bacteria 8906
317 Ga0496125_0016046 3300048928 Bacteria 7211
318 Ga0496125_0021871 3300048928 Bacteria 5952
319 Ga0496125_0232904 3300048928 Bacteria 1176
320 Ga0496126_0001669 3300048929 Bacteria 33303
321 Ga0496126_0001734 3300048929 Bacteria 32346
322 Ga0496126_0158651 3300048929 Bacteria 1934
323 Ga0496126_0377401 3300048929 Bacteria 1155
324 Ga0501031_0016322 3300049568 Bacteria 4821
325 Ga0501031_0108469 3300049568 Bacteria 1813
326 Ga0501032_0049337 3300049569 Bacteria 2839
327 Ga0501032_0147707 3300049569 Bacteria 1547
328 Ga0501032_0233252 3300049569 Bacteria 1196
329 Ga0501033_0009770 3300049570 Bacteria 7369
330 Ga0501033_0026929 3300049570 Bacteria 4325
331 Ga0501033_0127299 3300049570 Bacteria 1846
332 Ga0501033_0249776 3300049570 Bacteria 1257
333 Ga0501034_0008188 3300049571 Bacteria 11085
334 Ga0501034_0161596 3300049571 Bacteria 2210
335 Ga0501034_0197438 3300049571 Bacteria 1971
336 Ga0501036_0115830 3300049572 Bacteria 2263
337 Ga0501036_0170899 3300049572 Bacteria 1831
338 Ga0501036_0218188 3300049572 Bacteria 1602
339 Ga0501037_0009202 3300049573 Bacteria 7239
340 Ga0501037_0105652 3300049573 Bacteria 2029
341 Ga0501037_0236669 3300049573 Bacteria 1281
342 Ga0501037_0280449 3300049573 Bacteria 1161
343 Ga0501038_0066240 3300049574 Bacteria 3076
344 Ga0501038_0143376 3300049574 Bacteria 1952
345 Ga0501038_0146406 3300049574 Bacteria 1928
346 Ga0501038_0166765 3300049574 Bacteria 1786
347 Ga0501039_0493678 3300049575 Unclassified 961
348 Ga0501039_0533491 3300049575 Bacteria 921
349 Ga0501040_0417833 3300049576 Bacteria 964
350 Ga0501041_0321087 3300049577 Bacteria 977
351 Ga0501042_0407694 3300049578 Bacteria 985
352 Ga0501043_0070893 3300049579 Bacteria 2737
353 Ga0501043_0120617 3300049579 Bacteria 2056
354 Ga0501046_0011498 3300049580 Bacteria 7568
355 Ga0501046_0105154 3300049580 Bacteria 2162
356 Ga0501046_0118813 3300049580 Bacteria 2013
357 Ga0501046_0229223 3300049580 Bacteria 1373
358 Ga0501047_0001859 3300049581 Bacteria 20320
359 Ga0501047_0006372 3300049581 Bacteria 11098
360 Ga0501047_0079831 3300049581 Bacteria 3145
361 Ga0501047_0135623 3300049581 Bacteria 2341
362 Ga0501048_0005523 3300049582 Bacteria 9620
363 Ga0501048_0208004 3300049582 Bacteria 1388
364 Ga0501069_0106228 3300049585 Bacteria 1596
365 Ga0501070_0077037 3300049586 Bacteria 2760
366 Ga0501070_0228625 3300049586 Bacteria 1524
367 Ga0501070_0354245 3300049586 Bacteria 1191
368 Ga0501071_0041248 3300049587 Bacteria 3305
369 Ga0501072_0008500 3300049588 Bacteria 7791
370 Ga0501072_0600126 3300049588 Bacteria 868
371 Ga0501073_0000030 3300049589 Bacteria 115949
372 Ga0501073_0131270 3300049589 Bacteria 1736
373 Ga0501073_0198510 3300049589 Bacteria 1387
374 Ga0501074_0017719 3300049590 Bacteria 5173
375 Ga0501074_0121422 3300049590 Bacteria 1869
376 Ga0501074_0142935 3300049590 Bacteria 1711
377 Ga0501075_0088543 3300049591 Bacteria 2347
378 Ga0501075_0096317 3300049591 Bacteria 2246
379 Ga0501076_0145792 3300049592 Bacteria 1925
380 Ga0501076_0357917 3300049592 Bacteria 1199
381 Ga0501076_0480384 3300049592 Bacteria 1024
382 Ga0501077_0082382 3300049593 Bacteria 2039
383 Ga0501079_0265129 3300049741 Bacteria 1343
384 Ga0501080_0086845 3300049742 Bacteria 2907
385 Ga0501083_0038608 3300049744 Bacteria 3245
386 Ga0501035_0020822 3300049822 Bacteria 6026
387 Ga0501035_0025378 3300049822 Bacteria 5434
388 Ga0501035_0118938 3300049822 Bacteria 2311
389 Ga0501035_0130254 3300049822 Bacteria 2193
390 Ga0501035_0152121 3300049822 Bacteria 2007
391 Ga0501035_0168090 3300049822 Bacteria 1895
392 Ga0501044_0014885 3300049823 Bacteria 8386
393 Ga0501044_0023642 3300049823 Bacteria 6534
394 Ga0501044_0059103 3300049823 Bacteria 3929
395 Ga0501044_0180869 3300049823 Bacteria 2075
396 Ga0501044_0182997 3300049823 Bacteria 2061
397 Ga0501044_0189754 3300049823 Bacteria 2018
398 Ga0501044_0283285 3300049823 Bacteria 1590
399 Ga0501044_0892045 3300049823 Bacteria 764
400 Ga0501045_0049970 3300049824 Bacteria 3050
401 Ga0501045_0295295 3300049824 Bacteria 1206
402 Ga0501045_0373786 3300049824 Bacteria 1061
403 Ga0501045_0428054 3300049824 Bacteria 984
404 nmdc:mga00v17_16050_c1 3300050491 Bacteria 4216
405 nmdc:mga00v17_28713_c1 3300050491 Bacteria 3260
406 nmdc:mga00v17_375834_c1 3300050491 Bacteria 924
407 nmdc:mga0yw44_26725_c1 3300050492 Bacteria 3300
408 nmdc:mga08y16_608601_c1 3300050511 Bacteria 1101
409 nmdc:mga0sz30_18584_c1 3300050516 Bacteria 2783
410 Ga0495601_0051946 3300053077 Bacteria 2587
411 Ga0495619_0143132 3300053085 Bacteria 1647
412 Ga0500643_000325 3300053087 Bacteria 38363
413 Ga0500651_0000383 3300053093 Bacteria 24162
414 Ga0500559_0000736 3300053136 Bacteria 21465
415 Ga0500559_0001408 3300053136 Bacteria 13667
416 Ga0500573_0000031 3300053140 Bacteria 134098
417 Ga0500573_0036783 3300053140 Bacteria 2827
418 Ga0500573_0053588 3300053140 Bacteria 2318
419 Ga0500577_0001521 3300053142 Bacteria 5905
420 Ga0500590_040928 3300053148 Bacteria 2385
421 Ga0500620_001788 3300053155 Bacteria 4102
422 Ga0501084_0242360 3300054114 Bacteria 1522
423 Ga0501084_0277307 3300054114 Bacteria 1416
424 Ga0501082_0135219 3300060353 Bacteria 2139
425 Ga0501082_0158948 3300060353 Bacteria 1964
426 Ga0501082_0495924 3300060353 Bacteria 1067
427 Ga0530510_0281136 3300061734 Bacteria 1243

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0600126 Ga0501072_0600126_283_858 190
2 3300049577 Ga0501041_0321087 Ga0501041_0321087_329_964 210
3 3300049593 Ga0501077_0082382 Ga0501077_0082382_20_655 210
4 3300025924 Ga0207694_10241389 Ga0207694_102413893 212
5 3300049580 Ga0501046_0118813 Ga0501046_0118813_842_1510 221
6 3300049590 Ga0501074_0121422 Ga0501074_0121422_164_832 221
7 3300049591 Ga0501075_0096317 Ga0501075_0096317_710_1378 221
8 3300054114 Ga0501084_0242360 Ga0501084_0242360_382_1050 221
9 3300060353 Ga0501082_0135219 Ga0501082_0135219_1373_2041 221
10 3300053136 Ga0500559_0000736 Ga0500559_0000736_7810_8526 223
11 3300048929 Ga0496126_0158651 Ga0496126_0158651_62_790 224
12 3300044765 Ga0466970_0005495 Ga0466970_0005495_4498_5220 226
13 3300044842 Ga0466957_0051899 Ga0466957_0051899_72_791 227
14 3300049741 Ga0501079_0265129 Ga0501079_0265129_624_1316 227
15 3300049588 Ga0501072_0008500 Ga0501072_0008500_6953_7663 228
16 3300005563 Ga0068855_100181869 Ga0068855_1001818693 231
17 3300025949 Ga0207667_10152150 Ga0207667_101521503 231
18 3300031901 Ga0307406_10558964 Ga0307406_105589642 231
19 3300044901 Ga0466960_0290263 Ga0466960_0290263_131_841 231
20 iso_pu_bacteria 2767802112 2768645565 231
21 iso_pu_bacteria 2773857758 2774378821 231
22 iso_pu_bacteria 2808606306 2808629491 231
23 iso_pu_bacteria 2852646457 2852647706 231
24 iso_pu_bacteria 2884693830 2884702131 231
25 iso_pu_bacteria 2895442618 2895445327 231
26 iso_pu_bacteria 2908678064 2908678504 231
27 iso_pu_bacteria 2919069694 2919070825 231
28 iso_pu_bacteria 2977264416 2977265628 231
29 iso_pu_bacteria 2984580707 2984581648 231
30 iso_pu_bacteria 2995463766 2995464371 231
31 iso_pu_bacteria 3002998708 3003005711 231
32 iso_pu_bacteria 2643221542 2643732693 232
33 iso_pu_bacteria 2643221549 2643769359 232
34 iso_pu_bacteria 2643221553 2643785025 232
35 iso_pu_bacteria 2643221572 2643874861 232
36 iso_pu_bacteria 2643221619 2644113977 232
37 iso_pu_bacteria 2643221630 2644171496 232
38 iso_pu_bacteria 2643221649 2644277079 232
39 iso_pu_bacteria 2643221669 2644381917 232
40 iso_pu_bacteria 2643221724 2644680931 232
41 iso_pu_bacteria 2643221961 2645722503 232
42 iso_pu_bacteria 2675903059 2676483649 232
43 iso_pu_bacteria 2721755702 2723642656 232
44 iso_pu_bacteria 2728369380 2730230636 232
45 iso_pu_bacteria 2773857763 2774398543 232
46 iso_pu_bacteria 2808606368 2808886235 232
47 iso_pu_bacteria 2811994872 2812322868 232
48 iso_pu_bacteria 2821268502 2821269773 232
49 iso_pu_bacteria 2833709550 2833710694 232
50 iso_pu_bacteria 2852663356 2852663954 232
51 iso_pu_bacteria 2857723135 2857726199 232
52 iso_pu_bacteria 2895660088 2895660956 232
53 iso_pu_bacteria 2919051321 2919054576 232
54 iso_pu_bacteria 2919443155 2919443229 232
55 iso_pu_bacteria 2929219909 2929221902 232
56 iso_pu_bacteria 2935409751 2935413190 232
57 iso_pu_bacteria 2946080515 2946083920 232
58 iso_pu_bacteria 2966924647 2966925713 232
59 iso_pu_bacteria 8003870546 8003874046 232
60 iso_pu_bacteria 8004182704 8004184418 232
61 iso_pu_bacteria 8045830549 8045834284 232
62 iso_pu_bacteria 8057345674 8057346901 232
63 3300005548 Ga0070665_100346632 Ga0070665_1003466322 233
64 3300025932 Ga0207690_10325392 Ga0207690_103253921 233
65 3300028379 Ga0268266_10297371 Ga0268266_102973712 233
66 3300005340 Ga0070689_100282369 Ga0070689_1002823692 235
67 3300005345 Ga0070692_10071287 Ga0070692_100712873 235
68 3300005354 Ga0070675_100439656 Ga0070675_1004396561 235
69 3300005356 Ga0070674_100155622 Ga0070674_1001556222 235
70 3300005356 Ga0070674_100166059 Ga0070674_1001660592 235
71 3300005365 Ga0070688_100028574 Ga0070688_1000285745 235
72 3300005441 Ga0070700_100100555 Ga0070700_1001005552 235
73 3300005444 Ga0070694_100840600 Ga0070694_1008406001 235
74 3300005455 Ga0070663_100789365 Ga0070663_1007893651 235
75 3300005459 Ga0068867_100153703 Ga0068867_1001537033 235
76 3300005530 Ga0070679_100529705 Ga0070679_1005297052 235
77 3300005535 Ga0070684_100359226 Ga0070684_1003592262 235
78 3300005543 Ga0070672_100058814 Ga0070672_1000588142 235
79 3300005544 Ga0070686_100057302 Ga0070686_1000573022 235
80 3300005564 Ga0070664_100041887 Ga0070664_1000418873 235
81 3300005616 Ga0068852_100195241 Ga0068852_1001952412 235
82 3300005617 Ga0068859_100644218 Ga0068859_1006442182 235
83 3300005842 Ga0068858_100188320 Ga0068858_1001883202 235
84 3300006051 Ga0075364_10195910 Ga0075364_101959102 235
85 3300006881 Ga0068865_100668275 Ga0068865_1006682751 235
86 3300006931 Ga0097620_100644209 Ga0097620_1006442092 235
87 3300009094 Ga0111539_10023778 Ga0111539_100237786 235
88 3300009148 Ga0105243_10108490 Ga0105243_101084902 235
89 3300009148 Ga0105243_10160738 Ga0105243_101607381 235
90 3300009551 Ga0105238_10270739 Ga0105238_102707392 235
91 3300009553 Ga0105249_10478526 Ga0105249_104785262 235
92 3300010375 Ga0105239_10231826 Ga0105239_102318261 235
93 3300011119 Ga0105246_10776099 Ga0105246_107760991 235
94 3300013296 Ga0157374_10504184 Ga0157374_105041842 235
95 3300013297 Ga0157378_10117333 Ga0157378_101173332 235
96 3300013306 Ga0163162_10444438 Ga0163162_104444382 235
97 3300013308 Ga0157375_10573957 Ga0157375_105739571 235
98 3300014325 Ga0163163_10250958 Ga0163163_102509582 235
99 3300014326 Ga0157380_10182890 Ga0157380_101828902 235
100 3300014745 Ga0157377_10057778 Ga0157377_100577783 235
101 3300014968 Ga0157379_10880716 Ga0157379_108807161 235
102 3300025901 Ga0207688_10324349 Ga0207688_103243492 235
103 3300025908 Ga0207643_10187581 Ga0207643_101875812 235
104 3300025918 Ga0207662_10121337 Ga0207662_101213372 235
105 3300025935 Ga0207709_10306009 Ga0207709_103060091 235
106 3300025937 Ga0207669_10069499 Ga0207669_100694993 235
107 3300025938 Ga0207704_10601256 Ga0207704_106012561 235
108 3300025944 Ga0207661_10344203 Ga0207661_103442032 235
109 3300025986 Ga0207658_10631032 Ga0207658_106310322 235
110 3300026067 Ga0207678_10237972 Ga0207678_102379722 235
111 3300026075 Ga0207708_10091905 Ga0207708_100919054 235
112 3300026089 Ga0207648_10104417 Ga0207648_101044172 235
113 3300026116 Ga0207674_10017568 Ga0207674_100175688 235
114 3300026118 Ga0207675_100318926 Ga0207675_1003189262 235
115 3300027907 Ga0207428_10260880 Ga0207428_102608802 235
116 3300028379 Ga0268266_10540317 Ga0268266_105403172 235
117 3300031456 Ga0307513_10116836 Ga0307513_101168363 235
118 3300042008 Ga0439450_014019 Ga0439450_014019_819_1538 235
119 3300045976 Ga0466967_0190544 Ga0466967_0190544_1174_1881 235
120 3300045976 Ga0466967_0739432 Ga0466967_0739432_237_944 235
121 3300048911 Ga0496108_0161759 Ga0496108_0161759_289_1002 235
122 3300048912 Ga0496109_0370793 Ga0496109_0370793_274_987 235
123 3300048921 Ga0496118_0012162 Ga0496118_0012162_5713_6420 235
124 3300048922 Ga0496119_0117176 Ga0496119_0117176_573_1286 235
125 3300049582 Ga0501048_0208004 Ga0501048_0208004_192_905 235
126 3300049824 Ga0501045_0373786 Ga0501045_0373786_127_840 235
127 3300050511 nmdc:mga08y16_608601_c1 nmdc:mga08y16_608601_c1_61_774 235
128 3300053140 Ga0500573_0000031 Ga0500573_0000031_48112_48819 235
129 3300002738 JGI25154J39366_1005749 JGI25154J39366_10057492 236
130 3300003320 rootH2_10035408 rootH2_100354082 236
131 3300003322 rootL2_10279124 rootL2_102791242 236
132 3300003578 Ga0006562J51391_1026926 Ga0006562J51391_10269267 236
133 3300003578 Ga0006562J51391_1026931 Ga0006562J51391_10269313 236
134 3300005327 Ga0070658_10010239 Ga0070658_100102392 236
135 3300005327 Ga0070658_10032539 Ga0070658_100325395 236
136 3300005327 Ga0070658_10058294 Ga0070658_100582942 236
137 3300005329 Ga0070683_100477724 Ga0070683_1004777242 236
138 3300005338 Ga0068868_100010682 Ga0068868_1000106822 236
139 3300005339 Ga0070660_100479915 Ga0070660_1004799152 236
140 3300005344 Ga0070661_100350234 Ga0070661_1003502342 236
141 3300005355 Ga0070671_100046268 Ga0070671_1000462682 236
142 3300005366 Ga0070659_100000468 Ga0070659_10000046823 236
143 3300005367 Ga0070667_100170491 Ga0070667_1001704911 236
144 3300005434 Ga0070709_10001367 Ga0070709_1000136711 236
145 3300005435 Ga0070714_100020381 Ga0070714_1000203812 236
146 3300005437 Ga0070710_10003338 Ga0070710_100033386 236
147 3300005439 Ga0070711_100033408 Ga0070711_1000334083 236
148 3300005459 Ga0068867_100348933 Ga0068867_1003489331 236
149 3300005466 Ga0070685_10000654 Ga0070685_100006545 236
150 3300005539 Ga0068853_100017331 Ga0068853_1000173313 236
151 3300005563 Ga0068855_100033650 Ga0068855_1000336502 236
152 3300005563 Ga0068855_100133317 Ga0068855_1001333174 236
153 3300005563 Ga0068855_100445115 Ga0068855_1004451152 236
154 3300005563 Ga0068855_100490305 Ga0068855_1004903052 236
155 3300005563 Ga0068855_100822610 Ga0068855_1008226101 236
156 3300005577 Ga0068857_100006718 Ga0068857_1000067188 236
157 3300005578 Ga0068854_100451210 Ga0068854_1004512102 236
158 3300005614 Ga0068856_100052177 Ga0068856_1000521772 236
159 3300005614 Ga0068856_100550896 Ga0068856_1005508962 236
160 3300005615 Ga0070702_100166490 Ga0070702_1001664902 236
161 3300005616 Ga0068852_100008145 Ga0068852_1000081453 236
162 3300005616 Ga0068852_100018621 Ga0068852_1000186214 236
163 3300005616 Ga0068852_100063387 Ga0068852_1000633872 236
164 3300005618 Ga0068864_100025808 Ga0068864_1000258084 236
165 3300005618 Ga0068864_100104172 Ga0068864_1001041722 236
166 3300005834 Ga0068851_10000001 Ga0068851_1000000155 236
167 3300005841 Ga0068863_100213458 Ga0068863_1002134583 236
168 3300005842 Ga0068858_100000016 Ga0068858_100000016114 236
169 3300005937 Ga0081455_10001637 Ga0081455_1000163718 236
170 3300005937 Ga0081455_10012836 Ga0081455_100128362 236
171 3300006038 Ga0075365_10016678 Ga0075365_100166784 236
172 3300006038 Ga0075365_10329304 Ga0075365_103293041 236
173 3300006051 Ga0075364_10008851 Ga0075364_100088514 236
174 3300006051 Ga0075364_10093030 Ga0075364_100930302 236
175 3300006051 Ga0075364_10374642 Ga0075364_103746422 236
176 3300006163 Ga0070715_10051517 Ga0070715_100515172 236
177 3300006173 Ga0070716_100004107 Ga0070716_1000041075 236
178 3300006175 Ga0070712_100018022 Ga0070712_1000180224 236
179 3300006186 Ga0075369_10007022 Ga0075369_100070224 236
180 3300007076 Ga0075435_100434546 Ga0075435_1004345462 236
181 3300009093 Ga0105240_10021811 Ga0105240_100218117 236
182 3300009101 Ga0105247_10012472 Ga0105247_100124725 236
183 3300009148 Ga0105243_10097892 Ga0105243_100978922 236
184 3300009174 Ga0105241_10132132 Ga0105241_101321322 236
185 3300009174 Ga0105241_10482387 Ga0105241_104823872 236
186 3300009177 Ga0105248_10000366 Ga0105248_1000036642 236
187 3300009177 Ga0105248_10042104 Ga0105248_100421044 236
188 3300009545 Ga0105237_10006078 Ga0105237_1000607814 236
189 3300009545 Ga0105237_10207383 Ga0105237_102073832 236
190 3300009545 Ga0105237_10435028 Ga0105237_104350282 236
191 3300009551 Ga0105238_10002701 Ga0105238_100027013 236
192 3300009551 Ga0105238_10373666 Ga0105238_103736662 236
193 3300010375 Ga0105239_10129234 Ga0105239_101292342 236
194 3300010375 Ga0105239_10174532 Ga0105239_101745322 236
195 3300010375 Ga0105239_10408799 Ga0105239_104087991 236
196 3300011119 Ga0105246_10078550 Ga0105246_100785502 236
197 3300013105 Ga0157369_10072382 Ga0157369_100723823 236
198 3300013250 Ga0171462_1004 Ga0171462_1004465 236
199 3300013296 Ga0157374_10021634 Ga0157374_100216347 236
200 3300013306 Ga0163162_10037398 Ga0163162_100373982 236
201 3300013308 Ga0157375_10276059 Ga0157375_102760592 236
202 3300014325 Ga0163163_10023270 Ga0163163_100232704 236
203 3300014325 Ga0163163_10023605 Ga0163163_100236053 236
204 3300014326 Ga0157380_10041942 Ga0157380_100419422 236
205 3300014968 Ga0157379_10015256 Ga0157379_100152568 236
206 3300014968 Ga0157379_10027288 Ga0157379_100272882 236
207 3300014969 Ga0157376_10628913 Ga0157376_106289131 236
208 3300020077 Ga0206351_11016496 Ga0206351_110164962 236
209 3300020082 Ga0206353_10652235 Ga0206353_106522351 236
210 3300025246 Ga0209646_1000013 Ga0209646_1000013399 236
211 3300025246 Ga0209646_1000014 Ga0209646_1000014192 236
212 3300025321 Ga0207656_10000005 Ga0207656_10000005444 236
213 3300025898 Ga0207692_10014149 Ga0207692_100141493 236
214 3300025900 Ga0207710_10012760 Ga0207710_100127605 236
215 3300025909 Ga0207705_10000001 Ga0207705_100000011681 236
216 3300025909 Ga0207705_10021833 Ga0207705_100218333 236
217 3300025911 Ga0207654_10000001 Ga0207654_100000011004 236
218 3300025913 Ga0207695_10003316 Ga0207695_1000331612 236
219 3300025913 Ga0207695_10023069 Ga0207695_100230695 236
220 3300025914 Ga0207671_10000016 Ga0207671_1000001614 236
221 3300025919 Ga0207657_10064263 Ga0207657_100642634 236
222 3300025920 Ga0207649_10121904 Ga0207649_101219042 236
223 3300025924 Ga0207694_10000022 Ga0207694_1000002216 236
224 3300025924 Ga0207694_10260068 Ga0207694_102600681 236
225 3300025926 Ga0207659_10215771 Ga0207659_102157712 236
226 3300025928 Ga0207700_10006078 Ga0207700_100060786 236
227 3300025929 Ga0207664_10002462 Ga0207664_100024622 236
228 3300025932 Ga0207690_10007391 Ga0207690_100073918 236
229 3300025935 Ga0207709_10054722 Ga0207709_100547223 236
230 3300025939 Ga0207665_10006662 Ga0207665_100066626 236
231 3300025939 Ga0207665_10040177 Ga0207665_100401774 236
232 3300025940 Ga0207691_10254213 Ga0207691_102542132 236
233 3300025940 Ga0207691_10696537 Ga0207691_106965371 236
234 3300025941 Ga0207711_10002007 Ga0207711_1000200716 236
235 3300025941 Ga0207711_10024716 Ga0207711_100247165 236
236 3300025941 Ga0207711_10053568 Ga0207711_100535685 236
237 3300025949 Ga0207667_10009682 Ga0207667_100096824 236
238 3300025949 Ga0207667_10032898 Ga0207667_100328985 236
239 3300025949 Ga0207667_10186489 Ga0207667_101864892 236
240 3300025949 Ga0207667_11002724 Ga0207667_110027241 236
241 3300025981 Ga0207640_10252296 Ga0207640_102522962 236
242 3300025986 Ga0207658_10146872 Ga0207658_101468723 236
243 3300026023 Ga0207677_10042805 Ga0207677_100428053 236
244 3300026035 Ga0207703_10000075 Ga0207703_1000007550 236
245 3300026041 Ga0207639_10011644 Ga0207639_100116448 236
246 3300026067 Ga0207678_10234599 Ga0207678_102345992 236
247 3300026078 Ga0207702_10047043 Ga0207702_100470432 236
248 3300026088 Ga0207641_10192067 Ga0207641_101920674 236
249 3300026095 Ga0207676_10034966 Ga0207676_100349664 236
250 3300026095 Ga0207676_10057373 Ga0207676_100573735 236
251 3300026116 Ga0207674_10023075 Ga0207674_100230754 236
252 3300026116 Ga0207674_10218618 Ga0207674_102186183 236
253 3300026116 Ga0207674_10606866 Ga0207674_106068662 236
254 3300026118 Ga0207675_100129741 Ga0207675_1001297412 236
255 3300026142 Ga0207698_10001420 Ga0207698_100014209 236
256 3300026142 Ga0207698_10001474 Ga0207698_1000147412 236
257 3300026142 Ga0207698_10064674 Ga0207698_100646745 236
258 3300028379 Ga0268266_10291866 Ga0268266_102918662 236
259 3300031247 Ga0265340_10006120 Ga0265340_100061206 236
260 3300031507 Ga0307509_10122663 Ga0307509_101226632 236
261 3300031548 Ga0307408_100050562 Ga0307408_1000505622 236
262 3300031824 Ga0307413_10479384 Ga0307413_104793842 236
263 3300031901 Ga0307406_10000031 Ga0307406_1000003130 236
264 3300031901 Ga0307406_10012526 Ga0307406_100125264 236
265 3300031901 Ga0307406_10025710 Ga0307406_100257104 236
266 3300031901 Ga0307406_10095157 Ga0307406_100951571 236
267 3300031901 Ga0307406_10171807 Ga0307406_101718072 236
268 3300031901 Ga0307406_10379541 Ga0307406_103795411 236
269 3300031901 Ga0307406_10736705 Ga0307406_107367051 236
270 3300031911 Ga0307412_10067849 Ga0307412_100678492 236
271 3300031995 Ga0307409_100458519 Ga0307409_1004585192 236
272 3300032002 Ga0307416_100108211 Ga0307416_1001082112 236
273 3300032002 Ga0307416_100595526 Ga0307416_1005955262 236
274 3300032002 Ga0307416_100729854 Ga0307416_1007298542 236
275 3300032004 Ga0307414_10007544 Ga0307414_100075444 236
276 3300032004 Ga0307414_10467091 Ga0307414_104670911 236
277 3300032126 Ga0307415_100291146 Ga0307415_1002911461 236
278 3300035725 Ga0373947_0230350 Ga0373947_0230350_424_1140 236
279 3300037418 Ga0395900_0039612 Ga0395900_0039612_199_918 236
280 3300037418 Ga0395900_0635351 Ga0395900_0635351_32_781 236
281 3300037466 Ga0395898_0133714 Ga0395898_0133714_200_913 236
282 3300037471 Ga0395905_0178811 Ga0395905_0178811_560_1309 236
283 3300041451 Ga0451791_0451102 Ga0451791_0451102_1044_1763 236
284 3300041512 Ga0451853_1463364 Ga0451853_1463364_498_1217 236
285 3300042007 Ga0439449_0112764 Ga0439449_0112764_83_796 236
286 3300042016 Ga0439463_001677 Ga0439463_001677_2965_3687 236
287 3300042142 Ga0450905_017826 Ga0450905_017826_177_899 236
288 3300044683 Ga0466965_0167350 Ga0466965_0167350_235_996 236
289 3300044694 Ga0466963_0342207 Ga0466963_0342207_272_991 236
290 3300044706 Ga0466964_0311265 Ga0466964_0311265_11_736 236
291 3300044901 Ga0466960_0077498 Ga0466960_0077498_111_836 236
292 3300044901 Ga0466960_0103863 Ga0466960_0103863_206_919 236
293 3300044901 Ga0466960_0235615 Ga0466960_0235615_236_946 236
294 3300045976 Ga0466967_0175139 Ga0466967_0175139_751_1470 236
295 3300046453 Ga0495627_000261 Ga0495627_000261_46721_47437 236
296 3300046454 Ga0495592_0124568 Ga0495592_0124568_614_1327 236
297 3300046459 Ga0495629_0157939 Ga0495629_0157939_214_930 236
298 3300046460 Ga0495638_0200690 Ga0495638_0200690_22_747 236
299 3300046462 Ga0495651_0008171 Ga0495651_0008171_4222_4935 236
300 3300046463 Ga0495653_0073472 Ga0495653_0073472_347_1060 236
301 3300046472 Ga0495580_0201312 Ga0495580_0201312_255_971 236
302 3300046476 Ga0495662_0000835 Ga0495662_0000835_2989_3702 236
303 3300046477 Ga0495664_0069796 Ga0495664_0069796_68_781 236
304 3300046511 Ga0495608_0023207 Ga0495608_0023207_1911_2624 236
305 3300046512 Ga0495610_0089488 Ga0495610_0089488_127_852 236
306 3300046514 Ga0495618_0197244 Ga0495618_0197244_453_1166 236
307 3300046517 Ga0495630_0016342 Ga0495630_0016342_1492_2205 236
308 3300046526 Ga0495666_0001138 Ga0495666_0001138_11289_12002 236
309 3300046529 Ga0495652_0069465 Ga0495652_0069465_632_1345 236
310 3300046531 Ga0495665_0006538 Ga0495665_0006538_3545_4258 236
311 3300046533 Ga0495640_0021254 Ga0495640_0021254_2060_2773 236
312 3300046533 Ga0495640_0028693 Ga0495640_0028693_1031_1744 236
313 3300046535 Ga0495586_0005335 Ga0495586_0005335_1861_2574 236
314 3300046543 Ga0495645_0027019 Ga0495645_0027019_3000_3713 236
315 3300046642 Ga0495634_0038965 Ga0495634_0038965_1237_1950 236
316 3300046675 Ga0495657_0017803 Ga0495657_0017803_2836_3549 236
317 3300046679 Ga0495623_0244261 Ga0495623_0244261_80_793 236
318 3300046683 Ga0495658_0299781 Ga0495658_0299781_117_947 236
319 3300046692 Ga0495671_0210313 Ga0495671_0210313_144_854 236
320 3300046809 Ga0495600_0143967 Ga0495600_0143967_484_1197 236
321 3300047315 Ga0495581_0038477 Ga0495581_0038477_1773_2486 236
322 3300047317 Ga0495604_0002933 Ga0495604_0002933_7392_8105 236
323 3300047317 Ga0495604_0093861 Ga0495604_0093861_1461_2174 236
324 3300047319 Ga0495674_0013078 Ga0495674_0013078_2219_2932 236
325 3300047444 Ga0495675_0018606 Ga0495675_0018606_2945_3658 236
326 3300047471 Ga0495684_0077748 Ga0495684_0077748_202_915 236
327 3300047673 Ga0495593_0031468 Ga0495593_0031468_2145_2858 236
328 3300048088 Ga0495602_0055930 Ga0495602_0055930_1732_2445 236
329 3300048904 Ga0496101_0035358 Ga0496101_0035358_1502_2251 236
330 3300048904 Ga0496101_0112961 Ga0496101_0112961_443_1156 236
331 3300048905 Ga0496102_0025335 Ga0496102_0025335_4020_4733 236
332 3300048905 Ga0496102_0503616 Ga0496102_0503616_19_738 236
333 3300048906 Ga0496103_0020149 Ga0496103_0020149_2246_2995 236
334 3300048906 Ga0496103_0321033 Ga0496103_0321033_133_846 236
335 3300048907 Ga0496104_0005368 Ga0496104_0005368_4555_5268 236
336 3300048907 Ga0496104_0174567 Ga0496104_0174567_13_762 236
337 3300048908 Ga0496105_0289150 Ga0496105_0289150_460_1173 236
338 3300048909 Ga0496106_0154777 Ga0496106_0154777_864_1583 236
339 3300048909 Ga0496106_0196899 Ga0496106_0196899_769_1482 236
340 3300048910 Ga0496107_0121585 Ga0496107_0121585_746_1495 236
341 3300048911 Ga0496108_0013624 Ga0496108_0013624_3346_4059 236
342 3300048911 Ga0496108_0031926 Ga0496108_0031926_2322_3035 236
343 3300048911 Ga0496108_0086867 Ga0496108_0086867_1684_2403 236
344 3300048911 Ga0496108_0212349 Ga0496108_0212349_688_1437 236
345 3300048912 Ga0496109_0009855 Ga0496109_0009855_2970_3683 236
346 3300048912 Ga0496109_0026768 Ga0496109_0026768_52_765 236
347 3300048912 Ga0496109_0763553 Ga0496109_0763553_146_871 236
348 3300048913 Ga0496110_0001722 Ga0496110_0001722_11574_12287 236
349 3300048913 Ga0496110_0003665 Ga0496110_0003665_8532_9245 236
350 3300048914 Ga0496111_0003973 Ga0496111_0003973_6366_7079 236
351 3300048914 Ga0496111_0030068 Ga0496111_0030068_2142_2891 236
352 3300048914 Ga0496111_0046827 Ga0496111_0046827_970_1689 236
353 3300048914 Ga0496111_0308735 Ga0496111_0308735_310_1023 236
354 3300048915 Ga0496112_0023186 Ga0496112_0023186_3017_3730 236
355 3300048915 Ga0496112_0090699 Ga0496112_0090699_2176_2925 236
356 3300048916 Ga0496113_0011584 Ga0496113_0011584_4768_5481 236
357 3300048916 Ga0496113_0607895 Ga0496113_0607895_79_798 236
358 3300048917 Ga0496114_0001454 Ga0496114_0001454_14124_14843 236
359 3300048917 Ga0496114_0111033 Ga0496114_0111033_669_1388 236
360 3300048917 Ga0496114_0151910 Ga0496114_0151910_304_1020 236
361 3300048920 Ga0496117_0000466 Ga0496117_0000466_42279_42989 236
362 3300048920 Ga0496117_0047699 Ga0496117_0047699_495_1214 236
363 3300048920 Ga0496117_0094734 Ga0496117_0094734_203_925 236
364 3300048921 Ga0496118_0037745 Ga0496118_0037745_913_1635 236
365 3300048921 Ga0496118_0054555 Ga0496118_0054555_427_1146 236
366 3300048922 Ga0496119_0002891 Ga0496119_0002891_11086_11808 236
367 3300048922 Ga0496119_0002893 Ga0496119_0002893_15498_16211 236
368 3300048922 Ga0496119_0009534 Ga0496119_0009534_7174_7896 236
369 3300048922 Ga0496119_0040161 Ga0496119_0040161_65_814 236
370 3300048923 Ga0496120_0000257 Ga0496120_0000257_32954_33676 236
371 3300048923 Ga0496120_0067147 Ga0496120_0067147_62_784 236
372 3300048925 Ga0496122_0090309 Ga0496122_0090309_91_801 236
373 3300048925 Ga0496122_0145953 Ga0496122_0145953_330_1049 236
374 3300048927 Ga0496124_0436737 Ga0496124_0436737_105_824 236
375 3300048928 Ga0496125_0011379 Ga0496125_0011379_7408_8118 236
376 3300048928 Ga0496125_0016046 Ga0496125_0016046_4224_4934 236
377 3300048928 Ga0496125_0021871 Ga0496125_0021871_1862_2572 236
378 3300048928 Ga0496125_0232904 Ga0496125_0232904_375_1097 236
379 3300048929 Ga0496126_0001669 Ga0496126_0001669_231_956 236
380 3300048929 Ga0496126_0001734 Ga0496126_0001734_11259_11969 236
381 3300048929 Ga0496126_0377401 Ga0496126_0377401_195_917 236
382 3300049568 Ga0501031_0016322 Ga0501031_0016322_160_879 236
383 3300049568 Ga0501031_0108469 Ga0501031_0108469_736_1455 236
384 3300049569 Ga0501032_0049337 Ga0501032_0049337_441_1160 236
385 3300049569 Ga0501032_0147707 Ga0501032_0147707_652_1371 236
386 3300049569 Ga0501032_0233252 Ga0501032_0233252_10_729 236
387 3300049570 Ga0501033_0009770 Ga0501033_0009770_6210_6929 236
388 3300049570 Ga0501033_0026929 Ga0501033_0026929_135_857 236
389 3300049570 Ga0501033_0127299 Ga0501033_0127299_923_1642 236
390 3300049570 Ga0501033_0249776 Ga0501033_0249776_345_1064 236
391 3300049571 Ga0501034_0008188 Ga0501034_0008188_10_729 236
392 3300049571 Ga0501034_0161596 Ga0501034_0161596_612_1331 236
393 3300049571 Ga0501034_0197438 Ga0501034_0197438_879_1598 236
394 3300049572 Ga0501036_0115830 Ga0501036_0115830_624_1343 236
395 3300049572 Ga0501036_0170899 Ga0501036_0170899_923_1642 236
396 3300049572 Ga0501036_0218188 Ga0501036_0218188_438_1157 236
397 3300049573 Ga0501037_0009202 Ga0501037_0009202_1280_1999 236
398 3300049573 Ga0501037_0105652 Ga0501037_0105652_844_1563 236
399 3300049573 Ga0501037_0236669 Ga0501037_0236669_296_1015 236
400 3300049573 Ga0501037_0280449 Ga0501037_0280449_246_956 236
401 3300049574 Ga0501038_0066240 Ga0501038_0066240_1977_2696 236
402 3300049574 Ga0501038_0143376 Ga0501038_0143376_219_938 236
403 3300049574 Ga0501038_0146406 Ga0501038_0146406_598_1317 236
404 3300049574 Ga0501038_0166765 Ga0501038_0166765_511_1227 236
405 3300049575 Ga0501039_0493678 Ga0501039_0493678_71_790 236
406 3300049575 Ga0501039_0533491 Ga0501039_0533491_121_834 236
407 3300049576 Ga0501040_0417833 Ga0501040_0417833_43_783 236
408 3300049578 Ga0501042_0407694 Ga0501042_0407694_13_729 236
409 3300049579 Ga0501043_0070893 Ga0501043_0070893_42_761 236
410 3300049579 Ga0501043_0120617 Ga0501043_0120617_412_1134 236
411 3300049580 Ga0501046_0011498 Ga0501046_0011498_1568_2287 236
412 3300049580 Ga0501046_0105154 Ga0501046_0105154_54_776 236
413 3300049580 Ga0501046_0229223 Ga0501046_0229223_277_996 236
414 3300049581 Ga0501047_0001859 Ga0501047_0001859_14665_15384 236
415 3300049581 Ga0501047_0006372 Ga0501047_0006372_7413_8135 236
416 3300049581 Ga0501047_0079831 Ga0501047_0079831_1809_2528 236
417 3300049581 Ga0501047_0135623 Ga0501047_0135623_880_1599 236
418 3300049582 Ga0501048_0005523 Ga0501048_0005523_3001_3720 236
419 3300049585 Ga0501069_0106228 Ga0501069_0106228_160_879 236
420 3300049586 Ga0501070_0077037 Ga0501070_0077037_279_998 236
421 3300049586 Ga0501070_0228625 Ga0501070_0228625_721_1440 236
422 3300049586 Ga0501070_0354245 Ga0501070_0354245_29_751 236
423 3300049587 Ga0501071_0041248 Ga0501071_0041248_48_806 236
424 3300049589 Ga0501073_0000030 Ga0501073_0000030_49040_49753 236
425 3300049589 Ga0501073_0131270 Ga0501073_0131270_433_1152 236
426 3300049589 Ga0501073_0198510 Ga0501073_0198510_127_846 236
427 3300049590 Ga0501074_0017719 Ga0501074_0017719_242_961 236
428 3300049590 Ga0501074_0142935 Ga0501074_0142935_597_1313 236
429 3300049591 Ga0501075_0088543 Ga0501075_0088543_1205_1915 236
430 3300049592 Ga0501076_0145792 Ga0501076_0145792_1009_1719 236
431 3300049592 Ga0501076_0357917 Ga0501076_0357917_456_1175 236
432 3300049592 Ga0501076_0480384 Ga0501076_0480384_259_969 236
433 3300049742 Ga0501080_0086845 Ga0501080_0086845_181_897 236
434 3300049744 Ga0501083_0038608 Ga0501083_0038608_2461_3183 236
435 3300049822 Ga0501035_0020822 Ga0501035_0020822_1512_2231 236
436 3300049822 Ga0501035_0025378 Ga0501035_0025378_3945_4667 236
437 3300049822 Ga0501035_0118938 Ga0501035_0118938_505_1224 236
438 3300049822 Ga0501035_0130254 Ga0501035_0130254_853_1572 236
439 3300049822 Ga0501035_0152121 Ga0501035_0152121_419_1138 236
440 3300049822 Ga0501035_0168090 Ga0501035_0168090_238_957 236
441 3300049823 Ga0501044_0014885 Ga0501044_0014885_3932_4654 236
442 3300049823 Ga0501044_0023642 Ga0501044_0023642_879_1598 236
443 3300049823 Ga0501044_0059103 Ga0501044_0059103_1747_2466 236
444 3300049823 Ga0501044_0180869 Ga0501044_0180869_1212_1928 236
445 3300049823 Ga0501044_0182997 Ga0501044_0182997_912_1631 236
446 3300049823 Ga0501044_0189754 Ga0501044_0189754_880_1599 236
447 3300049823 Ga0501044_0283285 Ga0501044_0283285_571_1293 236
448 3300049823 Ga0501044_0892045 Ga0501044_0892045_35_748 236
449 3300049824 Ga0501045_0049970 Ga0501045_0049970_435_1154 236
450 3300049824 Ga0501045_0295295 Ga0501045_0295295_89_805 236
451 3300049824 Ga0501045_0428054 Ga0501045_0428054_84_794 236
452 3300050491 nmdc:mga00v17_16050_c1 nmdc:mga00v17_16050_c1_1032_1742 236
453 3300050491 nmdc:mga00v17_28713_c1 nmdc:mga00v17_28713_c1_1370_2083 236
454 3300050491 nmdc:mga00v17_375834_c1 nmdc:mga00v17_375834_c1_161_871 236
455 3300050492 nmdc:mga0yw44_26725_c1 nmdc:mga0yw44_26725_c1_749_1462 236
456 3300050516 nmdc:mga0sz30_18584_c1 nmdc:mga0sz30_18584_c1_775_1488 236
457 3300053077 Ga0495601_0051946 Ga0495601_0051946_1216_1929 236
458 3300053085 Ga0495619_0143132 Ga0495619_0143132_736_1449 236
459 3300053087 Ga0500643_000325 Ga0500643_000325_26375_27103 236
460 3300053093 Ga0500651_0000383 Ga0500651_0000383_21548_22270 236
461 3300053136 Ga0500559_0001408 Ga0500559_0001408_10439_11149 236
462 3300053140 Ga0500573_0036783 Ga0500573_0036783_983_1693 236
463 3300053140 Ga0500573_0053588 Ga0500573_0053588_824_1540 236
464 3300053142 Ga0500577_0001521 Ga0500577_0001521_273_995 236
465 3300053148 Ga0500590_040928 Ga0500590_040928_823_1536 236
466 3300053155 Ga0500620_001788 Ga0500620_001788_202_924 236
467 3300054114 Ga0501084_0277307 Ga0501084_0277307_584_1294 236
468 3300060353 Ga0501082_0158948 Ga0501082_0158948_411_1121 236
469 3300060353 Ga0501082_0495924 Ga0501082_0495924_20_739 236
470 3300061734 Ga0530510_0281136 Ga0530510_0281136_221_973 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

48

255

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.7789 7 217
6dq2-assembly1.cif.gz_A cronobacter sakazakii (enterobacter sakazakii) metallo-beta-lactamse harldq motif mutant s60 0.7785 1 216
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.7767 15 222
1qh5-assembly1.cif.gz_B human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione 0.7742 1 217
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.7732 7 217
ID Description Score Start End Superfamily
af_O86336_13_270_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8682 1 235 3.60.15.10
af_O86336_13_270_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8613 1 235 3.60.15.10
af_Q9UT36_7_256_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7851 11 217 3.60.15.10
af_Q95Q18_3_200_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7773 1 220 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7773 7 217 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2Y9AQV1-F1-model_v4 Glyoxylase, beta-lactamase superfamily II 1.002 1 234
AF-A0A7W9CAV4-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 1 1 233 GO:0016787
AF-A0A5C4VN22-F1-model_v4 MBL fold metallo-hydrolase 0.9974 1 234 GO:0016787
AF-A0A5J6L196-F1-model_v4 MBL fold metallo-hydrolase 0.997 1 234 GO:0016787
AF-D6M5Z0-F1-model_v4 Metallo-beta-lactamase 0.9953 1 206

Feature Viewer

pLDDT pTM Quality
96.77 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map