F450481

General Info

Members Datasets Scaffolds Average Seq Length
470 205 468 299

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0000001|Ga0495668_0000001_446500_447390
Length 296
Sequence MTTAKADMLDQIKSGQGFIAALDQSGGSTPKALKGYGIGEDAFSNDEEMFGLIHDMRSRIVTAPCFNGEKVIGAILFERTMDGEADGKPVPALLWERGVVPFLKVDKGLEDEADGVQLMKPNPGLDDLCARAVAKGVFGTKMRSVVNLANAAGVKAIVEQQFAEAKRIAAHGLVPIIEPEVNIKSAERDGADRLLLQEITTALGSWDGAPVMLKLSLPAEAGLFQSLVDHPKVLRVVALSGGFARPEACVELAKNPGIIASFSRALLEDLRHQMSDDEFNASLGGAIKEIHAASVA

Samples

Sample ID Description Type Environment
1 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
2 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
202 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
203 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
204 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 3.62
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000050 3300001904 Bacteria 19452
2 JGI24736J21556_1002839 3300001904 Bacteria 3038
3 JGI24752J21851_1000063 3300001976 Bacteria 13680
4 JGI24740J21852_10007380 3300001979 Bacteria 4473
5 JGI24740J21852_10031029 3300001979 Bacteria 1729
6 JGI24737J22298_10001804 3300001990 Bacteria 7671
7 JGI24750J21931_1000405 3300002070 Bacteria 7195
8 JGI24748J21848_1000113 3300002074 Bacteria 16860
9 JGI24738J21930_10001588 3300002075 Bacteria 6258
10 JGI24749J21850_1000119 3300002076 Bacteria 13219
11 JGI24034J26672_10000034 3300002239 Bacteria 85929
12 JGI24742J22300_10000852 3300002244 Bacteria 4660
13 JGI24751J29686_10000280 3300002459 Bacteria 19840
14 JGI24751J29686_10002456 3300002459 Bacteria 3735
15 Ga0055536_1008468 3300003781 Bacteria 4412
16 Ga0065707_10085948 3300005295 Bacteria 5773
17 Ga0065707_10086498 3300005295 Bacteria 5431
18 Ga0070658_10034595 3300005327 Bacteria 4065
19 Ga0070658_10182099 3300005327 Bacteria 1768
20 Ga0070658_10281999 3300005327 Bacteria 1414
21 Ga0070676_10023913 3300005328 Bacteria 3437
22 Ga0070676_10052576 3300005328 Bacteria 2396
23 Ga0070683_100055813 3300005329 Bacteria 3666
24 Ga0070683_100058349 3300005329 Bacteria 3586
25 Ga0070690_100000068 3300005330 Bacteria 51626
26 Ga0070670_100000024 3300005331 Bacteria 189811
27 Ga0070670_100013695 3300005331 Bacteria 6950
28 Ga0070670_100023422 3300005331 Bacteria 5315
29 Ga0070670_100080450 3300005331 Bacteria 2800
30 Ga0070670_100154360 3300005331 Bacteria 1988
31 Ga0070670_100178438 3300005331 Bacteria 1843
32 Ga0068869_100093149 3300005334 Bacteria 2269
33 Ga0070666_10000002 3300005335 Bacteria 478684
34 Ga0070666_10002231 3300005335 Bacteria 11721
35 Ga0070666_10002277 3300005335 Bacteria 11602
36 Ga0070666_10015714 3300005335 Bacteria 4832
37 Ga0070666_10029943 3300005335 Bacteria 3582
38 Ga0070666_10039248 3300005335 Bacteria 3155
39 Ga0070680_100404648 3300005336 Bacteria 1163
40 Ga0070682_100078148 3300005337 Bacteria 2134
41 Ga0068868_100032573 3300005338 Bacteria 4011
42 Ga0068868_100059294 3300005338 Bacteria 3027
43 Ga0070660_100002041 3300005339 Bacteria 13932
44 Ga0070660_100135444 3300005339 Bacteria 1973
45 Ga0070660_100218596 3300005339 Bacteria 1548
46 Ga0070689_100002548 3300005340 Bacteria 11944
47 Ga0070661_100052323 3300005344 Bacteria 2989
48 Ga0070661_100060829 3300005344 Bacteria 2771
49 Ga0070661_100131753 3300005344 Bacteria 1878
50 Ga0070661_100176995 3300005344 Bacteria 1622
51 Ga0070692_10072251 3300005345 Bacteria 1840
52 Ga0070668_100065058 3300005347 Bacteria 2828
53 Ga0070669_100000047 3300005353 Bacteria 118892
54 Ga0070669_100000055 3300005353 Bacteria 111488
55 Ga0070669_100101229 3300005353 Bacteria 2174
56 Ga0070675_100132632 3300005354 Bacteria 2124
57 Ga0070675_100283251 3300005354 Bacteria 1457
58 Ga0070671_100003765 3300005355 Bacteria 11907
59 Ga0070671_100003919 3300005355 Bacteria 11703
60 Ga0070671_100004086 3300005355 Bacteria 11519
61 Ga0070671_100017964 3300005355 Bacteria 5737
62 Ga0070674_100105278 3300005356 Bacteria 2063
63 Ga0070673_100004341 3300005364 Bacteria 8954
64 Ga0070673_100257421 3300005364 Bacteria 1523
65 Ga0070688_100006989 3300005365 Bacteria 6065
66 Ga0070659_100026260 3300005366 Bacteria 4479
67 Ga0070659_100126604 3300005366 Bacteria 2072
68 Ga0070659_100135556 3300005366 Bacteria 2002
69 Ga0070659_100207399 3300005366 Bacteria 1614
70 Ga0070659_100425964 3300005366 Bacteria 1123
71 Ga0070667_100007536 3300005367 Bacteria 9028
72 Ga0070667_100007975 3300005367 Bacteria 8782
73 Ga0070667_100016730 3300005367 Bacteria 6070
74 Ga0070667_100028334 3300005367 Bacteria 4662
75 Ga0070667_100083646 3300005367 Bacteria 2734
76 Ga0070667_100168452 3300005367 Bacteria 1932
77 Ga0070713_100067864 3300005436 Bacteria 3004
78 Ga0070663_100019395 3300005455 Bacteria 4481
79 Ga0070663_100030722 3300005455 Bacteria 3685
80 Ga0070663_100265214 3300005455 Bacteria 1363
81 Ga0070678_100001675 3300005456 Bacteria 11874
82 Ga0070678_100003048 3300005456 Bacteria 9284
83 Ga0070678_100014022 3300005456 Bacteria 5040
84 Ga0070678_100081151 3300005456 Bacteria 2458
85 Ga0070662_100003498 3300005457 Bacteria 9794
86 Ga0070662_100010408 3300005457 Bacteria 6100
87 Ga0070662_100041431 3300005457 Bacteria 3285
88 Ga0070662_100167333 3300005457 Bacteria 1724
89 Ga0070681_10051860 3300005458 Bacteria 4091
90 Ga0068867_100072554 3300005459 Bacteria 2577
91 Ga0070685_10000337 3300005466 Bacteria 28829
92 Ga0070679_100185740 3300005530 Bacteria 2049
93 Ga0070684_100022302 3300005535 Bacteria 5278
94 Ga0070684_100282837 3300005535 Bacteria 1520
95 Ga0070684_100412808 3300005535 Bacteria 1246
96 Ga0068853_100071557 3300005539 Bacteria 3020
97 Ga0070672_100001974 3300005543 Bacteria 12842
98 Ga0070672_100026483 3300005543 Bacteria 4315
99 Ga0070686_100000003 3300005544 Bacteria 308397
100 Ga0070665_100000036 3300005548 Bacteria 314603
101 Ga0070665_100061780 3300005548 Bacteria 3756
102 Ga0070665_100064762 3300005548 Bacteria 3666
103 Ga0068855_100566300 3300005563 Bacteria 1228
104 Ga0070664_100011244 3300005564 Bacteria 7261
105 Ga0070664_100022722 3300005564 Bacteria 5172
106 Ga0070664_100023812 3300005564 Bacteria 5058
107 Ga0070664_100039375 3300005564 Bacteria 3983
108 Ga0070664_100062865 3300005564 Bacteria 3165
109 Ga0070664_100150247 3300005564 Bacteria 2056
110 Ga0068857_100009975 3300005577 Bacteria 8243
111 Ga0068857_100069795 3300005577 Bacteria 3129
112 Ga0068854_100006274 3300005578 Bacteria 7556
113 Ga0068854_100322726 3300005578 Bacteria 1256
114 Ga0068856_100062685 3300005614 Bacteria 3672
115 Ga0068856_100147399 3300005614 Bacteria 2361
116 Ga0068852_100000973 3300005616 Bacteria 18804
117 Ga0068852_100064100 3300005616 Bacteria 3202
118 Ga0068852_100072583 3300005616 Bacteria 3025
119 Ga0068859_100002070 3300005617 Bacteria 20476
120 Ga0068859_100082026 3300005617 Bacteria 3267
121 Ga0068864_100000036 3300005618 Bacteria 189811
122 Ga0068864_100005293 3300005618 Bacteria 10561
123 Ga0068864_100006618 3300005618 Bacteria 9483
124 Ga0068864_100008310 3300005618 Bacteria 8561
125 Ga0068864_100011993 3300005618 Bacteria 7156
126 Ga0068864_100024410 3300005618 Bacteria 5086
127 Ga0068864_100053440 3300005618 Bacteria 3485
128 Ga0068864_100130937 3300005618 Bacteria 2253
129 Ga0068861_100005435 3300005719 Bacteria 8623
130 Ga0068861_100093106 3300005719 Bacteria 2382
131 Ga0068851_10037225 3300005834 Bacteria 2438
132 Ga0068870_10148890 3300005840 Bacteria 1377
133 Ga0068863_100000034 3300005841 Bacteria 168359
134 Ga0068863_100002388 3300005841 Bacteria 18667
135 Ga0068863_100004012 3300005841 Bacteria 14535
136 Ga0068863_100006118 3300005841 Bacteria 11804
137 Ga0068863_100270233 3300005841 Bacteria 1646
138 Ga0068858_100011572 3300005842 Bacteria 8322
139 Ga0068858_100013052 3300005842 Bacteria 7835
140 Ga0068858_100040890 3300005842 Bacteria 4300
141 Ga0068860_100000001 3300005843 Bacteria 703043
142 Ga0068860_100029076 3300005843 Bacteria 5315
143 Ga0068860_100110864 3300005843 Bacteria 2623
144 Ga0068860_100112729 3300005843 Bacteria 2600
145 Ga0068860_100539211 3300005843 Bacteria 1168
146 Ga0068862_100000033 3300005844 Bacteria 176515
147 Ga0068862_100001230 3300005844 Bacteria 24152
148 Ga0081455_10002904 3300005937 Bacteria 20117
149 Ga0070716_100138673 3300006173 Bacteria 1548
150 Ga0097621_100022233 3300006237 Bacteria 4921
151 Ga0097621_100070851 3300006237 Bacteria 2879
152 Ga0097621_100188315 3300006237 Bacteria 1786
153 Ga0068871_100006708 3300006358 Bacteria 8171
154 Ga0097620_100002070 3300006931 Bacteria 20476
155 Ga0097620_100082031 3300006931 Bacteria 3267
156 Ga0105250_10009842 3300009092 Bacteria 4014
157 Ga0105245_10005641 3300009098 Bacteria 10996
158 Ga0105245_10297043 3300009098 Bacteria 1583
159 Ga0105247_10018127 3300009101 Bacteria 4223
160 Ga0105242_10006705 3300009176 Bacteria 8883
161 Ga0105248_10000091 3300009177 Bacteria 101191
162 Ga0105248_10000096 3300009177 Bacteria 97519
163 Ga0105248_10053785 3300009177 Bacteria 4517
164 Ga0105248_10173813 3300009177 Bacteria 2428
165 Ga0105248_10202777 3300009177 Bacteria 2235
166 Ga0105237_10058417 3300009545 Bacteria 3860
167 Ga0105238_10009110 3300009551 Bacteria 9932
168 Ga0105249_10000026 3300009553 Bacteria 232053
169 Ga0105239_10165072 3300010375 Bacteria 2476
170 Ga0105239_10992516 3300010375 Bacteria 965
171 Ga0157373_10010767 3300013100 Bacteria 6730
172 Ga0157373_10070975 3300013100 Bacteria 2461
173 Ga0157371_10033884 3300013102 Bacteria 3667
174 Ga0157371_10073442 3300013102 Bacteria 2422
175 Ga0157371_10073983 3300013102 Bacteria 2413
176 Ga0157370_10001103 3300013104 Bacteria 33826
177 Ga0157370_10007621 3300013104 Bacteria 11756
178 Ga0157370_10099484 3300013104 Bacteria 2726
179 Ga0157369_10085942 3300013105 Bacteria 3360
180 Ga0157369_10089608 3300013105 Bacteria 3284
181 Ga0157369_10178800 3300013105 Bacteria 2233
182 Ga0157369_10350681 3300013105 Bacteria 1533
183 Ga0157374_10028621 3300013296 Bacteria 5035
184 Ga0157374_10155727 3300013296 Bacteria 2223
185 Ga0157374_10192925 3300013296 Bacteria 1993
186 Ga0157378_10028843 3300013297 Bacteria 4899
187 Ga0157378_10302349 3300013297 Bacteria 1549
188 Ga0163162_10013012 3300013306 Bacteria 8120
189 Ga0163162_10028826 3300013306 Bacteria 5494
190 Ga0163162_10063826 3300013306 Bacteria 3727
191 Ga0163162_10080188 3300013306 Bacteria 3331
192 Ga0163162_10173217 3300013306 Bacteria 2283
193 Ga0163162_10213907 3300013306 Bacteria 2058
194 Ga0163162_10494780 3300013306 Bacteria 1353
195 Ga0157372_10727589 3300013307 Bacteria 1154
196 Ga0157372_10732960 3300013307 Bacteria 1149
197 Ga0157375_10005156 3300013308 Bacteria 11342
198 Ga0163163_10011444 3300014325 Bacteria 8049
199 Ga0163163_10013075 3300014325 Bacteria 7583
200 Ga0163163_10019659 3300014325 Bacteria 6346
201 Ga0163163_10031056 3300014325 Bacteria 5152
202 Ga0163163_10181814 3300014325 Bacteria 2150
203 Ga0157380_10000209 3300014326 Bacteria 34445
204 Ga0157380_10000495 3300014326 Bacteria 24048
205 Ga0157380_10005216 3300014326 Bacteria 9084
206 Ga0157377_10051559 3300014745 Bacteria 2321
207 Ga0157379_10015207 3300014968 Bacteria 6748
208 Ga0157376_10008170 3300014969 Bacteria 7530
209 Ga0157376_10438870 3300014969 Bacteria 1271
210 Ga0163161_10000008 3300017792 Bacteria 294642
211 Ga0209257_1017985 3300025304 Bacteria 2748
212 Ga0207697_10018378 3300025315 Bacteria 2867
213 Ga0207656_10053738 3300025321 Bacteria 1749
214 Ga0207710_10116667 3300025900 Bacteria 1272
215 Ga0207688_10002334 3300025901 Bacteria 10193
216 Ga0207688_10085206 3300025901 Bacteria 1809
217 Ga0207680_10000004 3300025903 Bacteria 827324
218 Ga0207680_10007362 3300025903 Bacteria 5358
219 Ga0207680_10011823 3300025903 Bacteria 4425
220 Ga0207680_10026892 3300025903 Bacteria 3194
221 Ga0207647_10004106 3300025904 Bacteria 10807
222 Ga0207647_10015256 3300025904 Bacteria 5275
223 Ga0207647_10039169 3300025904 Bacteria 2993
224 Ga0207647_10057243 3300025904 Bacteria 2390
225 Ga0207647_10087058 3300025904 Bacteria 1867
226 Ga0207645_10017372 3300025907 Bacteria 4748
227 Ga0207643_10167019 3300025908 Bacteria 1326
228 Ga0207705_10031274 3300025909 Bacteria 3797
229 Ga0207705_10051879 3300025909 Bacteria 2952
230 Ga0207705_10089909 3300025909 Bacteria 2247
231 Ga0207705_10115878 3300025909 Bacteria 1983
232 Ga0207705_10171006 3300025909 Bacteria 1636
233 Ga0207705_10228685 3300025909 Bacteria 1414
234 Ga0207654_10001498 3300025911 Bacteria 12324
235 Ga0207707_10066825 3300025912 Bacteria 3131
236 Ga0207707_10297164 3300025912 Bacteria 1397
237 Ga0207695_10004440 3300025913 Bacteria 19138
238 Ga0207671_10003387 3300025914 Bacteria 15960
239 Ga0207660_10048258 3300025917 Bacteria 3012
240 Ga0207657_10010408 3300025919 Bacteria 9285
241 Ga0207657_10022074 3300025919 Bacteria 5974
242 Ga0207657_10048370 3300025919 Bacteria 3714
243 Ga0207649_10020768 3300025920 Bacteria 3770
244 Ga0207649_10049103 3300025920 Bacteria 2604
245 Ga0207649_10081489 3300025920 Bacteria 2096
246 Ga0207649_10132121 3300025920 Bacteria 1697
247 Ga0207649_10186526 3300025920 Bacteria 1455
248 Ga0207652_10235495 3300025921 Bacteria 1650
249 Ga0207681_10000014 3300025923 Bacteria 353422
250 Ga0207681_10000178 3300025923 Bacteria 52013
251 Ga0207681_10147870 3300025923 Bacteria 1757
252 Ga0207681_10234456 3300025923 Bacteria 1426
253 Ga0207694_10017125 3300025924 Bacteria 5475
254 Ga0207694_10031695 3300025924 Bacteria 4040
255 Ga0207694_10197804 3300025924 Bacteria 1634
256 Ga0207650_10000015 3300025925 Bacteria 369173
257 Ga0207650_10003932 3300025925 Bacteria 10168
258 Ga0207650_10009776 3300025925 Bacteria 6556
259 Ga0207650_10053429 3300025925 Bacteria 2994
260 Ga0207650_10159575 3300025925 Bacteria 1786
261 Ga0207650_10175935 3300025925 Bacteria 1703
262 Ga0207659_10066901 3300025926 Bacteria 2609
263 Ga0207659_10092978 3300025926 Bacteria 2256
264 Ga0207659_10220110 3300025926 Bacteria 1526
265 Ga0207687_10066297 3300025927 Bacteria 2566
266 Ga0207700_10087137 3300025928 Bacteria 2455
267 Ga0207664_10010269 3300025929 Bacteria 6611
268 Ga0207644_10000235 3300025931 Bacteria 38139
269 Ga0207644_10000480 3300025931 Bacteria 25749
270 Ga0207644_10002193 3300025931 Bacteria 12661
271 Ga0207644_10005323 3300025931 Bacteria 8398
272 Ga0207644_10006566 3300025931 Bacteria 7578
273 Ga0207644_10011734 3300025931 Bacteria 5799
274 Ga0207690_10043295 3300025932 Bacteria 2962
275 Ga0207690_10119510 3300025932 Bacteria 1912
276 Ga0207706_10007429 3300025933 Bacteria 10135
277 Ga0207706_10042336 3300025933 Bacteria 4037
278 Ga0207706_10053757 3300025933 Bacteria 3555
279 Ga0207706_10062269 3300025933 Bacteria 3285
280 Ga0207706_10068199 3300025933 Bacteria 3130
281 Ga0207706_10073354 3300025933 Bacteria 3010
282 Ga0207706_10078440 3300025933 Bacteria 2905
283 Ga0207706_10150333 3300025933 Bacteria 2048
284 Ga0207686_10049148 3300025934 Bacteria 2617
285 Ga0207670_10036047 3300025936 Bacteria 3214
286 Ga0207669_10378759 3300025937 Bacteria 1102
287 Ga0207704_10015845 3300025938 Bacteria 3855
288 Ga0207665_10083935 3300025939 Bacteria 2198
289 Ga0207691_10004948 3300025940 Bacteria 12851
290 Ga0207691_10045761 3300025940 Bacteria 4022
291 Ga0207691_10046368 3300025940 Bacteria 3994
292 Ga0207691_10092297 3300025940 Bacteria 2711
293 Ga0207711_10001481 3300025941 Bacteria 21836
294 Ga0207711_10002373 3300025941 Bacteria 16857
295 Ga0207711_10003731 3300025941 Bacteria 13137
296 Ga0207711_10004888 3300025941 Bacteria 11374
297 Ga0207711_10005994 3300025941 Bacteria 10274
298 Ga0207689_10015644 3300025942 Bacteria 6425
299 Ga0207679_10068893 3300025945 Bacteria 2660
300 Ga0207679_10116062 3300025945 Bacteria 2122
301 Ga0207679_10332935 3300025945 Bacteria 1318
302 Ga0207667_10023457 3300025949 Bacteria 6793
303 Ga0207651_10004134 3300025960 Bacteria 7251
304 Ga0207651_10005811 3300025960 Bacteria 6374
305 Ga0207712_10000001 3300025961 Bacteria 750309
306 Ga0207668_10050122 3300025972 Bacteria 2875
307 Ga0207668_10155142 3300025972 Bacteria 1778
308 Ga0207640_10004572 3300025981 Bacteria 7507
309 Ga0207640_10045258 3300025981 Bacteria 2825
310 Ga0207640_10059350 3300025981 Bacteria 2525
311 Ga0207640_10132299 3300025981 Bacteria 1805
312 Ga0207658_10005300 3300025986 Bacteria 8868
313 Ga0207658_10005800 3300025986 Bacteria 8452
314 Ga0207658_10006952 3300025986 Bacteria 7703
315 Ga0207658_10021158 3300025986 Bacteria 4511
316 Ga0207658_10031667 3300025986 Bacteria 3757
317 Ga0207658_10082729 3300025986 Bacteria 2466
318 Ga0207658_10134485 3300025986 Bacteria 1991
319 Ga0207677_10003757 3300026023 Bacteria 8055
320 Ga0207677_10018683 3300026023 Bacteria 4165
321 Ga0207677_10032197 3300026023 Bacteria 3368
322 Ga0207703_10012097 3300026035 Bacteria 6723
323 Ga0207703_10039068 3300026035 Bacteria 3791
324 Ga0207639_10004054 3300026041 Bacteria 9882
325 Ga0207678_10006822 3300026067 Bacteria 10127
326 Ga0207678_10015624 3300026067 Bacteria 6674
327 Ga0207678_10015932 3300026067 Bacteria 6602
328 Ga0207678_10022829 3300026067 Bacteria 5478
329 Ga0207678_10027098 3300026067 Bacteria 4998
330 Ga0207678_10034401 3300026067 Bacteria 4413
331 Ga0207678_10131271 3300026067 Bacteria 2137
332 Ga0207678_10304810 3300026067 Bacteria 1369
333 Ga0207702_10002323 3300026078 Bacteria 18167
334 Ga0207702_10069392 3300026078 Bacteria 3030
335 Ga0207702_10110538 3300026078 Bacteria 2442
336 Ga0207702_10413214 3300026078 Bacteria 1303
337 Ga0207641_10000057 3300026088 Bacteria 168603
338 Ga0207641_10000711 3300026088 Bacteria 35681
339 Ga0207641_10017731 3300026088 Bacteria 5832
340 Ga0207641_10030638 3300026088 Bacteria 4456
341 Ga0207641_10112829 3300026088 Bacteria 2412
342 Ga0207648_10004358 3300026089 Bacteria 14561
343 Ga0207648_10033869 3300026089 Bacteria 4504
344 Ga0207648_10036608 3300026089 Bacteria 4323
345 Ga0207676_10000021 3300026095 Bacteria 296572
346 Ga0207676_10002574 3300026095 Bacteria 12940
347 Ga0207676_10003395 3300026095 Bacteria 11252
348 Ga0207676_10028584 3300026095 Bacteria 4166
349 Ga0207676_10037835 3300026095 Bacteria 3680
350 Ga0207676_10053314 3300026095 Bacteria 3165
351 Ga0207676_10104403 3300026095 Bacteria 2357
352 Ga0207676_10263799 3300026095 Bacteria 1556
353 Ga0207674_10006197 3300026116 Bacteria 14098
354 Ga0207674_10083919 3300026116 Bacteria 3184
355 Ga0207674_10094734 3300026116 Bacteria 2972
356 Ga0207674_10170668 3300026116 Bacteria 2129
357 Ga0207674_10392306 3300026116 Bacteria 1342
358 Ga0207675_100000571 3300026118 Bacteria 35943
359 Ga0207675_100002138 3300026118 Bacteria 19611
360 Ga0207683_10003116 3300026121 Bacteria 14485
361 Ga0207683_10003428 3300026121 Bacteria 13817
362 Ga0207683_10026449 3300026121 Bacteria 5007
363 Ga0207683_10064322 3300026121 Bacteria 3232
364 Ga0207683_10331667 3300026121 Bacteria 1395
365 Ga0207698_10000847 3300026142 Bacteria 17770
366 Ga0207698_10008362 3300026142 Bacteria 6540
367 Ga0207698_10009031 3300026142 Bacteria 6330
368 Ga0207698_10024453 3300026142 Bacteria 4239
369 Ga0207698_10080539 3300026142 Bacteria 2624
370 Ga0268266_10000042 3300028379 Bacteria 316826
371 Ga0268266_10169587 3300028379 Bacteria 1980
372 Ga0268265_10000013 3300028380 Bacteria 341536
373 Ga0268265_10000233 3300028380 Bacteria 63492
374 Ga0268265_10261375 3300028380 Bacteria 1539
375 Ga0268264_10000006 3300028381 Bacteria 827324
376 Ga0268264_10032269 3300028381 Bacteria 4296
377 Ga0268264_10196672 3300028381 Bacteria 1841
378 Ga0307405_10378220 3300031731 Bacteria 1102
379 Ga0307410_10009286 3300031852 Bacteria 5509
380 Ga0307406_10030198 3300031901 Bacteria 3288
381 Ga0307407_10347415 3300031903 Bacteria 1049
382 Ga0307412_10034152 3300031911 Bacteria 3239
383 Ga0307412_10076586 3300031911 Bacteria 2298
384 Ga0307412_10096685 3300031911 Bacteria 2079
385 Ga0307412_10212805 3300031911 Bacteria 1476
386 Ga0307409_100101851 3300031995 Bacteria 2384
387 Ga0307409_100253575 3300031995 Bacteria 1610
388 Ga0307409_100316241 3300031995 Bacteria 1459
389 Ga0307414_10417306 3300032004 Bacteria 1169
390 Ga0307414_10485913 3300032004 Bacteria 1090
391 Ga0307411_10003005 3300032005 Bacteria 7686
392 Ga0307411_10052476 3300032005 Bacteria 2666
393 Ga0307415_100002556 3300032126 Bacteria 9100
394 Ga0395899_0049094 3300037312 Bacteria 3138
395 Ga0395899_0069775 3300037312 Bacteria 2573
396 Ga0395899_0179402 3300037312 Bacteria 1487
397 Ga0395900_0038883 3300037418 Bacteria 4904
398 Ga0395900_0101979 3300037418 Bacteria 2948
399 Ga0395900_0113487 3300037418 Bacteria 2781
400 Ga0395900_0174706 3300037418 Bacteria 2185
401 Ga0395900_0193044 3300037418 Bacteria 2064
402 Ga0395898_0010117 3300037466 Bacteria 9873
403 Ga0395898_0093201 3300037466 Bacteria 2895
404 Ga0395898_0202780 3300037466 Bacteria 1893
405 Ga0395905_0004125 3300037471 Bacteria 15214
406 Ga0395905_0004550 3300037471 Bacteria 14359
407 Ga0395905_0011553 3300037471 Bacteria 8533
408 Ga0395905_0015707 3300037471 Bacteria 7193
409 Ga0395905_0036984 3300037471 Bacteria 4586
410 Ga0395905_0097878 3300037471 Bacteria 2755
411 Ga0395905_0163692 3300037471 Bacteria 2090
412 Ga0395905_0266835 3300037471 Bacteria 1597
413 Ga0395901_0000447 3300038443 Bacteria 47979
414 Ga0395901_0061277 3300038443 Bacteria 3915
415 Ga0395901_0077844 3300038443 Bacteria 3461
416 Ga0395901_0100630 3300038443 Bacteria 3032
417 Ga0436365_0735741 3300039437 Bacteria 1829
418 Ga0439448_0001796 3300042005 Bacteria 5671
419 Ga0439458_0000869 3300042157 Bacteria 7824
420 Ga0466957_0080757 3300044842 Bacteria 2025
421 Ga0466967_0063952 3300045976 Bacteria 3271
422 Ga0466967_0132853 3300045976 Bacteria 2312
423 Ga0466967_0315653 3300045976 Bacteria 1506
424 Ga0495616_0000887 3300046513 Bacteria 21617
425 Ga0495654_0005438 3300046530 Bacteria 7397
426 Ga0495622_0051376 3300046557 Bacteria 1912
427 Ga0495668_0000001 3300046616 Bacteria 1013420
428 Ga0495668_0021589 3300046616 Bacteria 3689
429 Ga0495668_0031375 3300046616 Bacteria 2995
430 Ga0495669_0124017 3300046684 Bacteria 1213
431 Ga0495671_0023690 3300046692 Bacteria 3206
432 Ga0495589_0059991 3300046794 Bacteria 1869
433 Ga0496102_0000043 3300048905 Bacteria 189201
434 Ga0496102_0022877 3300048905 Bacteria 5542
435 Ga0496103_0000086 3300048906 Bacteria 104765
436 Ga0496103_0011704 3300048906 Bacteria 5203
437 Ga0496104_0112979 3300048907 Bacteria 2605
438 Ga0496105_0109301 3300048908 Bacteria 2283
439 Ga0496106_0158143 3300048909 Bacteria 1791
440 Ga0496109_0002390 3300048912 Bacteria 15690
441 Ga0496109_0008457 3300048912 Bacteria 8748
442 Ga0496109_0104251 3300048912 Bacteria 2633
443 Ga0496110_0325758 3300048913 Bacteria 1399
444 Ga0496111_0017925 3300048914 Bacteria 4897
445 Ga0496111_0135398 3300048914 Bacteria 1824
446 Ga0496112_0129220 3300048915 Bacteria 2497
447 Ga0496112_0371034 3300048915 Bacteria 1372
448 Ga0496113_0012937 3300048916 Bacteria 5629
449 Ga0496113_0041800 3300048916 Bacteria 3385
450 Ga0496116_0007459 3300048919 Bacteria 9696
451 Ga0496117_0000104 3300048920 Bacteria 189201
452 Ga0496117_0005462 3300048920 Bacteria 13330
453 Ga0496118_0000080 3300048921 Bacteria 189201
454 Ga0496118_0048616 3300048921 Bacteria 3273
455 Ga0496121_0069673 3300048924 Bacteria 2837
456 Ga0496124_0000093 3300048927 Bacteria 189201
457 Ga0496125_0046152 3300048928 Bacteria 3658
458 Ga0501038_0099632 3300049574 Bacteria 2422
459 Ga0501223_000015 3300049663 Bacteria 68826
460 Ga0501225_0000167 3300049705 Bacteria 19939
461 nmdc:mga05p37_481510_c1 3300050507 Bacteria 1429
462 Ga0500643_001092 3300053087 Bacteria 16292
463 Ga0500592_002049 3300053116 Bacteria 3248
464 Ga0500594_0005092 3300053118 Bacteria 2905
465 Ga0500627_0001222 3300053158 Bacteria 7069
466 Ga0500627_0009380 3300053158 Bacteria 3522
467 Ga0500611_005866 3300053727 Bacteria 1755
468 Ga0500645_024531 3300053730 Bacteria 1843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003781 Ga0055536_1008468 Ga0055536_10084686 294
2 3300005327 Ga0070658_10182099 Ga0070658_101820992 294
3 3300005334 Ga0068869_100093149 Ga0068869_1000931493 294
4 3300005355 Ga0070671_100003919 Ga0070671_10000391913 294
5 3300005458 Ga0070681_10051860 Ga0070681_100518603 294
6 3300013104 Ga0157370_10001103 Ga0157370_1000110311 294
7 3300013307 Ga0157372_10727589 Ga0157372_107275892 294
8 3300037471 Ga0395905_0004550 Ga0395905_0004550_11546_12430 294
9 3300044842 Ga0466957_0080757 Ga0466957_0080757_234_1118 294
10 3300045976 Ga0466967_0132853 Ga0466967_0132853_711_1595 294
11 3300046616 Ga0495668_0000001 Ga0495668_0000001_446500_447390 294
12 3300053116 Ga0500592_002049 Ga0500592_002049_407_1291 294
13 3300053727 Ga0500611_005866 Ga0500611_005866_732_1616 294
14 iso_pu_bacteria 2643221605 2644039036 294
15 3300013297 Ga0157378_10028843 Ga0157378_100288434 295
16 3300025940 Ga0207691_10046368 Ga0207691_100463682 295
17 3300031852 Ga0307410_10009286 Ga0307410_100092864 295
18 3300031911 Ga0307412_10212805 Ga0307412_102128052 295
19 3300031995 Ga0307409_100253575 Ga0307409_1002535752 295
20 3300032005 Ga0307411_10003005 Ga0307411_100030056 295
21 3300032126 Ga0307415_100002556 Ga0307415_1000025568 295
22 3300046530 Ga0495654_0005438 Ga0495654_0005438_945_1832 295
23 3300046616 Ga0495668_0021589 Ga0495668_0021589_548_1435 295
24 3300046794 Ga0495589_0059991 Ga0495589_0059991_437_1324 295
25 3300053158 Ga0500627_0001222 Ga0500627_0001222_47_934 295
26 iso_pu_bacteria 2848297114 2848299791 295
27 3300005337 Ga0070682_100078148 Ga0070682_1000781483 297
28 3300031901 Ga0307406_10030198 Ga0307406_100301984 297
29 3300031903 Ga0307407_10347415 Ga0307407_103474152 297
30 3300031911 Ga0307412_10034152 Ga0307412_100341523 297
31 3300031995 Ga0307409_100316241 Ga0307409_1003162413 297
32 3300032004 Ga0307414_10417306 Ga0307414_104173062 297
33 3300002076 JGI24749J21850_1000119 JGI24749J21850_10001195 298
34 3300002459 JGI24751J29686_10000280 JGI24751J29686_1000028012 298
35 3300005295 Ga0065707_10085948 Ga0065707_100859485 298
36 3300005295 Ga0065707_10086498 Ga0065707_100864983 298
37 3300005331 Ga0070670_100000024 Ga0070670_10000002412 298
38 3300005347 Ga0070668_100065058 Ga0070668_1000650583 298
39 3300005353 Ga0070669_100000047 Ga0070669_10000004712 298
40 3300005353 Ga0070669_100101229 Ga0070669_1001012292 298
41 3300005367 Ga0070667_100007975 Ga0070667_10000797510 298
42 3300005617 Ga0068859_100002070 Ga0068859_10000207010 298
43 3300005618 Ga0068864_100000036 Ga0068864_10000003613 298
44 3300005618 Ga0068864_100005293 Ga0068864_1000052938 298
45 3300005719 Ga0068861_100005435 Ga0068861_1000054353 298
46 3300005841 Ga0068863_100004012 Ga0068863_1000040125 298
47 3300005844 Ga0068862_100000033 Ga0068862_10000003391 298
48 3300005937 Ga0081455_10002904 Ga0081455_1000290417 298
49 3300006931 Ga0097620_100002070 Ga0097620_10000207010 298
50 3300009177 Ga0105248_10000091 Ga0105248_1000009111 298
51 3300013306 Ga0163162_10494780 Ga0163162_104947802 298
52 3300014325 Ga0163163_10019659 Ga0163163_100196595 298
53 3300014326 Ga0157380_10000209 Ga0157380_1000020923 298
54 3300014326 Ga0157380_10000495 Ga0157380_1000049520 298
55 3300025923 Ga0207681_10000014 Ga0207681_1000001496 298
56 3300025923 Ga0207681_10147870 Ga0207681_101478702 298
57 3300025924 Ga0207694_10197804 Ga0207694_101978042 298
58 3300025925 Ga0207650_10000015 Ga0207650_10000015114 298
59 3300025941 Ga0207711_10001481 Ga0207711_1000148119 298
60 3300025972 Ga0207668_10050122 Ga0207668_100501224 298
61 3300025986 Ga0207658_10005300 Ga0207658_100053002 298
62 3300026088 Ga0207641_10000711 Ga0207641_100007118 298
63 3300026095 Ga0207676_10000021 Ga0207676_10000021288 298
64 3300026095 Ga0207676_10003395 Ga0207676_100033953 298
65 3300026118 Ga0207675_100002138 Ga0207675_1000021387 298
66 3300028380 Ga0268265_10000013 Ga0268265_10000013260 298
67 3300031731 Ga0307405_10378220 Ga0307405_103782201 298
68 3300031911 Ga0307412_10076586 Ga0307412_100765862 298
69 3300031911 Ga0307412_10096685 Ga0307412_100966852 298
70 3300032004 Ga0307414_10485913 Ga0307414_104859131 298
71 3300048928 Ga0496125_0046152 Ga0496125_0046152_1607_2578 298
72 3300049663 Ga0501223_000015 Ga0501223_000015_58549_59445 298
73 3300049705 Ga0501225_0000167 Ga0501225_0000167_10988_11884 298
74 3300050507 nmdc:mga05p37_481510_c1 nmdc:mga05p37_481510_c1_488_1384 298
75 3300053730 Ga0500645_024531 Ga0500645_024531_872_1771 298
76 3300001979 JGI24740J21852_10031029 JGI24740J21852_100310293 299
77 3300001990 JGI24737J22298_10001804 JGI24737J22298_100018045 299
78 3300005327 Ga0070658_10034595 Ga0070658_100345952 299
79 3300005327 Ga0070658_10281999 Ga0070658_102819992 299
80 3300005328 Ga0070676_10023913 Ga0070676_100239133 299
81 3300005328 Ga0070676_10052576 Ga0070676_100525762 299
82 3300005329 Ga0070683_100055813 Ga0070683_1000558132 299
83 3300005329 Ga0070683_100058349 Ga0070683_1000583494 299
84 3300005331 Ga0070670_100013695 Ga0070670_1000136956 299
85 3300005331 Ga0070670_100023422 Ga0070670_1000234226 299
86 3300005331 Ga0070670_100154360 Ga0070670_1001543602 299
87 3300005331 Ga0070670_100178438 Ga0070670_1001784382 299
88 3300005335 Ga0070666_10002231 Ga0070666_100022316 299
89 3300005335 Ga0070666_10002277 Ga0070666_1000227710 299
90 3300005335 Ga0070666_10015714 Ga0070666_100157143 299
91 3300005335 Ga0070666_10029943 Ga0070666_100299433 299
92 3300005335 Ga0070666_10039248 Ga0070666_100392482 299
93 3300005336 Ga0070680_100404648 Ga0070680_1004046482 299
94 3300005338 Ga0068868_100032573 Ga0068868_1000325733 299
95 3300005338 Ga0068868_100059294 Ga0068868_1000592943 299
96 3300005339 Ga0070660_100002041 Ga0070660_1000020416 299
97 3300005339 Ga0070660_100135444 Ga0070660_1001354442 299
98 3300005339 Ga0070660_100218596 Ga0070660_1002185962 299
99 3300005344 Ga0070661_100052323 Ga0070661_1000523233 299
100 3300005344 Ga0070661_100060829 Ga0070661_1000608293 299
101 3300005344 Ga0070661_100131753 Ga0070661_1001317531 299
102 3300005344 Ga0070661_100176995 Ga0070661_1001769952 299
103 3300005345 Ga0070692_10072251 Ga0070692_100722512 299
104 3300005354 Ga0070675_100132632 Ga0070675_1001326322 299
105 3300005354 Ga0070675_100283251 Ga0070675_1002832512 299
106 3300005355 Ga0070671_100003765 Ga0070671_1000037652 299
107 3300005355 Ga0070671_100004086 Ga0070671_1000040864 299
108 3300005356 Ga0070674_100105278 Ga0070674_1001052783 299
109 3300005364 Ga0070673_100004341 Ga0070673_10000434111 299
110 3300005364 Ga0070673_100257421 Ga0070673_1002574211 299
111 3300005366 Ga0070659_100026260 Ga0070659_1000262605 299
112 3300005366 Ga0070659_100135556 Ga0070659_1001355562 299
113 3300005366 Ga0070659_100207399 Ga0070659_1002073991 299
114 3300005366 Ga0070659_100425964 Ga0070659_1004259642 299
115 3300005367 Ga0070667_100007536 Ga0070667_1000075361 299
116 3300005367 Ga0070667_100016730 Ga0070667_1000167307 299
117 3300005367 Ga0070667_100028334 Ga0070667_1000283345 299
118 3300005367 Ga0070667_100168452 Ga0070667_1001684522 299
119 3300005436 Ga0070713_100067864 Ga0070713_1000678643 299
120 3300005455 Ga0070663_100019395 Ga0070663_1000193953 299
121 3300005455 Ga0070663_100265214 Ga0070663_1002652142 299
122 3300005456 Ga0070678_100001675 Ga0070678_10000167512 299
123 3300005456 Ga0070678_100003048 Ga0070678_10000304810 299
124 3300005456 Ga0070678_100014022 Ga0070678_1000140222 299
125 3300005456 Ga0070678_100081151 Ga0070678_1000811512 299
126 3300005457 Ga0070662_100003498 Ga0070662_10000349815 299
127 3300005457 Ga0070662_100010408 Ga0070662_1000104084 299
128 3300005457 Ga0070662_100041431 Ga0070662_1000414313 299
129 3300005457 Ga0070662_100167333 Ga0070662_1001673332 299
130 3300005459 Ga0068867_100072554 Ga0068867_1000725542 299
131 3300005530 Ga0070679_100185740 Ga0070679_1001857403 299
132 3300005535 Ga0070684_100022302 Ga0070684_1000223022 299
133 3300005535 Ga0070684_100282837 Ga0070684_1002828372 299
134 3300005539 Ga0068853_100071557 Ga0068853_1000715573 299
135 3300005543 Ga0070672_100001974 Ga0070672_1000019745 299
136 3300005543 Ga0070672_100026483 Ga0070672_1000264832 299
137 3300005548 Ga0070665_100061780 Ga0070665_1000617802 299
138 3300005548 Ga0070665_100064762 Ga0070665_1000647625 299
139 3300005563 Ga0068855_100566300 Ga0068855_1005663001 299
140 3300005564 Ga0070664_100011244 Ga0070664_1000112444 299
141 3300005564 Ga0070664_100022722 Ga0070664_1000227222 299
142 3300005564 Ga0070664_100023812 Ga0070664_1000238126 299
143 3300005564 Ga0070664_100039375 Ga0070664_1000393753 299
144 3300005564 Ga0070664_100062865 Ga0070664_1000628653 299
145 3300005564 Ga0070664_100150247 Ga0070664_1001502472 299
146 3300005577 Ga0068857_100009975 Ga0068857_1000099756 299
147 3300005578 Ga0068854_100006274 Ga0068854_1000062743 299
148 3300005578 Ga0068854_100322726 Ga0068854_1003227262 299
149 3300005614 Ga0068856_100062685 Ga0068856_1000626852 299
150 3300005614 Ga0068856_100147399 Ga0068856_1001473993 299
151 3300005616 Ga0068852_100000973 Ga0068852_1000009738 299
152 3300005616 Ga0068852_100064100 Ga0068852_1000641002 299
153 3300005616 Ga0068852_100072583 Ga0068852_1000725833 299
154 3300005618 Ga0068864_100008310 Ga0068864_1000083101 299
155 3300005618 Ga0068864_100011993 Ga0068864_10001199310 299
156 3300005618 Ga0068864_100024410 Ga0068864_1000244102 299
157 3300005618 Ga0068864_100053440 Ga0068864_1000534402 299
158 3300005618 Ga0068864_100130937 Ga0068864_1001309372 299
159 3300005840 Ga0068870_10148890 Ga0068870_101488902 299
160 3300005841 Ga0068863_100002388 Ga0068863_10000238818 299
161 3300005841 Ga0068863_100006118 Ga0068863_1000061182 299
162 3300005841 Ga0068863_100270233 Ga0068863_1002702332 299
163 3300005842 Ga0068858_100013052 Ga0068858_10001305210 299
164 3300005842 Ga0068858_100040890 Ga0068858_1000408904 299
165 3300005843 Ga0068860_100029076 Ga0068860_1000290766 299
166 3300005843 Ga0068860_100110864 Ga0068860_1001108642 299
167 3300005843 Ga0068860_100112729 Ga0068860_1001127292 299
168 3300005843 Ga0068860_100539211 Ga0068860_1005392112 299
169 3300006173 Ga0070716_100138673 Ga0070716_1001386732 299
170 3300006237 Ga0097621_100022233 Ga0097621_1000222333 299
171 3300006237 Ga0097621_100070851 Ga0097621_1000708513 299
172 3300006237 Ga0097621_100188315 Ga0097621_1001883153 299
173 3300006358 Ga0068871_100006708 Ga0068871_1000067089 299
174 3300009098 Ga0105245_10005641 Ga0105245_100056413 299
175 3300009098 Ga0105245_10297043 Ga0105245_102970431 299
176 3300009176 Ga0105242_10006705 Ga0105242_100067059 299
177 3300009177 Ga0105248_10000096 Ga0105248_1000009645 299
178 3300009177 Ga0105248_10173813 Ga0105248_101738132 299
179 3300009177 Ga0105248_10202777 Ga0105248_102027773 299
180 3300009551 Ga0105238_10009110 Ga0105238_1000911011 299
181 3300010375 Ga0105239_10165072 Ga0105239_101650722 299
182 3300010375 Ga0105239_10992516 Ga0105239_109925161 299
183 3300013100 Ga0157373_10010767 Ga0157373_100107674 299
184 3300013100 Ga0157373_10070975 Ga0157373_100709752 299
185 3300013102 Ga0157371_10033884 Ga0157371_100338843 299
186 3300013102 Ga0157371_10073442 Ga0157371_100734423 299
187 3300013102 Ga0157371_10073983 Ga0157371_100739832 299
188 3300013104 Ga0157370_10099484 Ga0157370_100994843 299
189 3300013105 Ga0157369_10085942 Ga0157369_100859422 299
190 3300013105 Ga0157369_10089608 Ga0157369_100896083 299
191 3300013105 Ga0157369_10178800 Ga0157369_101788003 299
192 3300013105 Ga0157369_10350681 Ga0157369_103506812 299
193 3300013296 Ga0157374_10028621 Ga0157374_100286215 299
194 3300013296 Ga0157374_10155727 Ga0157374_101557272 299
195 3300013296 Ga0157374_10192925 Ga0157374_101929253 299
196 3300013297 Ga0157378_10302349 Ga0157378_103023492 299
197 3300013306 Ga0163162_10013012 Ga0163162_100130127 299
198 3300013306 Ga0163162_10028826 Ga0163162_100288266 299
199 3300013306 Ga0163162_10063826 Ga0163162_100638263 299
200 3300013306 Ga0163162_10213907 Ga0163162_102139072 299
201 3300013307 Ga0157372_10732960 Ga0157372_107329601 299
202 3300013308 Ga0157375_10005156 Ga0157375_1000515613 299
203 3300014325 Ga0163163_10011444 Ga0163163_100114442 299
204 3300014325 Ga0163163_10013075 Ga0163163_100130758 299
205 3300014325 Ga0163163_10181814 Ga0163163_101818143 299
206 3300014745 Ga0157377_10051559 Ga0157377_100515593 299
207 3300014969 Ga0157376_10008170 Ga0157376_100081709 299
208 3300014969 Ga0157376_10438870 Ga0157376_104388702 299
209 3300025304 Ga0209257_1017985 Ga0209257_10179855 299
210 3300025315 Ga0207697_10018378 Ga0207697_100183782 299
211 3300025321 Ga0207656_10053738 Ga0207656_100537382 299
212 3300025901 Ga0207688_10002334 Ga0207688_100023346 299
213 3300025901 Ga0207688_10085206 Ga0207688_100852063 299
214 3300025903 Ga0207680_10007362 Ga0207680_100073625 299
215 3300025903 Ga0207680_10011823 Ga0207680_100118234 299
216 3300025903 Ga0207680_10026892 Ga0207680_100268923 299
217 3300025904 Ga0207647_10015256 Ga0207647_100152564 299
218 3300025904 Ga0207647_10039169 Ga0207647_100391693 299
219 3300025904 Ga0207647_10057243 Ga0207647_100572432 299
220 3300025904 Ga0207647_10087058 Ga0207647_100870582 299
221 3300025907 Ga0207645_10017372 Ga0207645_100173724 299
222 3300025908 Ga0207643_10167019 Ga0207643_101670192 299
223 3300025909 Ga0207705_10031274 Ga0207705_100312745 299
224 3300025909 Ga0207705_10051879 Ga0207705_100518792 299
225 3300025909 Ga0207705_10089909 Ga0207705_100899093 299
226 3300025909 Ga0207705_10115878 Ga0207705_101158781 299
227 3300025909 Ga0207705_10171006 Ga0207705_101710062 299
228 3300025909 Ga0207705_10228685 Ga0207705_102286852 299
229 3300025912 Ga0207707_10066825 Ga0207707_100668254 299
230 3300025912 Ga0207707_10297164 Ga0207707_102971642 299
231 3300025917 Ga0207660_10048258 Ga0207660_100482583 299
232 3300025919 Ga0207657_10010408 Ga0207657_100104087 299
233 3300025919 Ga0207657_10022074 Ga0207657_100220743 299
234 3300025920 Ga0207649_10020768 Ga0207649_100207683 299
235 3300025920 Ga0207649_10049103 Ga0207649_100491033 299
236 3300025920 Ga0207649_10081489 Ga0207649_100814895 299
237 3300025920 Ga0207649_10132121 Ga0207649_101321212 299
238 3300025920 Ga0207649_10186526 Ga0207649_101865262 299
239 3300025921 Ga0207652_10235495 Ga0207652_102354952 299
240 3300025923 Ga0207681_10234456 Ga0207681_102344562 299
241 3300025924 Ga0207694_10031695 Ga0207694_100316953 299
242 3300025925 Ga0207650_10003932 Ga0207650_100039323 299
243 3300025925 Ga0207650_10009776 Ga0207650_100097766 299
244 3300025925 Ga0207650_10159575 Ga0207650_101595752 299
245 3300025925 Ga0207650_10175935 Ga0207650_101759352 299
246 3300025926 Ga0207659_10066901 Ga0207659_100669012 299
247 3300025926 Ga0207659_10092978 Ga0207659_100929782 299
248 3300025926 Ga0207659_10220110 Ga0207659_102201101 299
249 3300025927 Ga0207687_10066297 Ga0207687_100662972 299
250 3300025928 Ga0207700_10087137 Ga0207700_100871373 299
251 3300025929 Ga0207664_10010269 Ga0207664_100102694 299
252 3300025931 Ga0207644_10000235 Ga0207644_1000023532 299
253 3300025931 Ga0207644_10000480 Ga0207644_1000048018 299
254 3300025931 Ga0207644_10002193 Ga0207644_1000219314 299
255 3300025931 Ga0207644_10005323 Ga0207644_100053237 299
256 3300025931 Ga0207644_10006566 Ga0207644_100065664 299
257 3300025932 Ga0207690_10119510 Ga0207690_101195102 299
258 3300025933 Ga0207706_10007429 Ga0207706_1000742912 299
259 3300025933 Ga0207706_10042336 Ga0207706_100423362 299
260 3300025933 Ga0207706_10062269 Ga0207706_100622693 299
261 3300025933 Ga0207706_10068199 Ga0207706_100681993 299
262 3300025933 Ga0207706_10073354 Ga0207706_100733542 299
263 3300025933 Ga0207706_10078440 Ga0207706_100784402 299
264 3300025933 Ga0207706_10150333 Ga0207706_101503331 299
265 3300025934 Ga0207686_10049148 Ga0207686_100491482 299
266 3300025937 Ga0207669_10378759 Ga0207669_103787592 299
267 3300025938 Ga0207704_10015845 Ga0207704_100158453 299
268 3300025939 Ga0207665_10083935 Ga0207665_100839353 299
269 3300025940 Ga0207691_10004948 Ga0207691_100049487 299
270 3300025940 Ga0207691_10045761 Ga0207691_100457613 299
271 3300025940 Ga0207691_10092297 Ga0207691_100922972 299
272 3300025941 Ga0207711_10002373 Ga0207711_1000237313 299
273 3300025941 Ga0207711_10003731 Ga0207711_100037312 299
274 3300025941 Ga0207711_10004888 Ga0207711_1000488813 299
275 3300025941 Ga0207711_10005994 Ga0207711_1000599414 299
276 3300025942 Ga0207689_10015644 Ga0207689_100156444 299
277 3300025945 Ga0207679_10068893 Ga0207679_100688933 299
278 3300025945 Ga0207679_10116062 Ga0207679_101160622 299
279 3300025945 Ga0207679_10332935 Ga0207679_103329352 299
280 3300025949 Ga0207667_10023457 Ga0207667_100234579 299
281 3300025960 Ga0207651_10004134 Ga0207651_100041344 299
282 3300025960 Ga0207651_10005811 Ga0207651_100058119 299
283 3300025972 Ga0207668_10155142 Ga0207668_101551422 299
284 3300025981 Ga0207640_10004572 Ga0207640_100045727 299
285 3300025981 Ga0207640_10045258 Ga0207640_100452581 299
286 3300025981 Ga0207640_10059350 Ga0207640_100593503 299
287 3300025986 Ga0207658_10006952 Ga0207658_100069523 299
288 3300025986 Ga0207658_10021158 Ga0207658_100211582 299
289 3300025986 Ga0207658_10031667 Ga0207658_100316674 299
290 3300025986 Ga0207658_10082729 Ga0207658_100827292 299
291 3300025986 Ga0207658_10134485 Ga0207658_101344852 299
292 3300026023 Ga0207677_10003757 Ga0207677_100037574 299
293 3300026023 Ga0207677_10018683 Ga0207677_100186834 299
294 3300026023 Ga0207677_10032197 Ga0207677_100321972 299
295 3300026035 Ga0207703_10012097 Ga0207703_100120974 299
296 3300026067 Ga0207678_10006822 Ga0207678_1000682210 299
297 3300026067 Ga0207678_10015624 Ga0207678_100156243 299
298 3300026067 Ga0207678_10015932 Ga0207678_100159324 299
299 3300026067 Ga0207678_10022829 Ga0207678_100228295 299
300 3300026067 Ga0207678_10027098 Ga0207678_100270983 299
301 3300026067 Ga0207678_10131271 Ga0207678_101312712 299
302 3300026067 Ga0207678_10304810 Ga0207678_103048102 299
303 3300026078 Ga0207702_10069392 Ga0207702_100693923 299
304 3300026078 Ga0207702_10110538 Ga0207702_101105382 299
305 3300026078 Ga0207702_10413214 Ga0207702_104132141 299
306 3300026088 Ga0207641_10017731 Ga0207641_100177316 299
307 3300026088 Ga0207641_10030638 Ga0207641_100306384 299
308 3300026088 Ga0207641_10112829 Ga0207641_101128294 299
309 3300026089 Ga0207648_10004358 Ga0207648_1000435811 299
310 3300026089 Ga0207648_10033869 Ga0207648_100338691 299
311 3300026089 Ga0207648_10036608 Ga0207648_100366084 299
312 3300026095 Ga0207676_10002574 Ga0207676_100025743 299
313 3300026095 Ga0207676_10028584 Ga0207676_100285843 299
314 3300026095 Ga0207676_10037835 Ga0207676_100378354 299
315 3300026095 Ga0207676_10053314 Ga0207676_100533143 299
316 3300026095 Ga0207676_10104403 Ga0207676_101044031 299
317 3300026116 Ga0207674_10006197 Ga0207674_1000619715 299
318 3300026116 Ga0207674_10094734 Ga0207674_100947344 299
319 3300026116 Ga0207674_10170668 Ga0207674_101706682 299
320 3300026116 Ga0207674_10392306 Ga0207674_103923061 299
321 3300026121 Ga0207683_10003116 Ga0207683_1000311617 299
322 3300026121 Ga0207683_10003428 Ga0207683_100034285 299
323 3300026121 Ga0207683_10026449 Ga0207683_100264494 299
324 3300026121 Ga0207683_10064322 Ga0207683_100643223 299
325 3300026121 Ga0207683_10331667 Ga0207683_103316672 299
326 3300026142 Ga0207698_10000847 Ga0207698_100008478 299
327 3300026142 Ga0207698_10009031 Ga0207698_100090315 299
328 3300026142 Ga0207698_10024453 Ga0207698_100244533 299
329 3300026142 Ga0207698_10080539 Ga0207698_100805394 299
330 3300028379 Ga0268266_10169587 Ga0268266_101695872 299
331 3300028380 Ga0268265_10261375 Ga0268265_102613752 299
332 3300028381 Ga0268264_10032269 Ga0268264_100322692 299
333 3300028381 Ga0268264_10196672 Ga0268264_101966722 299
334 3300031995 Ga0307409_100101851 Ga0307409_1001018512 299
335 3300037312 Ga0395899_0049094 Ga0395899_0049094_1862_2761 299
336 3300037312 Ga0395899_0069775 Ga0395899_0069775_789_1688 299
337 3300037312 Ga0395899_0179402 Ga0395899_0179402_102_1001 299
338 3300037418 Ga0395900_0038883 Ga0395900_0038883_3650_4549 299
339 3300037418 Ga0395900_0101979 Ga0395900_0101979_678_1577 299
340 3300037418 Ga0395900_0113487 Ga0395900_0113487_1797_2696 299
341 3300037418 Ga0395900_0174706 Ga0395900_0174706_472_1371 299
342 3300037418 Ga0395900_0193044 Ga0395900_0193044_68_967 299
343 3300037466 Ga0395898_0010117 Ga0395898_0010117_656_1555 299
344 3300037466 Ga0395898_0093201 Ga0395898_0093201_857_1756 299
345 3300037466 Ga0395898_0202780 Ga0395898_0202780_938_1837 299
346 3300037471 Ga0395905_0004125 Ga0395905_0004125_7695_8594 299
347 3300037471 Ga0395905_0011553 Ga0395905_0011553_5493_6395 299
348 3300037471 Ga0395905_0015707 Ga0395905_0015707_3022_3921 299
349 3300037471 Ga0395905_0036984 Ga0395905_0036984_1912_2811 299
350 3300037471 Ga0395905_0097878 Ga0395905_0097878_544_1443 299
351 3300037471 Ga0395905_0163692 Ga0395905_0163692_586_1485 299
352 3300037471 Ga0395905_0266835 Ga0395905_0266835_449_1348 299
353 3300038443 Ga0395901_0000447 Ga0395901_0000447_43162_44061 299
354 3300038443 Ga0395901_0061277 Ga0395901_0061277_2060_2959 299
355 3300038443 Ga0395901_0077844 Ga0395901_0077844_56_955 299
356 3300038443 Ga0395901_0100630 Ga0395901_0100630_438_1337 299
357 3300039437 Ga0436365_0735741 Ga0436365_0735741_684_1583 299
358 3300042005 Ga0439448_0001796 Ga0439448_0001796_4194_5093 299
359 3300042157 Ga0439458_0000869 Ga0439458_0000869_3879_4778 299
360 3300045976 Ga0466967_0063952 Ga0466967_0063952_1679_2578 299
361 3300045976 Ga0466967_0315653 Ga0466967_0315653_404_1303 299
362 3300046557 Ga0495622_0051376 Ga0495622_0051376_882_1787 299
363 3300046684 Ga0495669_0124017 Ga0495669_0124017_20_940 299
364 3300046692 Ga0495671_0023690 Ga0495671_0023690_1302_2207 299
365 3300048912 Ga0496109_0002390 Ga0496109_0002390_3946_4854 299
366 3300048912 Ga0496109_0008457 Ga0496109_0008457_7547_8446 299
367 3300048912 Ga0496109_0104251 Ga0496109_0104251_660_1559 299
368 3300048913 Ga0496110_0325758 Ga0496110_0325758_305_1204 299
369 3300048914 Ga0496111_0017925 Ga0496111_0017925_3848_4747 299
370 3300048914 Ga0496111_0135398 Ga0496111_0135398_710_1609 299
371 3300048915 Ga0496112_0129220 Ga0496112_0129220_137_1036 299
372 3300048915 Ga0496112_0371034 Ga0496112_0371034_324_1223 299
373 3300048916 Ga0496113_0012937 Ga0496113_0012937_3525_4424 299
374 3300048916 Ga0496113_0041800 Ga0496113_0041800_1019_1918 299
375 3300049574 Ga0501038_0099632 Ga0501038_0099632_1089_1988 299
376 3300053087 Ga0500643_001092 Ga0500643_001092_9559_10641 299
377 3300053118 Ga0500594_0005092 Ga0500594_0005092_50_955 299
378 3300048905 Ga0496102_0000043 Ga0496102_0000043_81764_82666 300
379 3300048906 Ga0496103_0000086 Ga0496103_0000086_27907_28809 300
380 3300048919 Ga0496116_0007459 Ga0496116_0007459_2562_3464 300
381 3300048920 Ga0496117_0000104 Ga0496117_0000104_81764_82666 300
382 3300048921 Ga0496118_0000080 Ga0496118_0000080_106536_107438 300
383 3300048927 Ga0496124_0000093 Ga0496124_0000093_106536_107438 300
384 3300001904 JGI24736J21556_1000050 JGI24736J21556_100005022 301
385 3300001904 JGI24736J21556_1002839 JGI24736J21556_10028392 301
386 3300001976 JGI24752J21851_1000063 JGI24752J21851_10000632 301
387 3300001979 JGI24740J21852_10007380 JGI24740J21852_100073803 301
388 3300002070 JGI24750J21931_1000405 JGI24750J21931_10004057 301
389 3300002074 JGI24748J21848_1000113 JGI24748J21848_100011311 301
390 3300002075 JGI24738J21930_10001588 JGI24738J21930_100015883 301
391 3300002239 JGI24034J26672_10000034 JGI24034J26672_1000003468 301
392 3300002244 JGI24742J22300_10000852 JGI24742J22300_100008522 301
393 3300002459 JGI24751J29686_10002456 JGI24751J29686_100024563 301
394 3300005330 Ga0070690_100000068 Ga0070690_10000006840 301
395 3300005331 Ga0070670_100080450 Ga0070670_1000804503 301
396 3300005335 Ga0070666_10000002 Ga0070666_10000002161 301
397 3300005340 Ga0070689_100002548 Ga0070689_1000025486 301
398 3300005353 Ga0070669_100000055 Ga0070669_100000055118 301
399 3300005355 Ga0070671_100017964 Ga0070671_1000179644 301
400 3300005365 Ga0070688_100006989 Ga0070688_1000069893 301
401 3300005366 Ga0070659_100126604 Ga0070659_1001266043 301
402 3300005367 Ga0070667_100083646 Ga0070667_1000836463 301
403 3300005455 Ga0070663_100030722 Ga0070663_1000307225 301
404 3300005466 Ga0070685_10000337 Ga0070685_1000033728 301
405 3300005535 Ga0070684_100412808 Ga0070684_1004128082 301
406 3300005544 Ga0070686_100000003 Ga0070686_100000003206 301
407 3300005548 Ga0070665_100000036 Ga0070665_100000036178 301
408 3300005577 Ga0068857_100069795 Ga0068857_1000697953 301
409 3300005617 Ga0068859_100082026 Ga0068859_1000820264 301
410 3300005618 Ga0068864_100006618 Ga0068864_1000066182 301
411 3300005719 Ga0068861_100093106 Ga0068861_1000931062 301
412 3300005834 Ga0068851_10037225 Ga0068851_100372252 301
413 3300005841 Ga0068863_100000034 Ga0068863_100000034121 301
414 3300005842 Ga0068858_100011572 Ga0068858_1000115727 301
415 3300005843 Ga0068860_100000001 Ga0068860_100000001162 301
416 3300005844 Ga0068862_100001230 Ga0068862_1000012304 301
417 3300006931 Ga0097620_100082031 Ga0097620_1000820314 301
418 3300009092 Ga0105250_10009842 Ga0105250_100098426 301
419 3300009101 Ga0105247_10018127 Ga0105247_100181272 301
420 3300009177 Ga0105248_10053785 Ga0105248_100537854 301
421 3300009545 Ga0105237_10058417 Ga0105237_100584176 301
422 3300009553 Ga0105249_10000026 Ga0105249_10000026161 301
423 3300013104 Ga0157370_10007621 Ga0157370_100076218 301
424 3300013306 Ga0163162_10080188 Ga0163162_100801883 301
425 3300013306 Ga0163162_10173217 Ga0163162_101732172 301
426 3300014325 Ga0163163_10031056 Ga0163163_100310562 301
427 3300014326 Ga0157380_10005216 Ga0157380_100052169 301
428 3300014968 Ga0157379_10015207 Ga0157379_100152078 301
429 3300017792 Ga0163161_10000008 Ga0163161_10000008146 301
430 3300025900 Ga0207710_10116667 Ga0207710_101166672 301
431 3300025903 Ga0207680_10000004 Ga0207680_10000004698 301
432 3300025904 Ga0207647_10004106 Ga0207647_1000410612 301
433 3300025911 Ga0207654_10001498 Ga0207654_100014988 301
434 3300025913 Ga0207695_10004440 Ga0207695_1000444013 301
435 3300025914 Ga0207671_10003387 Ga0207671_1000338713 301
436 3300025919 Ga0207657_10048370 Ga0207657_100483704 301
437 3300025923 Ga0207681_10000178 Ga0207681_1000017822 301
438 3300025924 Ga0207694_10017125 Ga0207694_100171254 301
439 3300025925 Ga0207650_10053429 Ga0207650_100534293 301
440 3300025931 Ga0207644_10011734 Ga0207644_100117343 301
441 3300025932 Ga0207690_10043295 Ga0207690_100432952 301
442 3300025933 Ga0207706_10053757 Ga0207706_100537572 301
443 3300025936 Ga0207670_10036047 Ga0207670_100360472 301
444 3300025961 Ga0207712_10000001 Ga0207712_10000001572 301
445 3300025981 Ga0207640_10132299 Ga0207640_101322992 301
446 3300025986 Ga0207658_10005800 Ga0207658_1000580011 301
447 3300026035 Ga0207703_10039068 Ga0207703_100390683 301
448 3300026041 Ga0207639_10004054 Ga0207639_100040544 301
449 3300026067 Ga0207678_10034401 Ga0207678_100344014 301
450 3300026078 Ga0207702_10002323 Ga0207702_1000232316 301
451 3300026088 Ga0207641_10000057 Ga0207641_10000057119 301
452 3300026095 Ga0207676_10263799 Ga0207676_102637992 301
453 3300026116 Ga0207674_10083919 Ga0207674_100839195 301
454 3300026118 Ga0207675_100000571 Ga0207675_10000057133 301
455 3300026142 Ga0207698_10008362 Ga0207698_100083624 301
456 3300028379 Ga0268266_10000042 Ga0268266_10000042162 301
457 3300028380 Ga0268265_10000233 Ga0268265_1000023367 301
458 3300028381 Ga0268264_10000006 Ga0268264_10000006698 301
459 3300032005 Ga0307411_10052476 Ga0307411_100524763 301
460 3300046513 Ga0495616_0000887 Ga0495616_0000887_5588_6502 301
461 3300046616 Ga0495668_0031375 Ga0495668_0031375_1218_2132 301
462 3300048905 Ga0496102_0022877 Ga0496102_0022877_379_1284 301
463 3300048906 Ga0496103_0011704 Ga0496103_0011704_3477_4382 301
464 3300048907 Ga0496104_0112979 Ga0496104_0112979_876_1781 301
465 3300048908 Ga0496105_0109301 Ga0496105_0109301_1167_2072 301
466 3300048909 Ga0496106_0158143 Ga0496106_0158143_64_969 301
467 3300048920 Ga0496117_0005462 Ga0496117_0005462_8391_9296 301
468 3300048921 Ga0496118_0048616 Ga0496118_0048616_1547_2452 301
469 3300048924 Ga0496121_0069673 Ga0496121_0069673_1195_2100 301
470 3300053158 Ga0500627_0009380 Ga0500627_0009380_33_947 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00274

Glycolytic

Fructose-bisphosphate aldolase class-I

4

192

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iqt-assembly1.cif.gz_A-2 crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis 0.9798 2 295
2iqt-assembly1.cif.gz_A-2 crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis 0.97 2 295
6ald-assembly1.cif.gz_B rabbit muscle aldolase a/fructose-1,6-bisphosphate complex 0.8564 3 296
6xmh-assembly1.cif.gz_B-2 human aldolase a wild type 0.8549 3 296
3dft-assembly1.cif.gz_C phosphate ions in d33s mutant fructose-1,6-bisphosphate aldolase from rabbit muscle 0.8548 3 297
ID Description Score Start End Superfamily
af_Q2FV17_1_294_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.993 4 295 3.20.20.70
af_Q2FV17_1_294_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.983 4 295 3.20.20.70
af_A0A1D6JVQ3_1_141_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8412 17 140 3.20.20.70
3mbdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8346 5 293 3.20.20.70
af_A0A1D6FD79_26_183_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8138 2 138 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A432GXV0-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 1.002 234 292 GO:0004332
AF-A0A521W7U5-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9974 227 293 GO:0004332
AF-A0A509Y451-F1-model_v4 deleted 0.9967 211 293
AF-A0A7Y2NTH3-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9962 217 292 GO:0004332
AF-A0A1H7A9F4-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) (Fructose-bisphosphate aldolase class I) 0.9951 3 301 GO:0004332
GO:0006096

Feature Viewer

pLDDT pTM Quality
94.75 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map