metagRoot

F450458

General Info

Members	Datasets	Scaffolds	Average Seq Length
470	239	468	361

Family's Representative Sequence

Representative Sequence	3300041486\|Ga0451807_2318568\|Ga0451807_2318568_257_1513
Length	408
Sequence	MPTAAPAAAVMLAACAARDSRRRACRIRLVTEGKIKGFAAETLALPGSTVNPALVVTLGGFVLAFIFGAVANRTNFCTMGAVSDVVNMGSWGRMRMWLLAIAVAILGTHALQLAGLIDVGKSIYVRPNVTWLSYVLGGFLFGVGMTLGSGCGSKTLVRLGGGSLKSLVVFTFLGIAAYMTLKGLFAIWRTRWIDPVATDLASHDIARQDLPTLISAWSGANLANVELAVALTVAIGLLVFVFKDRDFRTSFDHVFGGVVVGLVIVGGWYVTGHIGYGENPETLETVFFSFTAPVAFSLELLMLWSDKSLGPTFGIGATAGIILGSFAYAIASKTFRFEGLAGAEDTANHVVGGLLMGFGGVLALGCTIGQGLSGFSTLAIGSIIAFLSIVAGSALTMRYQYWRMSQGA

Samples

	Sample ID	Description	Type	Environment
1	2547132512	Azospira oryzae 6a3	Isolate	Unclassified
2	2574179768	Azoarcus communis DSM 12120	Isolate	Unclassified
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
9	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
14	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
15	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
16	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
17	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
18	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
19	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
20	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
21	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
24	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
25	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
26	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
27	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
28	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
29	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
30	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
31	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
32	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
33	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
36	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
37	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
38	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
39	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
40	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
41	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
42	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
43	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
44	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
45	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
46	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
47	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
48	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
49	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
50	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
51	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
52	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
53	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
54	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
55	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
56	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
58	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
59	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
60	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
61	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
62	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
65	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
66	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
67	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
69	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
70	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
71	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
73	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
74	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
75	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
76	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
77	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
78	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
81	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
82	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
83	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
84	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
85	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
86	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
87	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
88	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
89	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
90	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
91	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
139	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
140	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
141	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
142	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
143	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
144	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
145	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
146	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
147	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
148	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
149	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
150	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
151	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
152	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
153	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
154	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
155	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
156	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
157	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
158	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
159	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
160	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
161	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
162	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
163	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
164	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
165	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
166	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
167	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
168	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
169	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
170	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
171	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
172	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
173	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
174	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
175	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
176	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
177	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
178	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
179	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
180	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
181	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
182	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
183	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
184	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
185	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
186	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
187	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
188	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
189	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
190	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
191	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
192	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
193	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
194	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
195	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
196	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
197	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
198	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
199	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
200	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
202	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
204	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
205	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
206	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
212	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
213	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
214	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
215	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
216	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
217	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
218	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
219	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
220	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
221	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
228	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
229	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
230	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
231	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
232	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
233	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
234	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
235	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
236	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
237	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
238	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
239	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.36
Metatranscriptomes	0.21
Isolates	0.43

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.49
Nodule	0
Rhizoplane	1.49
Rhizosphere	95.96
Stem	0
Stem Tuber	0
Unclassified	1.06

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065712_10111787	3300005290	Bacteria	1811
2	Ga0065707_10185133	3300005295	Bacteria	1391
3	Ga0070658_10002601	3300005327	Bacteria	15036
4	Ga0070658_10033698	3300005327	Bacteria	4121
5	Ga0070676_10036931	3300005328	Bacteria	2815
6	Ga0070690_100002444	3300005330	Bacteria	9987
7	Ga0068869_100004354	3300005334	Bacteria	8790
8	Ga0068869_100052829	3300005334	Bacteria	2952
9	Ga0070666_10075440	3300005335	Bacteria	2299
10	Ga0070680_100098802	3300005336	Bacteria	2422
11	Ga0070680_100115724	3300005336	Bacteria	2234
12	Ga0068868_100097087	3300005338	Bacteria	2381
13	Ga0068868_100355715	3300005338	Bacteria	1255
14	Ga0070689_100001229	3300005340	Bacteria	16275
15	Ga0070689_100082047	3300005340	Bacteria	2532
16	Ga0070689_100108581	3300005340	Bacteria	2204
17	Ga0070691_10002819	3300005341	Bacteria	7763
18	Ga0070687_100000835	3300005343	Bacteria	10273
19	Ga0070687_100042159	3300005343	Bacteria	2311
20	Ga0070668_100022752	3300005347	Bacteria	4739
21	Ga0070669_100001834	3300005353	Bacteria	15323
22	Ga0070675_100034476	3300005354	Bacteria	4109
23	Ga0070674_100319368	3300005356	Bacteria	1244
24	Ga0070673_100162611	3300005364	Bacteria	1899
25	Ga0070673_100207104	3300005364	Bacteria	1692
26	Ga0070688_100150216	3300005365	Bacteria	1592
27	Ga0070713_100068059	3300005436	Bacteria	3000
28	Ga0070711_100025758	3300005439	Bacteria	3850
29	Ga0070705_100002203	3300005440	Bacteria	9892
30	Ga0070705_100004535	3300005440	Bacteria	6756
31	Ga0070705_100178092	3300005440	Bacteria	1437
32	Ga0070700_100016418	3300005441	Bacteria	4218
33	Ga0070700_100018859	3300005441	Bacteria	3973
34	Ga0070700_100024354	3300005441	Bacteria	3553
35	Ga0070694_100002446	3300005444	Bacteria	10965
36	Ga0070694_100009514	3300005444	Bacteria	5962
37	Ga0070694_100209640	3300005444	Bacteria	1457
38	Ga0070694_100225106	3300005444	Bacteria	1409
39	Ga0070678_100186084	3300005456	Bacteria	1704
40	Ga0070681_10000228	3300005458	Bacteria	44234
41	Ga0070681_10039988	3300005458	Bacteria	4701
42	Ga0070681_10191690	3300005458	Bacteria	1964
43	Ga0068867_100000915	3300005459	Bacteria	20043
44	Ga0068867_100003365	3300005459	Bacteria	11262
45	Ga0068867_100022875	3300005459	Bacteria	4473
46	Ga0068867_100078525	3300005459	Bacteria	2483
47	Ga0070698_100324833	3300005471	Bacteria	1470
48	Ga0070699_100159135	3300005518	Bacteria	1999
49	Ga0070679_100046308	3300005530	Bacteria	4334
50	Ga0070684_100059089	3300005535	Bacteria	3352
51	Ga0070697_100012724	3300005536	Bacteria	6588
52	Ga0070697_100050807	3300005536	Bacteria	3366
53	Ga0068853_100012794	3300005539	Bacteria	6834
54	Ga0070672_100013027	3300005543	Bacteria	5861
55	Ga0070695_100003202	3300005545	Bacteria	9559
56	Ga0070695_100008780	3300005545	Bacteria	6005
57	Ga0070696_100005290	3300005546	Bacteria	8616
58	Ga0070696_100008821	3300005546	Bacteria	6745
59	Ga0070696_100015459	3300005546	Bacteria	5125
60	Ga0070696_100075694	3300005546	Bacteria	2375
61	Ga0070693_100000154	3300005547	Bacteria	31511
62	Ga0070693_100017202	3300005547	Bacteria	3755
63	Ga0070665_100011604	3300005548	Bacteria	8908
64	Ga0070704_100034839	3300005549	Bacteria	3418
65	Ga0068855_100009783	3300005563	Bacteria	11566
66	Ga0068855_100035661	3300005563	Bacteria	5924
67	Ga0068855_100068915	3300005563	Bacteria	4117
68	Ga0068856_100121253	3300005614	Bacteria	2616
69	Ga0068856_100414793	3300005614	Bacteria	1366
70	Ga0070702_100001093	3300005615	Bacteria	10844
71	Ga0070702_100020180	3300005615	Bacteria	3487
72	Ga0070702_100099654	3300005615	Bacteria	1780
73	Ga0068852_100001543	3300005616	Bacteria	15632
74	Ga0068852_100004526	3300005616	Bacteria	9836
75	Ga0068852_100027377	3300005616	Bacteria	4646
76	Ga0068852_100217004	3300005616	Bacteria	1818
77	Ga0068859_100002186	3300005617	Bacteria	19854
78	Ga0068859_100034631	3300005617	Bacteria	5068
79	Ga0068859_100249181	3300005617	Bacteria	1866
80	Ga0068859_100471701	3300005617	Bacteria	1350
81	Ga0068864_100440191	3300005618	Bacteria	1245
82	Ga0068866_10120434	3300005718	Bacteria	1478
83	Ga0068861_100000465	3300005719	Bacteria	23689
84	Ga0068861_100005234	3300005719	Bacteria	8741
85	Ga0068861_100013512	3300005719	Bacteria	5714
86	Ga0068851_10002530	3300005834	Bacteria	8044
87	Ga0068858_100005494	3300005842	Bacteria	12413
88	Ga0068858_100031578	3300005842	Bacteria	4920
89	Ga0068858_100208989	3300005842	Bacteria	1847
90	Ga0068860_100008808	3300005843	Bacteria	10053
91	Ga0068860_100009637	3300005843	Bacteria	9599
92	Ga0068860_100247349	3300005843	Bacteria	1736
93	Ga0068862_100009755	3300005844	Bacteria	7939
94	Ga0068862_100024913	3300005844	Bacteria	5021
95	Ga0068862_100036214	3300005844	Bacteria	4182
96	Ga0068862_100217490	3300005844	Bacteria	1729
97	Ga0068862_100275612	3300005844	Bacteria	1540
98	Ga0070712_100132817	3300006175	Bacteria	1889
99	Ga0075367_10088679	3300006178	Bacteria	1880
100	Ga0075366_10010136	3300006195	Bacteria	5283
101	Ga0075366_10060975	3300006195	Bacteria	2241
102	Ga0097621_100009455	3300006237	Bacteria	7077
103	Ga0097621_100102316	3300006237	Bacteria	2412
104	Ga0097621_100365801	3300006237	Bacteria	1286
105	Ga0075370_10071816	3300006353	Bacteria	1981
106	Ga0068871_100005557	3300006358	Bacteria	8835
107	Ga0068871_100011387	3300006358	Bacteria	6521
108	Ga0068871_100060163	3300006358	Bacteria	3098
109	Ga0068871_100074100	3300006358	Bacteria	2808
110	Ga0068871_100200712	3300006358	Bacteria	1722
111	Ga0075428_100035859	3300006844	Bacteria	5466
112	Ga0075428_100210597	3300006844	Bacteria	2100
113	Ga0075430_100014995	3300006846	Bacteria	6599
114	Ga0075430_100277584	3300006846	Bacteria	1386
115	Ga0075431_100018776	3300006847	Bacteria	7045
116	Ga0075433_10124206	3300006852	Bacteria	2293
117	Ga0075434_100000002	3300006871	Bacteria	135661
118	Ga0075434_100004195	3300006871	Bacteria	12915
119	Ga0075429_100024496	3300006880	Bacteria	5235
120	Ga0068865_100001808	3300006881	Bacteria	12559
121	Ga0068865_100004837	3300006881	Bacteria	8141
122	Ga0068865_100261800	3300006881	Bacteria	1369
123	Ga0075436_100002163	3300006914	Bacteria	13541
124	Ga0075436_100004944	3300006914	Bacteria	9161
125	Ga0075436_100045135	3300006914	Bacteria	3040
126	Ga0075436_100183391	3300006914	Bacteria	1480
127	Ga0097620_100002187	3300006931	Bacteria	19854
128	Ga0097620_100034631	3300006931	Bacteria	5068
129	Ga0097620_100249168	3300006931	Bacteria	1866
130	Ga0097620_100471685	3300006931	Bacteria	1350
131	Ga0075435_100038058	3300007076	Bacteria	3834
132	Ga0075435_100049690	3300007076	Bacteria	3373
133	Ga0075435_100061031	3300007076	Bacteria	3058
134	Ga0075435_100269130	3300007076	Bacteria	1453
135	Ga0099794_10035966	3300007265	Bacteria	2339
136	Ga0099794_10051212	3300007265	Bacteria	1988
137	Ga0105240_10015406	3300009093	Bacteria	10393
138	Ga0105240_10023511	3300009093	Bacteria	8147
139	Ga0111539_10000888	3300009094	Bacteria	39059
140	Ga0111539_10009151	3300009094	Bacteria	12524
141	Ga0111539_10015352	3300009094	Bacteria	9536
142	Ga0111539_10451542	3300009094	Bacteria	1497
143	Ga0105245_10006932	3300009098	Bacteria	9933
144	Ga0105245_10012155	3300009098	Bacteria	7487
145	Ga0105245_10034038	3300009098	Bacteria	4517
146	Ga0105245_10145448	3300009098	Bacteria	2236
147	Ga0105245_10218791	3300009098	Bacteria	1837
148	Ga0105243_10006360	3300009148	Bacteria	9124
149	Ga0105243_10012220	3300009148	Bacteria	6492
150	Ga0105243_10243243	3300009148	Bacteria	1602
151	Ga0105241_10023053	3300009174	Bacteria	4615
152	Ga0105241_10030624	3300009174	Bacteria	4023
153	Ga0105241_10142585	3300009174	Bacteria	1952
154	Ga0105242_10001417	3300009176	Bacteria	18888
155	Ga0105242_10006892	3300009176	Bacteria	8764
156	Ga0105242_10009129	3300009176	Bacteria	7614
157	Ga0105242_10280098	3300009176	Bacteria	1514
158	Ga0105248_10022456	3300009177	Bacteria	6998
159	Ga0105248_10165742	3300009177	Bacteria	2491
160	Ga0105248_10271278	3300009177	Bacteria	1910
161	Ga0105248_10375643	3300009177	Bacteria	1600
162	Ga0105238_10005137	3300009551	Bacteria	12940
163	Ga0105238_10423364	3300009551	Bacteria	1326
164	Ga0105249_10008874	3300009553	Bacteria	8782
165	Ga0105249_10038642	3300009553	Bacteria	4331
166	Ga0105249_10153007	3300009553	Bacteria	2222
167	Ga0105249_10254473	3300009553	Bacteria	1742
168	Ga0157370_10016722	3300013104	Bacteria	7423
169	Ga0157369_10003243	3300013105	Bacteria	19372
170	Ga0157378_10019995	3300013297	Bacteria	5887
171	Ga0157378_10056088	3300013297	Bacteria	3510
172	Ga0157378_10057004	3300013297	Bacteria	3482
173	Ga0157378_10435839	3300013297	Bacteria	1298
174	Ga0163162_10003921	3300013306	Bacteria	14287
175	Ga0163162_10011326	3300013306	Bacteria	8697
176	Ga0163162_10032358	3300013306	Bacteria	5194
177	Ga0163162_10329671	3300013306	Bacteria	1659
178	Ga0157372_10015049	3300013307	Bacteria	8281
179	Ga0157372_10039639	3300013307	Bacteria	5200
180	Ga0157372_10322924	3300013307	Bacteria	1797
181	Ga0157375_10011746	3300013308	Bacteria	7742
182	Ga0157375_10476219	3300013308	Bacteria	1414
183	Ga0157380_10013932	3300014326	Bacteria	5873
184	Ga0157380_10016913	3300014326	Bacteria	5386
185	Ga0157380_10027034	3300014326	Bacteria	4360
186	Ga0157380_10210417	3300014326	Bacteria	1732
187	Ga0157379_10075658	3300014968	Bacteria	3015
188	Ga0157379_10116483	3300014968	Bacteria	2403
189	Ga0157379_10133515	3300014968	Bacteria	2235
190	Ga0157376_10040258	3300014969	Bacteria	3818
191	Ga0163161_10066990	3300017792	Bacteria	2622
192	Ga0206353_11232249	3300020082	Bacteria	1302
193	Ga0213876_10063169	3300021384	Bacteria	1955
194	Ga0207656_10002579	3300025321	Bacteria	6128
195	Ga0207643_10012419	3300025908	Bacteria	4603
196	Ga0207705_10036886	3300025909	Bacteria	3498
197	Ga0207654_10142668	3300025911	Bacteria	1529
198	Ga0207707_10004992	3300025912	Bacteria	11655
199	Ga0207707_10220315	3300025912	Bacteria	1652
200	Ga0207695_10018724	3300025913	Bacteria	7994
201	Ga0207695_10025084	3300025913	Bacteria	6687
202	Ga0207663_10009250	3300025916	Bacteria	5197
203	Ga0207660_10034377	3300025917	Bacteria	3514
204	Ga0207660_10040641	3300025917	Bacteria	3257
205	Ga0207660_10082191	3300025917	Bacteria	2369
206	Ga0207662_10002217	3300025918	Bacteria	9689
207	Ga0207662_10046365	3300025918	Bacteria	2571
208	Ga0207662_10057530	3300025918	Bacteria	2324
209	Ga0207652_10023466	3300025921	Bacteria	5111
210	Ga0207652_10156217	3300025921	Bacteria	2044
211	Ga0207659_10028559	3300025926	Bacteria	3792
212	Ga0207659_10169574	3300025926	Bacteria	1721
213	Ga0207687_10007901	3300025927	Bacteria	6970
214	Ga0207687_10018159	3300025927	Bacteria	4640
215	Ga0207664_10151999	3300025929	Bacteria	1967
216	Ga0207686_10002618	3300025934	Bacteria	9766
217	Ga0207686_10010356	3300025934	Bacteria	5076
218	Ga0207686_10031727	3300025934	Bacteria	3139
219	Ga0207686_10213814	3300025934	Bacteria	1388
220	Ga0207709_10009283	3300025935	Bacteria	5416
221	Ga0207709_10041250	3300025935	Bacteria	2768
222	Ga0207709_10077486	3300025935	Bacteria	2131
223	Ga0207670_10158082	3300025936	Bacteria	1689
224	Ga0207669_10078013	3300025937	Bacteria	2109
225	Ga0207669_10141594	3300025937	Bacteria	1670
226	Ga0207669_10227115	3300025937	Bacteria	1375
227	Ga0207704_10003177	3300025938	Bacteria	7439
228	Ga0207665_10174873	3300025939	Bacteria	1552
229	Ga0207691_10021822	3300025940	Bacteria	6044
230	Ga0207691_10066856	3300025940	Bacteria	3251
231	Ga0207711_10013593	3300025941	Bacteria	6761
232	Ga0207711_10105775	3300025941	Bacteria	2496
233	Ga0207689_10054442	3300025942	Bacteria	3294
234	Ga0207689_10131434	3300025942	Bacteria	2060
235	Ga0207661_10018930	3300025944	Bacteria	5124
236	Ga0207661_10227123	3300025944	Bacteria	1652
237	Ga0207667_10014587	3300025949	Bacteria	8949
238	Ga0207667_10017222	3300025949	Bacteria	8142
239	Ga0207667_10031406	3300025949	Bacteria	5734
240	Ga0207651_10152694	3300025960	Bacteria	1800
241	Ga0207712_10003707	3300025961	Bacteria	9641
242	Ga0207712_10082110	3300025961	Bacteria	2349
243	Ga0207712_10094902	3300025961	Bacteria	2204
244	Ga0207712_10139362	3300025961	Bacteria	1859
245	Ga0207668_10208594	3300025972	Bacteria	1561
246	Ga0207703_10002731	3300026035	Bacteria	15122
247	Ga0207703_10005518	3300026035	Bacteria	10160
248	Ga0207703_10018697	3300026035	Bacteria	5412
249	Ga0207703_10045828	3300026035	Bacteria	3519
250	Ga0207639_10141068	3300026041	Bacteria	2008
251	Ga0207708_10009587	3300026075	Bacteria	7179
252	Ga0207708_10064243	3300026075	Bacteria	2803
253	Ga0207708_10074605	3300026075	Bacteria	2600
254	Ga0207648_10002498	3300026089	Bacteria	19740
255	Ga0207648_10002542	3300026089	Bacteria	19564
256	Ga0207648_10032321	3300026089	Bacteria	4621
257	Ga0207648_10272036	3300026089	Bacteria	1513
258	Ga0207676_10046089	3300026095	Bacteria	3372
259	Ga0207676_10114857	3300026095	Bacteria	2259
260	Ga0207675_100003157	3300026118	Bacteria	16167
261	Ga0207675_100007492	3300026118	Bacteria	10310
262	Ga0207675_100150969	3300026118	Bacteria	2211
263	Ga0207675_100194237	3300026118	Bacteria	1948
264	Ga0207683_10029498	3300026121	Bacteria	4750
265	Ga0207683_10110158	3300026121	Bacteria	2465
266	Ga0207698_10018636	3300026142	Bacteria	4736
267	Ga0207698_10101871	3300026142	Bacteria	2382
268	Ga0207698_10133789	3300026142	Bacteria	2123
269	Ga0209969_1002664	3300027360	Bacteria	2474
270	Ga0209981_1007291	3300027378	Bacteria	1490
271	Ga0210000_1002639	3300027462	Bacteria	2554
272	Ga0210000_1003501	3300027462	Bacteria	2263
273	Ga0209995_1003379	3300027471	Bacteria	2542
274	Ga0209995_1015007	3300027471	Bacteria	1270
275	Ga0209968_1011842	3300027526	Bacteria	1356
276	Ga0209999_1005997	3300027543	Bacteria	2183
277	Ga0209999_1006301	3300027543	Bacteria	2131
278	Ga0209999_1016055	3300027543	Bacteria	1363
279	Ga0209983_1006392	3300027665	Bacteria	2422
280	Ga0209966_1001436	3300027695	Bacteria	4133
281	Ga0207428_10001981	3300027907	Bacteria	20768
282	Ga0207428_10060225	3300027907	Bacteria	3008
283	Ga0268266_10224155	3300028379	Bacteria	1729
284	Ga0268265_10001576	3300028380	Bacteria	18904
285	Ga0268265_10068229	3300028380	Bacteria	2756
286	Ga0268265_10321870	3300028380	Bacteria	1401
287	Ga0268264_10004529	3300028381	Bacteria	11844
288	Ga0265332_10000029	3300031238	Bacteria	180902
289	Ga0307408_100018530	3300031548	Bacteria	4674
290	Ga0316579_10000246	3300031691	Bacteria	16511
291	Ga0316578_10037154	3300031728	Bacteria	2805
292	Ga0307412_10175594	3300031911	Bacteria	1606
293	Ga0307409_100332213	3300031995	Bacteria	1427
294	Ga0307416_100074235	3300032002	Bacteria	2840
295	Ga0307416_100075225	3300032002	Bacteria	2825
296	Ga0307416_100096071	3300032002	Bacteria	2561
297	Ga0307416_100118989	3300032002	Bacteria	2349
298	Ga0307416_100119834	3300032002	Bacteria	2342
299	Ga0316583_10000962	3300032133	Bacteria	9276
300	Ga0373944_0008399	3300035089	Bacteria	2789
301	Ga0373952_0004856	3300035092	Bacteria	2445
302	Ga0373923_0068787	3300035111	Bacteria	1517
303	Ga0373953_0008897	3300035117	Bacteria	3429
304	Ga0373954_0000014	3300035118	Bacteria	71012
305	Ga0373956_0024014	3300035119	Bacteria	2622
306	Ga0373957_0026647	3300035120	Bacteria	2093
307	Ga0373943_0000544	3300035170	Bacteria	16302
308	Ga0373946_0003517	3300035171	Bacteria	5562
309	Ga0373924_0008359	3300035410	Bacteria	3757
310	Ga0373924_0008553	3300035410	Bacteria	3725
311	Ga0373931_0112025	3300035691	Bacteria	1549
312	Ga0373927_0022144	3300035695	Bacteria	4164
313	Ga0373933_0003675	3300035724	Bacteria	8493
314	Ga0373933_0008325	3300035724	Bacteria	5664
315	Ga0373933_0098370	3300035724	Bacteria	1813
316	Ga0373937_0000218	3300036401	Bacteria	55605
317	Ga0373937_0006346	3300036401	Bacteria	10197
318	Ga0373937_0091982	3300036401	Bacteria	2811
319	Ga0316582_0005124	3300036647	Bacteria	6703
320	Ga0316582_0021038	3300036647	Bacteria	3846
321	Ga0316584_0011489	3300036712	Bacteria	6224
322	Ga0373925_0019445	3300037068	Bacteria	4939
323	Ga0436365_0523062	3300039437	Bacteria	9388
324	Ga0439453_0022010	3300041408	Bacteria	1153
325	Ga0439461_0000864	3300041410	Bacteria	4482
326	Ga0451800_0699506	3300041459	Bacteria	1313
327	Ga0451807_2318568	3300041486	Bacteria	1540
328	Ga0451853_2625565	3300041512	Bacteria	4012
329	Ga0439441_000083	3300042001	Bacteria	7364
330	Ga0439441_000466	3300042001	Bacteria	4360
331	Ga0439441_006062	3300042001	Bacteria	1902
332	Ga0439443_003887	3300042003	Bacteria	1915
333	Ga0439443_013819	3300042003	Bacteria	1210
334	Ga0439446_0001331	3300042156	Bacteria	5568
335	Ga0439435_0000755	3300042436	Bacteria	5436
336	Ga0439435_0002293	3300042436	Bacteria	3767
337	Ga0439435_0008866	3300042436	Bacteria	2344
338	Ga0439460_0013703	3300042461	Bacteria	2124
339	Ga0451577_0050140	3300042876	Bacteria	3727
340	Ga0451577_0215577	3300042876	Bacteria	1735
341	Ga0466966_0042357	3300044684	Bacteria	2923
342	Ga0466957_0033768	3300044842	Bacteria	3070
343	Ga0451576_0007799	3300045051	Bacteria	12697
344	Ga0451576_0056576	3300045051	Bacteria	4101
345	Ga0495592_0028702	3300046454	Bacteria	4211
346	Ga0495662_0012088	3300046476	Bacteria	4218
347	Ga0495628_0063492	3300046516	Bacteria	2893
348	Ga0495630_0101713	3300046517	Bacteria	2174
349	Ga0495652_0038182	3300046529	Bacteria	4162
350	Ga0495586_0047607	3300046535	Bacteria	2315
351	Ga0495586_0096345	3300046535	Bacteria	1638
352	Ga0495587_0065724	3300046536	Bacteria	2117
353	Ga0495621_0049659	3300046539	Bacteria	1497
354	Ga0495667_0007046	3300046559	Bacteria	7630
355	Ga0495667_0052660	3300046559	Bacteria	2681
356	Ga0495599_0033701	3300046678	Bacteria	3219
357	Ga0495658_0042989	3300046683	Bacteria	2525
358	Ga0495624_0055582	3300046690	Bacteria	2493
359	Ga0495600_0039978	3300046809	Bacteria	3054
360	Ga0495674_0027923	3300047319	Bacteria	5153
361	Ga0495680_0018614	3300047322	Bacteria	5888
362	Ga0495680_0257784	3300047322	Bacteria	1234
363	Ga0496104_0163263	3300048907	Bacteria	2136
364	Ga0496105_0097896	3300048908	Bacteria	2423
365	Ga0496109_0227823	3300048912	Bacteria	1753
366	Ga0496110_0115557	3300048913	Bacteria	2415
367	Ga0496114_0386564	3300048917	Bacteria	1239
368	Ga0501298_008847	3300049521	Bacteria	1700
369	Ga0501031_0141308	3300049568	Bacteria	1574
370	Ga0501034_0308100	3300049571	Bacteria	1519
371	Ga0501036_0066085	3300049572	Bacteria	3060
372	Ga0501036_0101172	3300049572	Bacteria	2438
373	Ga0501037_0300076	3300049573	Bacteria	1116
374	Ga0501039_0002447	3300049575	Bacteria	13825
375	Ga0501039_0026778	3300049575	Bacteria	4431
376	Ga0501039_0068136	3300049575	Bacteria	2763
377	Ga0501040_0001034	3300049576	Bacteria	17662
378	Ga0501040_0012589	3300049576	Bacteria	5546
379	Ga0501040_0015489	3300049576	Bacteria	5039
380	Ga0501040_0060488	3300049576	Bacteria	2603
381	Ga0501041_0000600	3300049577	Bacteria	18846
382	Ga0501041_0169885	3300049577	Bacteria	1364
383	Ga0501042_0004577	3300049578	Bacteria	8827
384	Ga0501042_0030618	3300049578	Bacteria	3802
385	Ga0501046_0001057	3300049580	Bacteria	26945
386	Ga0501046_0098978	3300049580	Bacteria	2239
387	Ga0501046_0128364	3300049580	Bacteria	1924
388	Ga0501047_0001064	3300049581	Bacteria	27402
389	Ga0501048_0011924	3300049582	Bacteria	6480
390	Ga0501048_0150329	3300049582	Bacteria	1647
391	Ga0501067_0125553	3300049583	Bacteria	1428
392	Ga0501068_0056979	3300049584	Bacteria	2369
393	Ga0501068_0072764	3300049584	Bacteria	2099
394	Ga0501069_0000979	3300049585	Bacteria	13598
395	Ga0501069_0010742	3300049585	Bacteria	4855
396	Ga0501070_0006232	3300049586	Bacteria	10152
397	Ga0501070_0029786	3300049586	Bacteria	4574
398	Ga0501071_0043330	3300049587	Bacteria	3226
399	Ga0501071_0056616	3300049587	Bacteria	2832
400	Ga0501072_0001862	3300049588	Bacteria	15708
401	Ga0501072_0003229	3300049588	Bacteria	12234
402	Ga0501072_0029718	3300049588	Bacteria	4270
403	Ga0501072_0136157	3300049588	Bacteria	1958
404	Ga0501073_0000919	3300049589	Bacteria	21209
405	Ga0501074_0001293	3300049590	Bacteria	16602
406	Ga0501074_0041605	3300049590	Bacteria	3327
407	Ga0501074_0188528	3300049590	Bacteria	1471
408	Ga0501074_0193518	3300049590	Bacteria	1450
409	Ga0501075_0003996	3300049591	Bacteria	9947
410	Ga0501075_0014622	3300049591	Bacteria	5624
411	Ga0501075_0091465	3300049591	Bacteria	2309
412	Ga0501075_0095455	3300049591	Bacteria	2257
413	Ga0501076_0000348	3300049592	Bacteria	28519
414	Ga0501076_0001233	3300049592	Bacteria	17022
415	Ga0501077_0003407	3300049593	Bacteria	9556
416	Ga0501077_0273341	3300049593	Bacteria	1075
417	Ga0501079_0000859	3300049741	Bacteria	20782
418	Ga0501079_0002582	3300049741	Bacteria	13162
419	Ga0501079_0011304	3300049741	Bacteria	6809
420	Ga0501079_0181514	3300049741	Bacteria	1642
421	Ga0501080_0002144	3300049742	Bacteria	17133
422	Ga0501080_0021250	3300049742	Bacteria	6007
423	Ga0501080_0029290	3300049742	Bacteria	5125
424	Ga0501080_0035307	3300049742	Bacteria	4666
425	Ga0501080_0077369	3300049742	Bacteria	3094
426	Ga0501081_0000131	3300049743	Bacteria	33122
427	Ga0501081_0054679	3300049743	Bacteria	2758
428	Ga0501081_0165519	3300049743	Bacteria	1595
429	Ga0501083_0004143	3300049744	Bacteria	10209
430	Ga0501044_0115414	3300049823	Bacteria	2691
431	Ga0501044_0229329	3300049823	Bacteria	1805
432	Ga0501045_0018427	3300049824	Bacteria	4965
433	Ga0501045_0023475	3300049824	Bacteria	4422
434	nmdc:mga0k408_39464_c1	3300050493	Bacteria	2713
435	nmdc:mga0k408_6438_c1	3300050493	Bacteria	6265
436	nmdc:mga0k408_9483_c1	3300050493	Bacteria	5248
437	nmdc:mga09592_147436_c1	3300050508	Bacteria	2029
438	nmdc:mga0qj67_11376_c1	3300050509	Bacteria	6667
439	nmdc:mga0qj67_14513_c1	3300050509	Bacteria	5958
440	nmdc:mga0qj67_352115_c1	3300050509	Bacteria	1190
441	nmdc:mga0qj67_51161_c1	3300050509	Bacteria	3266
442	nmdc:mga06r32_185737_c1	3300050510	Bacteria	2066
443	nmdc:mga08y16_2035_c1	3300050511	Bacteria	20717
444	nmdc:mga08y16_85911_c1	3300050511	Bacteria	3279
445	nmdc:mga0n895_153550_c1	3300050512	Bacteria	2333
446	nmdc:mga0n895_171962_c1	3300050512	Bacteria	2198
447	nmdc:mga0n895_26101_c1	3300050512	Bacteria	5527
448	nmdc:mga0n895_31437_c1	3300050512	Bacteria	5084
449	nmdc:mga0n895_37817_c1	3300050512	Bacteria	4672
450	nmdc:mga0rr50_101192_c1	3300050513	Bacteria	2265
451	nmdc:mga0rr50_318532_c1	3300050513	Bacteria	1303
452	nmdc:mga0rr50_71274_c1	3300050513	Bacteria	2651
453	nmdc:mga0rr50_7960_c1	3300050513	Bacteria	6579
454	nmdc:mga08x19_15428_c1	3300050514	Bacteria	4649
455	nmdc:mga08x19_156173_c1	3300050514	Bacteria	1547
456	nmdc:mga08x19_16521_c1	3300050514	Bacteria	4503
457	nmdc:mga08x19_31488_c1	3300050514	Bacteria	3337
458	nmdc:mga08x19_4644_c1	3300050514	Bacteria	8150
459	nmdc:mga08x19_47815_c1	3300050514	Bacteria	2739
460	nmdc:mga0a205_28794_c1	3300050515	Bacteria	5311
461	nmdc:mga0a205_5275_c1	3300050515	Bacteria	11638
462	Ga0495601_0018997	3300053077	Bacteria	4188
463	Ga0501084_0003474	3300054114	Bacteria	12800
464	Ga0501084_0034745	3300054114	Bacteria	4215
465	Ga0501082_0035381	3300060353	Bacteria	4304
466	Ga0501082_0146774	3300060353	Bacteria	2048
467	Ga0501082_0224882	3300060353	Bacteria	1633
468	Ga0530510_0000425	3300061734	Bacteria	27205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042436	Ga0439435_0002293	Ga0439435_0002293_2839_3753	303
2	3300041408	Ga0439453_0022010	Ga0439453_0022010_195_1142	310
3	3300049591	Ga0501075_0091465	Ga0501075_0091465_20_970	315
4	3300049573	Ga0501037_0300076	Ga0501037_0300076_10_963	316
5	3300049593	Ga0501077_0273341	Ga0501077_0273341_104_1057	316
6	3300050512	nmdc:mga0n895_26101_c1	nmdc:mga0n895_26101_c1_15_1037	324
7	3300036647	Ga0316582_0021038	Ga0316582_0021038_2376_3545	328
8	3300036712	Ga0316584_0011489	Ga0316584_0011489_3930_5099	328
9	3300035120	Ga0373957_0026647	Ga0373957_0026647_1069_2064	330
10	3300035092	Ga0373952_0004856	Ga0373952_0004856_846_1943	331
11	3300047322	Ga0495680_0257784	Ga0495680_0257784_155_1174	331
12	3300050514	nmdc:mga08x19_156173_c1	nmdc:mga08x19_156173_c1_166_1272	335
13	3300035089	Ga0373944_0008399	Ga0373944_0008399_427_1440	336
14	3300035170	Ga0373943_0000544	Ga0373943_0000544_389_1402	336
15	3300035171	Ga0373946_0003517	Ga0373946_0003517_1253_2266	336
16	3300035695	Ga0373927_0022144	Ga0373927_0022144_2379_3392	336
17	3300037068	Ga0373925_0019445	Ga0373925_0019445_869_1882	336
18	3300041459	Ga0451800_0699506	Ga0451800_0699506_70_1083	336
19	3300049581	Ga0501047_0001064	Ga0501047_0001064_26354_27364	336
20	3300050493	nmdc:mga0k408_9483_c1	nmdc:mga0k408_9483_c1_4207_5226	339
21	3300026118	Ga0207675_100150969	Ga0207675_1001509694	340
22	3300032002	Ga0307416_100096071	Ga0307416_1000960713	343
23	3300005328	Ga0070676_10036931	Ga0070676_100369313	344
24	3300005347	Ga0070668_100022752	Ga0070668_1000227522	344
25	3300005441	Ga0070700_100024354	Ga0070700_1000243543	344
26	3300005456	Ga0070678_100186084	Ga0070678_1001860842	344
27	3300005459	Ga0068867_100022875	Ga0068867_1000228752	344
28	3300005543	Ga0070672_100013027	Ga0070672_1000130276	344
29	3300005563	Ga0068855_100035661	Ga0068855_1000356614	344
30	3300005719	Ga0068861_100000465	Ga0068861_10000046522	344
31	3300005842	Ga0068858_100208989	Ga0068858_1002089892	344
32	3300005843	Ga0068860_100008808	Ga0068860_1000088082	344
33	3300005844	Ga0068862_100036214	Ga0068862_1000362141	344
34	3300006881	Ga0068865_100001808	Ga0068865_10000180812	344
35	3300009176	Ga0105242_10280098	Ga0105242_102800982	344
36	3300009553	Ga0105249_10153007	Ga0105249_101530072	344
37	3300013297	Ga0157378_10019995	Ga0157378_100199954	344
38	3300013306	Ga0163162_10003921	Ga0163162_1000392116	344
39	3300013308	Ga0157375_10011746	Ga0157375_100117463	344
40	3300014326	Ga0157380_10016913	Ga0157380_100169137	344
41	3300014968	Ga0157379_10075658	Ga0157379_100756582	344
42	3300025913	Ga0207695_10025084	Ga0207695_100250846	344
43	3300025934	Ga0207686_10213814	Ga0207686_102138142	344
44	3300025937	Ga0207669_10078013	Ga0207669_100780131	344
45	3300025940	Ga0207691_10021822	Ga0207691_100218225	344
46	3300025949	Ga0207667_10014587	Ga0207667_100145874	344
47	3300025961	Ga0207712_10082110	Ga0207712_100821102	344
48	3300025972	Ga0207668_10208594	Ga0207668_102085941	344
49	3300026035	Ga0207703_10018697	Ga0207703_100186977	344
50	3300026075	Ga0207708_10009587	Ga0207708_100095872	344
51	3300026089	Ga0207648_10002498	Ga0207648_1000249820	344
52	3300026118	Ga0207675_100003157	Ga0207675_10000315714	344
53	3300005615	Ga0070702_100099654	Ga0070702_1000996542	345
54	3300009093	Ga0105240_10015406	Ga0105240_1001540611	345
55	3300046476	Ga0495662_0012088	Ga0495662_0012088_2945_4027	348
56	3300046535	Ga0495586_0047607	Ga0495586_0047607_819_1901	348
57	3300046690	Ga0495624_0055582	Ga0495624_0055582_1216_2298	348
58	3300047319	Ga0495674_0027923	Ga0495674_0027923_1612_2694	348
59	3300049823	Ga0501044_0115414	Ga0501044_0115414_14_1063	349
60	3300005563	Ga0068855_100009783	Ga0068855_10000978314	350
61	3300013104	Ga0157370_10016722	Ga0157370_100167226	350
62	3300025949	Ga0207667_10031406	Ga0207667_100314062	350
63	3300005330	Ga0070690_100002444	Ga0070690_10000244412	351
64	3300005334	Ga0068869_100004354	Ga0068869_10000435411	351
65	3300005340	Ga0070689_100001229	Ga0070689_10000122912	351
66	3300005340	Ga0070689_100082047	Ga0070689_1000820472	351
67	3300005341	Ga0070691_10002819	Ga0070691_100028197	351
68	3300005343	Ga0070687_100000835	Ga0070687_10000083512	351
69	3300005354	Ga0070675_100034476	Ga0070675_1000344763	351
70	3300005364	Ga0070673_100162611	Ga0070673_1001626112	351
71	3300005365	Ga0070688_100150216	Ga0070688_1001502162	351
72	3300005440	Ga0070705_100002203	Ga0070705_10000220312	351
73	3300005441	Ga0070700_100018859	Ga0070700_1000188594	351
74	3300005444	Ga0070694_100002446	Ga0070694_10000244612	351
75	3300005444	Ga0070694_100225106	Ga0070694_1002251061	351
76	3300005459	Ga0068867_100003365	Ga0068867_1000033656	351
77	3300005545	Ga0070695_100003202	Ga0070695_10000320212	351
78	3300005546	Ga0070696_100075694	Ga0070696_1000756943	351
79	3300005547	Ga0070693_100000154	Ga0070693_10000015426	351
80	3300005615	Ga0070702_100001093	Ga0070702_10000109310	351
81	3300005617	Ga0068859_100002186	Ga0068859_10000218624	351
82	3300005618	Ga0068864_100440191	Ga0068864_1004401912	351
83	3300005719	Ga0068861_100005234	Ga0068861_10000523411	351
84	3300005842	Ga0068858_100005494	Ga0068858_10000549412	351
85	3300005843	Ga0068860_100009637	Ga0068860_10000963712	351
86	3300005844	Ga0068862_100024913	Ga0068862_1000249136	351
87	3300006178	Ga0075367_10088679	Ga0075367_100886792	351
88	3300006358	Ga0068871_100005557	Ga0068871_1000055579	351
89	3300006852	Ga0075433_10124206	Ga0075433_101242062	351
90	3300006871	Ga0075434_100004195	Ga0075434_10000419512	351
91	3300006881	Ga0068865_100004837	Ga0068865_10000483710	351
92	3300006914	Ga0075436_100004944	Ga0075436_1000049448	351
93	3300006931	Ga0097620_100002187	Ga0097620_10000218724	351
94	3300007076	Ga0075435_100061031	Ga0075435_1000610312	351
95	3300009094	Ga0111539_10015352	Ga0111539_100153522	351
96	3300009098	Ga0105245_10006932	Ga0105245_1000693212	351
97	3300009148	Ga0105243_10006360	Ga0105243_1000636012	351
98	3300009174	Ga0105241_10023053	Ga0105241_100230535	351
99	3300009176	Ga0105242_10006892	Ga0105242_1000689211	351
100	3300009553	Ga0105249_10008874	Ga0105249_100088747	351
101	3300014326	Ga0157380_10027034	Ga0157380_100270342	351
102	3300021384	Ga0213876_10063169	Ga0213876_100631692	351
103	3300025918	Ga0207662_10002217	Ga0207662_100022173	351
104	3300025927	Ga0207687_10007901	Ga0207687_100079016	351
105	3300025934	Ga0207686_10010356	Ga0207686_100103562	351
106	3300025935	Ga0207709_10009283	Ga0207709_100092832	351
107	3300025941	Ga0207711_10105775	Ga0207711_101057753	351
108	3300025949	Ga0207667_10017222	Ga0207667_100172223	351
109	3300026035	Ga0207703_10005518	Ga0207703_100055183	351
110	3300026075	Ga0207708_10074605	Ga0207708_100746052	351
111	3300026089	Ga0207648_10002542	Ga0207648_100025423	351
112	3300026095	Ga0207676_10046089	Ga0207676_100460895	351
113	3300028380	Ga0268265_10068229	Ga0268265_100682292	351
114	3300028380	Ga0268265_10321870	Ga0268265_103218702	351
115	3300028381	Ga0268264_10004529	Ga0268264_100045294	351
116	3300035691	Ga0373931_0112025	Ga0373931_0112025_296_1354	351
117	3300039437	Ga0436365_0523062	Ga0436365_0523062_676_1797	351
118	3300042876	Ga0451577_0050140	Ga0451577_0050140_1643_2701	351
119	3300045051	Ga0451576_0007799	Ga0451576_0007799_11274_12332	351
120	3300050493	nmdc:mga0k408_6438_c1	nmdc:mga0k408_6438_c1_3113_4228	351
121	3300050512	nmdc:mga0n895_31437_c1	nmdc:mga0n895_31437_c1_1787_2845	351
122	3300050513	nmdc:mga0rr50_7960_c1	nmdc:mga0rr50_7960_c1_3634_4692	351
123	3300050514	nmdc:mga08x19_15428_c1	nmdc:mga08x19_15428_c1_1804_2862	351
124	3300050515	nmdc:mga0a205_5275_c1	nmdc:mga0a205_5275_c1_1814_2872	351
125	3300005336	Ga0070680_100098802	Ga0070680_1000988022	353
126	3300005458	Ga0070681_10039988	Ga0070681_100399882	353
127	3300005530	Ga0070679_100046308	Ga0070679_1000463083	353
128	3300006846	Ga0075430_100014995	Ga0075430_1000149953	353
129	3300025917	Ga0207660_10040641	Ga0207660_100406412	353
130	3300025921	Ga0207652_10023466	Ga0207652_100234661	353
131	3300050509	nmdc:mga0qj67_11376_c1	nmdc:mga0qj67_11376_c1_4604_5671	353
132	3300031238	Ga0265332_10000029	Ga0265332_10000029124	354
133	3300032002	Ga0307416_100075225	Ga0307416_1000752254	354
134	3300045051	Ga0451576_0056576	Ga0451576_0056576_119_1189	354
135	3300006844	Ga0075428_100035859	Ga0075428_1000358596	355
136	3300006846	Ga0075430_100277584	Ga0075430_1002775841	355
137	3300027462	Ga0210000_1002639	Ga0210000_10026393	355
138	3300027543	Ga0209999_1016055	Ga0209999_10160552	355
139	3300027665	Ga0209983_1006392	Ga0209983_10063923	355
140	3300027695	Ga0209966_1001436	Ga0209966_10014368	355
141	3300042001	Ga0439441_000466	Ga0439441_000466_441_1511	355
142	3300042003	Ga0439443_013819	Ga0439443_013819_75_1145	355
143	3300050510	nmdc:mga06r32_185737_c1	nmdc:mga06r32_185737_c1_653_1723	355
144	3300042001	Ga0439441_000083	Ga0439441_000083_5791_6900	356
145	3300005336	Ga0070680_100115724	Ga0070680_1001157242	357
146	3300005546	Ga0070696_100015459	Ga0070696_1000154593	357
147	3300025929	Ga0207664_10151999	Ga0207664_101519992	357
148	3300005335	Ga0070666_10075440	Ga0070666_100754402	358
149	3300005340	Ga0070689_100108581	Ga0070689_1001085813	358
150	3300005364	Ga0070673_100207104	Ga0070673_1002071042	358
151	3300005440	Ga0070705_100178092	Ga0070705_1001780922	358
152	3300005548	Ga0070665_100011604	Ga0070665_1000116042	358
153	3300005617	Ga0068859_100471701	Ga0068859_1004717011	358
154	3300005844	Ga0068862_100275612	Ga0068862_1002756121	358
155	3300006237	Ga0097621_100102316	Ga0097621_1001023162	358
156	3300006358	Ga0068871_100074100	Ga0068871_1000741002	358
157	3300006880	Ga0075429_100024496	Ga0075429_1000244963	358
158	3300006914	Ga0075436_100002163	Ga0075436_1000021639	358
159	3300006931	Ga0097620_100471685	Ga0097620_1004716852	358
160	3300009094	Ga0111539_10009151	Ga0111539_1000915115	358
161	3300009177	Ga0105248_10375643	Ga0105248_103756431	358
162	3300014968	Ga0157379_10133515	Ga0157379_101335151	358
163	3300014969	Ga0157376_10040258	Ga0157376_100402584	358
164	3300025918	Ga0207662_10046365	Ga0207662_100463652	358
165	3300025942	Ga0207689_10131434	Ga0207689_101314342	358
166	3300026095	Ga0207676_10114857	Ga0207676_101148572	358
167	3300026121	Ga0207683_10029498	Ga0207683_100294981	358
168	3300027543	Ga0209999_1005997	Ga0209999_10059971	358
169	3300028379	Ga0268266_10224155	Ga0268266_102241552	358
170	3300032002	Ga0307416_100074235	Ga0307416_1000742354	358
171	3300036401	Ga0373937_0091982	Ga0373937_0091982_1607_2689	358
172	3300046454	Ga0495592_0028702	Ga0495592_0028702_938_2020	358
173	3300046516	Ga0495628_0063492	Ga0495628_0063492_185_1267	358
174	3300046517	Ga0495630_0101713	Ga0495630_0101713_798_1880	358
175	3300046529	Ga0495652_0038182	Ga0495652_0038182_2786_3868	358
176	3300046535	Ga0495586_0096345	Ga0495586_0096345_157_1239	358
177	3300046536	Ga0495587_0065724	Ga0495587_0065724_911_1993	358
178	3300046559	Ga0495667_0007046	Ga0495667_0007046_5447_6529	358
179	3300046683	Ga0495658_0042989	Ga0495658_0042989_559_1641	358
180	3300046809	Ga0495600_0039978	Ga0495600_0039978_1133_2215	358
181	3300047322	Ga0495680_0018614	Ga0495680_0018614_3427_4509	358
182	3300048917	Ga0496114_0386564	Ga0496114_0386564_40_1158	358
183	3300049577	Ga0501041_0169885	Ga0501041_0169885_226_1308	358
184	3300049741	Ga0501079_0181514	Ga0501079_0181514_416_1498	358
185	3300049743	Ga0501081_0054679	Ga0501081_0054679_218_1300	358
186	3300050508	nmdc:mga09592_147436_c1	nmdc:mga09592_147436_c1_220_1302	358
187	3300050513	nmdc:mga0rr50_318532_c1	nmdc:mga0rr50_318532_c1_60_1184	358
188	3300060353	Ga0501082_0224882	Ga0501082_0224882_177_1259	358
189	3300005444	Ga0070694_100209640	Ga0070694_1002096402	359
190	3300005458	Ga0070681_10000228	Ga0070681_100002285	359
191	3300006237	Ga0097621_100365801	Ga0097621_1003658012	359
192	3300006871	Ga0075434_100000002	Ga0075434_100000002156	359
193	3300006914	Ga0075436_100183391	Ga0075436_1001833912	359
194	3300007076	Ga0075435_100038058	Ga0075435_1000380588	359
195	3300009098	Ga0105245_10012155	Ga0105245_100121555	359
196	3300009176	Ga0105242_10009129	Ga0105242_100091294	359
197	3300025912	Ga0207707_10004992	Ga0207707_1000499213	359
198	3300025917	Ga0207660_10034377	Ga0207660_100343773	359
199	3300025921	Ga0207652_10156217	Ga0207652_101562172	359
200	3300025927	Ga0207687_10018159	Ga0207687_100181595	359
201	3300049583	Ga0501067_0125553	Ga0501067_0125553_202_1287	359
202	3300049591	Ga0501075_0095455	Ga0501075_0095455_1152_2237	359
203	3300050512	nmdc:mga0n895_37817_c1	nmdc:mga0n895_37817_c1_3480_4565	359
204	3300050514	nmdc:mga08x19_4644_c1	nmdc:mga08x19_4644_c1_5630_6715	359
205	3300050514	nmdc:mga08x19_47815_c1	nmdc:mga08x19_47815_c1_1639_2721	359
206	3300006847	Ga0075431_100018776	Ga0075431_1000187767	360
207	3300031995	Ga0307409_100332213	Ga0307409_1003322132	360
208	3300032002	Ga0307416_100119834	Ga0307416_1001198343	360
209	3300049521	Ga0501298_008847	Ga0501298_008847_161_1246	360
210	3300049575	Ga0501039_0068136	Ga0501039_0068136_151_1239	360
211	3300049587	Ga0501071_0056616	Ga0501071_0056616_118_1206	360
212	3300049588	Ga0501072_0029718	Ga0501072_0029718_1694_2782	360
213	3300049590	Ga0501074_0193518	Ga0501074_0193518_99_1187	360
214	3300049742	Ga0501080_0035307	Ga0501080_0035307_1908_2996	360
215	3300050509	nmdc:mga0qj67_14513_c1	nmdc:mga0qj67_14513_c1_264_1349	360
216	3300005458	Ga0070681_10191690	Ga0070681_101916902	361
217	3300005615	Ga0070702_100020180	Ga0070702_1000201803	361
218	3300007265	Ga0099794_10051212	Ga0099794_100512122	361
219	3300013307	Ga0157372_10322924	Ga0157372_103229242	361
220	3300013308	Ga0157375_10476219	Ga0157375_104762192	361
221	3300025918	Ga0207662_10057530	Ga0207662_100575302	361
222	3300042003	Ga0439443_003887	Ga0439443_003887_345_1436	361
223	3300042436	Ga0439435_0008866	Ga0439435_0008866_338_1429	361
224	3300042461	Ga0439460_0013703	Ga0439460_0013703_929_2020	361
225	3300049572	Ga0501036_0066085	Ga0501036_0066085_231_1322	361
226	3300049575	Ga0501039_0026778	Ga0501039_0026778_1242_2333	361
227	3300049576	Ga0501040_0015489	Ga0501040_0015489_3362_4453	361
228	3300049576	Ga0501040_0060488	Ga0501040_0060488_722_1813	361
229	3300049578	Ga0501042_0030618	Ga0501042_0030618_433_1524	361
230	3300049587	Ga0501071_0043330	Ga0501071_0043330_1010_2101	361
231	3300049588	Ga0501072_0003229	Ga0501072_0003229_8838_9929	361
232	3300049591	Ga0501075_0014622	Ga0501075_0014622_142_1233	361
233	3300049592	Ga0501076_0001233	Ga0501076_0001233_10684_11775	361
234	3300049741	Ga0501079_0011304	Ga0501079_0011304_1642_2733	361
235	3300049742	Ga0501080_0029290	Ga0501080_0029290_1390_2481	361
236	3300049824	Ga0501045_0023475	Ga0501045_0023475_1471_2562	361
237	3300050509	nmdc:mga0qj67_51161_c1	nmdc:mga0qj67_51161_c1_1038_2129	361
238	3300050512	nmdc:mga0n895_153550_c1	nmdc:mga0n895_153550_c1_664_1755	361
239	3300054114	Ga0501084_0034745	Ga0501084_0034745_719_1810	361
240	3300060353	Ga0501082_0035381	Ga0501082_0035381_1067_2158	361
241	3300005353	Ga0070669_100001834	Ga0070669_1000018345	362
242	3300005356	Ga0070674_100319368	Ga0070674_1003193681	362
243	3300005441	Ga0070700_100016418	Ga0070700_1000164184	362
244	3300005459	Ga0068867_100000915	Ga0068867_10000091515	362
245	3300005719	Ga0068861_100013512	Ga0068861_1000135122	362
246	3300005844	Ga0068862_100009755	Ga0068862_1000097557	362
247	3300006844	Ga0075428_100210597	Ga0075428_1002105973	362
248	3300006881	Ga0068865_100261800	Ga0068865_1002618002	362
249	3300007076	Ga0075435_100049690	Ga0075435_1000496906	362
250	3300009094	Ga0111539_10451542	Ga0111539_104515422	362
251	3300009148	Ga0105243_10012220	Ga0105243_100122209	362
252	3300009553	Ga0105249_10038642	Ga0105249_100386422	362
253	3300014326	Ga0157380_10013932	Ga0157380_100139325	362
254	3300025908	Ga0207643_10012419	Ga0207643_100124194	362
255	3300025917	Ga0207660_10082191	Ga0207660_100821912	362
256	3300025926	Ga0207659_10028559	Ga0207659_100285593	362
257	3300025935	Ga0207709_10041250	Ga0207709_100412502	362
258	3300025937	Ga0207669_10141594	Ga0207669_101415942	362
259	3300025938	Ga0207704_10003177	Ga0207704_100031778	362
260	3300025960	Ga0207651_10152694	Ga0207651_101526943	362
261	3300025961	Ga0207712_10003707	Ga0207712_100037073	362
262	3300026075	Ga0207708_10064243	Ga0207708_100642434	362
263	3300026118	Ga0207675_100007492	Ga0207675_1000074922	362
264	3300027360	Ga0209969_1002664	Ga0209969_10026642	362
265	3300027378	Ga0209981_1007291	Ga0209981_10072912	362
266	3300027462	Ga0210000_1003501	Ga0210000_10035012	362
267	3300027471	Ga0209995_1003379	Ga0209995_10033791	362
268	3300027471	Ga0209995_1015007	Ga0209995_10150071	362
269	3300027526	Ga0209968_1011842	Ga0209968_10118422	362
270	3300027543	Ga0209999_1006301	Ga0209999_10063012	362
271	3300027907	Ga0207428_10060225	Ga0207428_100602253	362
272	3300028380	Ga0268265_10001576	Ga0268265_1000157622	362
273	3300032133	Ga0316583_10000962	Ga0316583_100009622	362
274	3300035111	Ga0373923_0068787	Ga0373923_0068787_357_1451	362
275	3300035118	Ga0373954_0000014	Ga0373954_0000014_19790_20884	362
276	3300035410	Ga0373924_0008359	Ga0373924_0008359_214_1308	362
277	3300035724	Ga0373933_0008325	Ga0373933_0008325_1383_2477	362
278	3300036401	Ga0373937_0000218	Ga0373937_0000218_35888_36982	362
279	3300041410	Ga0439461_0000864	Ga0439461_0000864_1679_2797	362
280	3300042156	Ga0439446_0001331	Ga0439446_0001331_2444_3562	362
281	3300042436	Ga0439435_0000755	Ga0439435_0000755_4124_5242	362
282	3300049743	Ga0501081_0165519	Ga0501081_0165519_478_1584	362
283	3300050511	nmdc:mga08y16_85911_c1	nmdc:mga08y16_85911_c1_1502_2596	362
284	3300050513	nmdc:mga0rr50_101192_c1	nmdc:mga0rr50_101192_c1_491_1585	362
285	3300050514	nmdc:mga08x19_16521_c1	nmdc:mga08x19_16521_c1_2880_3974	362
286	iso_pu_bacteria	2574179768	2574429461	362
287	3300005563	Ga0068855_100068915	Ga0068855_1000689152	363
288	iso_pu_bacteria	2547132512	2548846648	363
289	3300005440	Ga0070705_100004535	Ga0070705_1000045356	364
290	3300005444	Ga0070694_100009514	Ga0070694_1000095148	364
291	3300005536	Ga0070697_100050807	Ga0070697_1000508075	364
292	3300005545	Ga0070695_100008780	Ga0070695_1000087802	364
293	3300005546	Ga0070696_100008821	Ga0070696_1000088212	364
294	3300006914	Ga0075436_100045135	Ga0075436_1000451354	364
295	3300013307	Ga0157372_10039639	Ga0157372_100396395	364
296	3300035117	Ga0373953_0008897	Ga0373953_0008897_1668_2768	364
297	3300035119	Ga0373956_0024014	Ga0373956_0024014_1202_2302	364
298	3300035410	Ga0373924_0008553	Ga0373924_0008553_749_1849	364
299	3300035724	Ga0373933_0003675	Ga0373933_0003675_6269_7369	364
300	3300036401	Ga0373937_0006346	Ga0373937_0006346_1058_2158	364
301	3300041486	Ga0451807_2318568	Ga0451807_2318568_257_1513	364
302	3300046559	Ga0495667_0052660	Ga0495667_0052660_486_1586	364
303	3300050514	nmdc:mga08x19_31488_c1	nmdc:mga08x19_31488_c1_1365_2486	364
304	3300005535	Ga0070684_100059089	Ga0070684_1000590895	365
305	3300025912	Ga0207707_10220315	Ga0207707_102203152	365
306	3300025944	Ga0207661_10018930	Ga0207661_100189303	365
307	3300005459	Ga0068867_100078525	Ga0068867_1000785252	366
308	3300005718	Ga0068866_10120434	Ga0068866_101204342	366
309	3300009148	Ga0105243_10243243	Ga0105243_102432431	366
310	3300025935	Ga0207709_10077486	Ga0207709_100774862	366
311	3300009177	Ga0105248_10022456	Ga0105248_100224567	367
312	3300013306	Ga0163162_10032358	Ga0163162_100323586	367
313	3300025941	Ga0207711_10013593	Ga0207711_100135934	367
314	3300049572	Ga0501036_0101172	Ga0501036_0101172_1200_2309	367
315	3300049576	Ga0501040_0012589	Ga0501040_0012589_2196_3305	367
316	3300049580	Ga0501046_0098978	Ga0501046_0098978_209_1318	367
317	3300050513	nmdc:mga0rr50_71274_c1	nmdc:mga0rr50_71274_c1_1123_2235	368
318	3300005844	Ga0068862_100217490	Ga0068862_1002174902	369
319	3300013306	Ga0163162_10329671	Ga0163162_103296713	369
320	3300017792	Ga0163161_10066990	Ga0163161_100669903	369
321	3300025937	Ga0207669_10227115	Ga0207669_102271152	369
322	3300031911	Ga0307412_10175594	Ga0307412_101755942	369
323	3300049568	Ga0501031_0141308	Ga0501031_0141308_18_1133	369
324	3300049571	Ga0501034_0308100	Ga0501034_0308100_43_1152	369
325	3300049575	Ga0501039_0002447	Ga0501039_0002447_12652_13767	369
326	3300049576	Ga0501040_0001034	Ga0501040_0001034_2037_3152	369
327	3300049577	Ga0501041_0000600	Ga0501041_0000600_4326_5441	369
328	3300049578	Ga0501042_0004577	Ga0501042_0004577_4676_5791	369
329	3300049580	Ga0501046_0001057	Ga0501046_0001057_13264_14379	369
330	3300049580	Ga0501046_0128364	Ga0501046_0128364_278_1387	369
331	3300049582	Ga0501048_0011924	Ga0501048_0011924_1089_2204	369
332	3300049582	Ga0501048_0150329	Ga0501048_0150329_372_1481	369
333	3300049584	Ga0501068_0056979	Ga0501068_0056979_90_1205	369
334	3300049584	Ga0501068_0072764	Ga0501068_0072764_808_1917	369
335	3300049585	Ga0501069_0000979	Ga0501069_0000979_1797_2906	369
336	3300049586	Ga0501070_0006232	Ga0501070_0006232_8137_9246	369
337	3300049588	Ga0501072_0001862	Ga0501072_0001862_729_1844	369
338	3300049588	Ga0501072_0136157	Ga0501072_0136157_724_1833	369
339	3300049589	Ga0501073_0000919	Ga0501073_0000919_6936_8045	369
340	3300049590	Ga0501074_0001293	Ga0501074_0001293_906_2015	369
341	3300049590	Ga0501074_0041605	Ga0501074_0041605_591_1706	369
342	3300049591	Ga0501075_0003996	Ga0501075_0003996_3553_4668	369
343	3300049592	Ga0501076_0000348	Ga0501076_0000348_4904_6019	369
344	3300049593	Ga0501077_0003407	Ga0501077_0003407_2135_3250	369
345	3300049741	Ga0501079_0000859	Ga0501079_0000859_7100_8215	369
346	3300049741	Ga0501079_0002582	Ga0501079_0002582_2928_4037	369
347	3300049742	Ga0501080_0002144	Ga0501080_0002144_7684_8793	369
348	3300049742	Ga0501080_0021250	Ga0501080_0021250_4074_5183	369
349	3300049742	Ga0501080_0077369	Ga0501080_0077369_449_1564	369
350	3300049743	Ga0501081_0000131	Ga0501081_0000131_26347_27462	369
351	3300049744	Ga0501083_0004143	Ga0501083_0004143_913_2022	369
352	3300049823	Ga0501044_0229329	Ga0501044_0229329_567_1676	369
353	3300049824	Ga0501045_0018427	Ga0501045_0018427_309_1424	369
354	3300050493	nmdc:mga0k408_39464_c1	nmdc:mga0k408_39464_c1_793_1902	369
355	3300054114	Ga0501084_0003474	Ga0501084_0003474_9212_10327	369
356	3300060353	Ga0501082_0146774	Ga0501082_0146774_224_1333	369
357	3300061734	Ga0530510_0000425	Ga0530510_0000425_16355_17470	369
358	3300005436	Ga0070713_100068059	Ga0070713_1000680593	370
359	3300005439	Ga0070711_100025758	Ga0070711_1000257585	370
360	3300005536	Ga0070697_100012724	Ga0070697_1000127244	370
361	3300006175	Ga0070712_100132817	Ga0070712_1001328172	370
362	3300007265	Ga0099794_10035966	Ga0099794_100359662	370
363	3300025916	Ga0207663_10009250	Ga0207663_100092503	370
364	3300031691	Ga0316579_10000246	Ga0316579_1000024614	370
365	3300031728	Ga0316578_10037154	Ga0316578_100371542	370
366	3300036647	Ga0316582_0005124	Ga0316582_0005124_1078_2196	370
367	3300006195	Ga0075366_10010136	Ga0075366_100101366	371
368	3300006353	Ga0075370_10071816	Ga0075370_100718163	371
369	3300009174	Ga0105241_10142585	Ga0105241_101425852	371
370	3300009176	Ga0105242_10001417	Ga0105242_1000141710	371
371	3300009551	Ga0105238_10423364	Ga0105238_104233641	371
372	3300013306	Ga0163162_10011326	Ga0163162_100113267	371
373	3300014968	Ga0157379_10116483	Ga0157379_101164831	371
374	3300025926	Ga0207659_10169574	Ga0207659_101695742	371
375	3300025934	Ga0207686_10002618	Ga0207686_100026181	371
376	3300025940	Ga0207691_10066856	Ga0207691_100668564	371
377	3300026035	Ga0207703_10002731	Ga0207703_1000273111	371
378	3300026089	Ga0207648_10032321	Ga0207648_100323212	371
379	3300026089	Ga0207648_10272036	Ga0207648_102720362	371
380	3300026121	Ga0207683_10110158	Ga0207683_101101582	371
381	3300005617	Ga0068859_100034631	Ga0068859_1000346315	372
382	3300006931	Ga0097620_100034631	Ga0097620_1000346315	372
383	3300009094	Ga0111539_10000888	Ga0111539_1000088817	372
384	3300009553	Ga0105249_10254473	Ga0105249_102544732	372
385	3300013297	Ga0157378_10056088	Ga0157378_100560883	372
386	3300025942	Ga0207689_10054442	Ga0207689_100544422	372
387	3300025961	Ga0207712_10139362	Ga0207712_101393622	372
388	3300026118	Ga0207675_100194237	Ga0207675_1001942373	372
389	3300027907	Ga0207428_10001981	Ga0207428_1000198117	372
390	3300032002	Ga0307416_100118989	Ga0307416_1001189893	372
391	3300042001	Ga0439441_006062	Ga0439441_006062_441_1559	372
392	3300046539	Ga0495621_0049659	Ga0495621_0049659_172_1290	372
393	3300050509	nmdc:mga0qj67_352115_c1	nmdc:mga0qj67_352115_c1_41_1159	372
394	3300050511	nmdc:mga08y16_2035_c1	nmdc:mga08y16_2035_c1_6589_7707	372
395	3300005295	Ga0065707_10185133	Ga0065707_101851332	373
396	3300005327	Ga0070658_10002601	Ga0070658_100026013	373
397	3300005327	Ga0070658_10033698	Ga0070658_100336985	373
398	3300005338	Ga0068868_100097087	Ga0068868_1000970872	373
399	3300005338	Ga0068868_100355715	Ga0068868_1003557151	373
400	3300005343	Ga0070687_100042159	Ga0070687_1000421593	373
401	3300005471	Ga0070698_100324833	Ga0070698_1003248332	373
402	3300005539	Ga0068853_100012794	Ga0068853_1000127943	373
403	3300005549	Ga0070704_100034839	Ga0070704_1000348394	373
404	3300005614	Ga0068856_100121253	Ga0068856_1001212533	373
405	3300005614	Ga0068856_100414793	Ga0068856_1004147932	373
406	3300005616	Ga0068852_100001543	Ga0068852_10000154320	373
407	3300005616	Ga0068852_100004526	Ga0068852_1000045265	373
408	3300005616	Ga0068852_100027377	Ga0068852_1000273775	373
409	3300005616	Ga0068852_100217004	Ga0068852_1002170042	373
410	3300005834	Ga0068851_10002530	Ga0068851_100025304	373
411	3300006195	Ga0075366_10060975	Ga0075366_100609754	373
412	3300006237	Ga0097621_100009455	Ga0097621_1000094555	373
413	3300006358	Ga0068871_100060163	Ga0068871_1000601633	373
414	3300006358	Ga0068871_100200712	Ga0068871_1002007122	373
415	3300007076	Ga0075435_100269130	Ga0075435_1002691301	373
416	3300009093	Ga0105240_10023511	Ga0105240_100235114	373
417	3300009098	Ga0105245_10218791	Ga0105245_102187913	373
418	3300009174	Ga0105241_10030624	Ga0105241_100306242	373
419	3300009177	Ga0105248_10165742	Ga0105248_101657423	373
420	3300009551	Ga0105238_10005137	Ga0105238_100051374	373
421	3300013105	Ga0157369_10003243	Ga0157369_100032434	373
422	3300013307	Ga0157372_10015049	Ga0157372_100150496	373
423	3300014326	Ga0157380_10210417	Ga0157380_102104172	373
424	3300020082	Ga0206353_11232249	Ga0206353_112322492	373
425	3300025321	Ga0207656_10002579	Ga0207656_100025796	373
426	3300025909	Ga0207705_10036886	Ga0207705_100368863	373
427	3300025911	Ga0207654_10142668	Ga0207654_101426682	373
428	3300025913	Ga0207695_10018724	Ga0207695_100187244	373
429	3300025939	Ga0207665_10174873	Ga0207665_101748732	373
430	3300025944	Ga0207661_10227123	Ga0207661_102271232	373
431	3300026041	Ga0207639_10141068	Ga0207639_101410682	373
432	3300026142	Ga0207698_10018636	Ga0207698_100186364	373
433	3300026142	Ga0207698_10101871	Ga0207698_101018713	373
434	3300026142	Ga0207698_10133789	Ga0207698_101337892	373
435	3300031548	Ga0307408_100018530	Ga0307408_1000185303	373
436	3300041512	Ga0451853_2625565	Ga0451853_2625565_1516_2637	373
437	3300042876	Ga0451577_0215577	Ga0451577_0215577_307_1428	373
438	3300044684	Ga0466966_0042357	Ga0466966_0042357_586_1707	373
439	3300044842	Ga0466957_0033768	Ga0466957_0033768_414_1535	373
440	3300048907	Ga0496104_0163263	Ga0496104_0163263_812_1933	373
441	3300048908	Ga0496105_0097896	Ga0496105_0097896_150_1271	373
442	3300048912	Ga0496109_0227823	Ga0496109_0227823_240_1361	373
443	3300048913	Ga0496110_0115557	Ga0496110_0115557_270_1391	373
444	3300049585	Ga0501069_0010742	Ga0501069_0010742_3121_4242	373
445	3300049586	Ga0501070_0029786	Ga0501070_0029786_1229_2350	373
446	3300049590	Ga0501074_0188528	Ga0501074_0188528_187_1308	373
447	3300005290	Ga0065712_10111787	Ga0065712_101117872	374
448	3300005334	Ga0068869_100052829	Ga0068869_1000528292	374
449	3300005518	Ga0070699_100159135	Ga0070699_1001591352	374
450	3300005546	Ga0070696_100005290	Ga0070696_10000529010	374
451	3300005547	Ga0070693_100017202	Ga0070693_1000172021	374
452	3300005617	Ga0068859_100249181	Ga0068859_1002491812	374
453	3300005842	Ga0068858_100031578	Ga0068858_1000315787	374
454	3300005843	Ga0068860_100247349	Ga0068860_1002473492	374
455	3300006358	Ga0068871_100011387	Ga0068871_1000113877	374
456	3300006931	Ga0097620_100249168	Ga0097620_1002491682	374
457	3300009098	Ga0105245_10034038	Ga0105245_100340385	374
458	3300009098	Ga0105245_10145448	Ga0105245_101454484	374
459	3300009177	Ga0105248_10271278	Ga0105248_102712782	374
460	3300013297	Ga0157378_10057004	Ga0157378_100570041	374
461	3300013297	Ga0157378_10435839	Ga0157378_104358392	374
462	3300025934	Ga0207686_10031727	Ga0207686_100317273	374
463	3300025936	Ga0207670_10158082	Ga0207670_101580822	374
464	3300025961	Ga0207712_10094902	Ga0207712_100949022	374
465	3300026035	Ga0207703_10045828	Ga0207703_100458283	374
466	3300035724	Ga0373933_0098370	Ga0373933_0098370_135_1259	374
467	3300046678	Ga0495599_0033701	Ga0495599_0033701_485_1609	374
468	3300050512	nmdc:mga0n895_171962_c1	nmdc:mga0n895_171962_c1_402_1526	374
469	3300050515	nmdc:mga0a205_28794_c1	nmdc:mga0a205_28794_c1_4046_5170	374
470	3300053077	Ga0495601_0018997	Ga0495601_0018997_2976_4100	374

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04143

Sulf_transp

Sulphur transport

73

395

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6lep-assembly1.cif.gz_A	crystal structure of thiosulfate transporter yeee inactive mutant - c91a	0.8804	13	366
6lep-assembly1.cif.gz_A	crystal structure of thiosulfate transporter yeee inactive mutant - c91a	0.8724	13	366
6leo-assembly1.cif.gz_A	crystal structure of thiosulfate transporter yeee from spirochaeta thermophila	0.8641	13	366
6leo-assembly1.cif.gz_A	crystal structure of thiosulfate transporter yeee from spirochaeta thermophila	0.8565	13	366
5y79-assembly1.cif.gz_B	crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate	0.2962	5	364

ID	Description	Score	Start	End	Superfamily
af_P25744_212_408_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.369	7	328	1.20.1250.20
af_P41036_15_224_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.3355	5	328	1.20.1250.20
af_Q01818_292_487_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.3341	9	339	1.20.1250.20
af_P25744_212_408_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.3335	7	328	1.20.1250.20
4ja3A01	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.3222	5	358	1.20.1250.20

ID	Description	Score	Start	End	GO Terms
AF-A0A847VMR7-F1-model_v4	YeeE/YedE family protein	0.9906	36	372	GO:0005886
AF-A0A537BBN4-F1-model_v4	YeeE/YedE family protein	0.9886	36	374	GO:0005886
AF-A0A536TBA7-F1-model_v4	YeeE/YedE family protein	0.9855	36	370	GO:0005886
AF-A0A3D3DQ60-F1-model_v4	Uncharacterized protein	0.9837	8	370	GO:0005886
AF-A0A537BBN4-F1-model_v4	YeeE/YedE family protein	0.9828	36	374	GO:0005886

Feature Viewer

pLDDT	pTM	Quality
91.04	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450458

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04143

Sulf_transp

Sulphur transport

73

395

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map