F450435

General Info

Members Datasets Scaffolds Average Seq Length
470 232 470 183

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10487380|Ga0307413_104873802
Length 195
Sequence MNPNRSRVTGLLGGTFDPPQAGHVALARAAREKLPIDRLIVLVAAAPGHRAVVAGPETRLRLARLAFDGIADEIVLDPHAFTVDAVRGKSFGEAIFVVGADEGAAFPTWKDPDEVLRWVRLAVGTRSGYPPPDLERYGDRVLAFELPSPAVSSSEVRDRLARGESIEGLVPPAVAAALDETGLYRGYTDREPERT

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
172 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.7
Rhizosphere 87.87
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10202908 3300005327 Bacteria 1673
2 Ga0070683_100003762 3300005329 Bacteria 12384
3 Ga0070683_100393300 3300005329 Unclassified 1322
4 Ga0070690_100255207 3300005330 Bacteria 1242
5 Ga0070666_10441370 3300005335 Unclassified 939
6 Ga0070680_100346604 3300005336 Bacteria 1263
7 Ga0070680_100839143 3300005336 Bacteria 792
8 Ga0070682_100063183 3300005337 Bacteria 2347
9 Ga0070682_100124811 3300005337 Bacteria 1733
10 Ga0070682_100283655 3300005337 Unclassified 1208
11 Ga0068868_100084121 3300005338 Bacteria 2555
12 Ga0068868_100181463 3300005338 Bacteria 1746
13 Ga0068868_100231973 3300005338 Bacteria 1548
14 Ga0068868_100323232 3300005338 Bacteria 1315
15 Ga0070660_100242174 3300005339 Bacteria 1469
16 Ga0070660_100615080 3300005339 Bacteria 909
17 Ga0070691_10214769 3300005341 Unclassified 1016
18 Ga0070691_10519078 3300005341 Unclassified 691
19 Ga0070687_100229445 3300005343 Unclassified 1142
20 Ga0070692_10139015 3300005345 Bacteria 1373
21 Ga0070668_100032616 3300005347 Bacteria 3964
22 Ga0070668_100156097 3300005347 Bacteria 1849
23 Ga0070674_100112206 3300005356 Bacteria 2004
24 Ga0070673_100531211 3300005364 Bacteria 1067
25 Ga0070659_100168983 3300005366 Bacteria 1790
26 Ga0070703_10011160 3300005406 Bacteria 2537
27 Ga0070703_10062313 3300005406 Unclassified 1224
28 Ga0070709_10005956 3300005434 Bacteria 6620
29 Ga0070709_10017392 3300005434 Bacteria 4123
30 Ga0070709_10196347 3300005434 Bacteria 1426
31 Ga0070709_10243753 3300005434 Bacteria 1292
32 Ga0070714_100012599 3300005435 Bacteria 6752
33 Ga0070713_100481745 3300005436 Bacteria 1169
34 Ga0070710_10123962 3300005437 Bacteria 1567
35 Ga0070701_10124189 3300005438 Bacteria 1459
36 Ga0070711_100013007 3300005439 Bacteria 5217
37 Ga0070711_100036017 3300005439 Bacteria 3313
38 Ga0070711_100252364 3300005439 Bacteria 1384
39 Ga0070711_100891986 3300005439 Bacteria 758
40 Ga0070705_100007795 3300005440 Bacteria 5287
41 Ga0070705_100008341 3300005440 Bacteria 5130
42 Ga0070705_100022184 3300005440 Bacteria 3389
43 Ga0070700_100118888 3300005441 Bacteria 1768
44 Ga0070700_100137091 3300005441 Bacteria 1659
45 Ga0070700_100827967 3300005441 Bacteria 748
46 Ga0070694_100038862 3300005444 Bacteria 3164
47 Ga0070708_100108429 3300005445 Bacteria 2550
48 Ga0070663_100006551 3300005455 Bacteria 7017
49 Ga0070678_100023722 3300005456 Bacteria 4093
50 Ga0070678_100174877 3300005456 Bacteria 1752
51 Ga0070678_100582101 3300005456 Unclassified 997
52 Ga0070662_100044601 3300005457 Bacteria 3177
53 Ga0070662_100083097 3300005457 Bacteria 2389
54 Ga0070681_10109698 3300005458 Bacteria 2699
55 Ga0070681_10988434 3300005458 Bacteria 761
56 Ga0068867_100071484 3300005459 Bacteria 2595
57 Ga0068867_100248301 3300005459 Bacteria 1446
58 Ga0068867_100249223 3300005459 Bacteria 1443
59 Ga0068867_100646276 3300005459 Unclassified 928
60 Ga0070706_100026680 3300005467 Bacteria 5315
61 Ga0070706_100077596 3300005467 Bacteria 3075
62 Ga0070706_100196648 3300005467 Bacteria 1883
63 Ga0070707_100005312 3300005468 Bacteria 12053
64 Ga0070707_100206675 3300005468 Bacteria 1914
65 Ga0070707_100473635 3300005468 Bacteria 1214
66 Ga0070707_100628251 3300005468 Bacteria 1037
67 Ga0070698_100082041 3300005471 Bacteria 3217
68 Ga0070698_100143658 3300005471 Bacteria 2336
69 Ga0070698_100272288 3300005471 Bacteria 1625
70 Ga0070698_101122431 3300005471 Bacteria 735
71 Ga0070699_100060067 3300005518 Bacteria 3293
72 Ga0070699_100194636 3300005518 Bacteria 1802
73 Ga0070679_100307878 3300005530 Bacteria 1534
74 Ga0070679_100628439 3300005530 Unclassified 1017
75 Ga0070679_100693755 3300005530 Unclassified 961
76 Ga0070684_100007824 3300005535 Bacteria 8336
77 Ga0070684_100031622 3300005535 Bacteria 4507
78 Ga0070684_100146223 3300005535 Bacteria 2139
79 Ga0070684_100161558 3300005535 Bacteria 2032
80 Ga0070697_100062410 3300005536 Bacteria 3041
81 Ga0070697_100069513 3300005536 Bacteria 2884
82 Ga0070697_100114054 3300005536 Bacteria 2255
83 Ga0070697_100128375 3300005536 Bacteria 2125
84 Ga0070686_100012816 3300005544 Bacteria 4785
85 Ga0070686_100359894 3300005544 Unclassified 1096
86 Ga0070695_100068053 3300005545 Bacteria 2324
87 Ga0070695_100098313 3300005545 Bacteria 1966
88 Ga0070696_100040543 3300005546 Bacteria 3215
89 Ga0070696_100043240 3300005546 Bacteria 3116
90 Ga0070696_100065225 3300005546 Bacteria 2553
91 Ga0070693_100007025 3300005547 Bacteria 5481
92 Ga0070693_100131059 3300005547 Bacteria 1568
93 Ga0070693_100155344 3300005547 Bacteria 1452
94 Ga0070693_100314860 3300005547 Bacteria 1060
95 Ga0070704_100077960 3300005549 Bacteria 2429
96 Ga0070704_100640514 3300005549 Unclassified 937
97 Ga0070704_100927398 3300005549 Bacteria 784
98 Ga0068855_100110790 3300005563 Bacteria 3151
99 Ga0068855_100666103 3300005563 Unclassified 1116
100 Ga0070664_100219613 3300005564 Bacteria 1700
101 Ga0070664_100791783 3300005564 Bacteria 886
102 Ga0068857_100008881 3300005577 Bacteria 8703
103 Ga0068857_100062043 3300005577 Bacteria 3323
104 Ga0068857_100396469 3300005577 Bacteria 1284
105 Ga0068856_101588856 3300005614 Unclassified 667
106 Ga0070702_100049852 3300005615 Bacteria 2389
107 Ga0070702_100077238 3300005615 Bacteria 1984
108 Ga0070702_100107935 3300005615 Bacteria 1720
109 Ga0070702_100257198 3300005615 Bacteria 1187
110 Ga0070702_100283725 3300005615 Unclassified 1138
111 Ga0068852_100132533 3300005616 Bacteria 2297
112 Ga0068852_101154151 3300005616 Bacteria 795
113 Ga0068859_101668609 3300005617 Unclassified 704
114 Ga0068866_10135505 3300005718 Bacteria 1406
115 Ga0068861_100016632 3300005719 Bacteria 5208
116 Ga0068861_100057363 3300005719 Bacteria 2974
117 Ga0068861_100190221 3300005719 Bacteria 1715
118 Ga0068861_100337656 3300005719 Bacteria 1317
119 Ga0068858_100742147 3300005842 Unclassified 956
120 Ga0068860_100115472 3300005843 Bacteria 2567
121 Ga0068860_100233760 3300005843 Bacteria 1787
122 Ga0068862_100112647 3300005844 Bacteria 2389
123 Ga0068862_100696844 3300005844 Bacteria 984
124 Ga0081539_10003990 3300005985 Bacteria 17035
125 Ga0070717_10079859 3300006028 Bacteria 2743
126 Ga0075432_10036064 3300006058 Bacteria 1719
127 Ga0070715_10032313 3300006163 Bacteria 2131
128 Ga0070715_10046564 3300006163 Bacteria 1844
129 Ga0070712_100107775 3300006175 Bacteria 2073
130 Ga0070712_100163196 3300006175 Bacteria 1722
131 Ga0070712_100193427 3300006175 Bacteria 1593
132 Ga0097621_100034316 3300006237 Bacteria 4047
133 Ga0068871_100057131 3300006358 Bacteria 3174
134 Ga0068871_100398531 3300006358 Bacteria 1225
135 Ga0075431_100057987 3300006847 Bacteria 3994
136 Ga0075433_10183926 3300006852 Bacteria 1859
137 Ga0075433_10319924 3300006852 Bacteria 1373
138 Ga0075434_100424050 3300006871 Unclassified 1351
139 Ga0075429_100517726 3300006880 Bacteria 1045
140 Ga0075429_100564668 3300006880 Bacteria 997
141 Ga0068865_100387397 3300006881 Unclassified 1142
142 Ga0075436_100011278 3300006914 Bacteria 6130
143 Ga0075436_100076247 3300006914 Bacteria 2321
144 Ga0075436_100116877 3300006914 Unclassified 1864
145 Ga0075436_100326098 3300006914 Unclassified 1103
146 Ga0097620_101668242 3300006931 Unclassified 704
147 Ga0075435_100026951 3300007076 Bacteria 4490
148 Ga0075435_100057825 3300007076 Bacteria 3138
149 Ga0075435_100174922 3300007076 Bacteria 1812
150 Ga0105240_10153988 3300009093 Bacteria 2736
151 Ga0105240_10361427 3300009093 Bacteria 1644
152 Ga0111539_10025778 3300009094 Bacteria 7200
153 Ga0111539_10585302 3300009094 Unclassified 1300
154 Ga0105245_10029500 3300009098 Bacteria 4847
155 Ga0105245_10037828 3300009098 Bacteria 4291
156 Ga0105245_10329631 3300009098 Bacteria 1506
157 Ga0105245_10917781 3300009098 Bacteria 918
158 Ga0114129_10145480 3300009147 Bacteria 3247
159 Ga0114129_10294168 3300009147 Bacteria 2166
160 Ga0105243_10018503 3300009148 Bacteria 5279
161 Ga0105243_10071510 3300009148 Bacteria 2805
162 Ga0105243_10433564 3300009148 Bacteria 1229
163 Ga0105243_10527823 3300009148 Unclassified 1124
164 Ga0105241_10082506 3300009174 Bacteria 2520
165 Ga0105241_10121805 3300009174 Bacteria 2101
166 Ga0105242_11351772 3300009176 Bacteria 738
167 Ga0105248_10640011 3300009177 Unclassified 1200
168 Ga0105237_10306005 3300009545 Bacteria 1592
169 Ga0105249_10005501 3300009553 Bacteria 10946
170 Ga0105249_10215540 3300009553 Bacteria 1886
171 Ga0105249_10772436 3300009553 Bacteria 1024
172 Ga0105249_12370454 3300009553 Unclassified 603
173 Ga0105239_10153627 3300010375 Bacteria 2569
174 Ga0105239_10938281 3300010375 Bacteria 994
175 Ga0157338_1017165 3300012515 Bacteria 808
176 Ga0157373_10037815 3300013100 Bacteria 3459
177 Ga0157371_10439546 3300013102 Bacteria 958
178 Ga0157378_10428891 3300013297 Bacteria 1308
179 Ga0157378_10852529 3300013297 Bacteria 940
180 Ga0163162_10486222 3300013306 Bacteria 1366
181 Ga0157372_10185879 3300013307 Bacteria 2406
182 Ga0157372_10303120 3300013307 Bacteria 1859
183 Ga0157375_10263252 3300013308 Bacteria 1886
184 Ga0157375_10445758 3300013308 Bacteria 1460
185 Ga0157375_10511229 3300013308 Bacteria 1365
186 Ga0157377_10103066 3300014745 Bacteria 1704
187 Ga0157377_10119896 3300014745 Bacteria 1593
188 Ga0157376_10035691 3300014969 Bacteria 4023
189 Ga0163161_10169661 3300017792 Bacteria 1668
190 Ga0163161_10728454 3300017792 Bacteria 828
191 Ga0207653_10022467 3300025885 Unclassified 2004
192 Ga0207692_10086116 3300025898 Unclassified 1692
193 Ga0207642_10400956 3300025899 Unclassified 821
194 Ga0207688_10030270 3300025901 Bacteria 2984
195 Ga0207685_10104350 3300025905 Bacteria 1218
196 Ga0207699_10099681 3300025906 Bacteria 1841
197 Ga0207684_10109353 3300025910 Bacteria 2366
198 Ga0207654_10030703 3300025911 Bacteria 2952
199 Ga0207654_10519746 3300025911 Bacteria 843
200 Ga0207695_10515962 3300025913 Bacteria 1077
201 Ga0207693_10002382 3300025915 Bacteria 16313
202 Ga0207693_10020573 3300025915 Bacteria 5247
203 Ga0207693_10031153 3300025915 Bacteria 4214
204 Ga0207693_10076327 3300025915 Bacteria 2624
205 Ga0207693_10758473 3300025915 Unclassified 749
206 Ga0207663_10038863 3300025916 Bacteria 2880
207 Ga0207663_10373830 3300025916 Unclassified 1084
208 Ga0207660_10179126 3300025917 Bacteria 1645
209 Ga0207662_10154811 3300025918 Bacteria 1460
210 Ga0207657_10028020 3300025919 Bacteria 5148
211 Ga0207646_10028892 3300025922 Bacteria 5044
212 Ga0207646_10270638 3300025922 Bacteria 1535
213 Ga0207646_10352478 3300025922 Bacteria 1330
214 Ga0207646_10551861 3300025922 Bacteria 1036
215 Ga0207681_10060475 3300025923 Bacteria 2601
216 Ga0207659_11519952 3300025926 Bacteria 572
217 Ga0207687_10029321 3300025927 Bacteria 3701
218 Ga0207687_10271146 3300025927 Bacteria 1357
219 Ga0207687_10681853 3300025927 Bacteria 871
220 Ga0207687_10688563 3300025927 Bacteria 867
221 Ga0207700_10087060 3300025928 Bacteria 2456
222 Ga0207700_10157736 3300025928 Bacteria 1882
223 Ga0207664_10107841 3300025929 Bacteria 2311
224 Ga0207690_10072006 3300025932 Bacteria 2386
225 Ga0207690_10475724 3300025932 Bacteria 1008
226 Ga0207690_11174751 3300025932 Bacteria 640
227 Ga0207706_10001859 3300025933 Bacteria 20681
228 Ga0207706_10229229 3300025933 Bacteria 1626
229 Ga0207686_10123853 3300025934 Bacteria 1764
230 Ga0207686_10221524 3300025934 Bacteria 1366
231 Ga0207686_10747270 3300025934 Bacteria 781
232 Ga0207669_10228296 3300025937 Bacteria 1372
233 Ga0207704_10064151 3300025938 Bacteria 2293
234 Ga0207665_10002122 3300025939 Bacteria 13415
235 Ga0207665_10502937 3300025939 Unclassified 936
236 Ga0207691_10465564 3300025940 Unclassified 1075
237 Ga0207689_10700502 3300025942 Unclassified 854
238 Ga0207661_10032454 3300025944 Bacteria 4046
239 Ga0207661_10410128 3300025944 Bacteria 1229
240 Ga0207679_10067452 3300025945 Bacteria 2684
241 Ga0207667_10068117 3300025949 Bacteria 3707
242 Ga0207667_10125182 3300025949 Bacteria 2647
243 Ga0207667_10194780 3300025949 Bacteria 2079
244 Ga0207667_10255005 3300025949 Bacteria 1794
245 Ga0207667_11273591 3300025949 Unclassified 712
246 Ga0207712_10220899 3300025961 Bacteria 1515
247 Ga0207712_10595620 3300025961 Unclassified 956
248 Ga0207668_10039802 3300025972 Bacteria 3168
249 Ga0207668_11187031 3300025972 Bacteria 686
250 Ga0207640_10063312 3300025981 Bacteria 2457
251 Ga0207677_10079839 3300026023 Bacteria 2341
252 Ga0207677_10171234 3300026023 Bacteria 1698
253 Ga0207677_10317553 3300026023 Bacteria 1293
254 Ga0207677_10939865 3300026023 Bacteria 781
255 Ga0207639_10124938 3300026041 Bacteria 2120
256 Ga0207678_10109294 3300026067 Bacteria 2358
257 Ga0207708_10002458 3300026075 Bacteria 13624
258 Ga0207708_10070886 3300026075 Bacteria 2669
259 Ga0207708_10328633 3300026075 Unclassified 1249
260 Ga0207702_10066736 3300026078 Bacteria 3085
261 Ga0207702_10452091 3300026078 Bacteria 1246
262 Ga0207648_10008245 3300026089 Bacteria 10114
263 Ga0207648_10126122 3300026089 Bacteria 2252
264 Ga0207648_10323651 3300026089 Bacteria 1386
265 Ga0207648_10578815 3300026089 Unclassified 1033
266 Ga0207674_10001139 3300026116 Bacteria 34497
267 Ga0207674_10289434 3300026116 Bacteria 1587
268 Ga0207675_100005395 3300026118 Bacteria 12252
269 Ga0207675_100006012 3300026118 Bacteria 11550
270 Ga0207675_100502206 3300026118 Unclassified 1207
271 Ga0207683_10000656 3300026121 Bacteria 31727
272 Ga0207683_10076708 3300026121 Bacteria 2959
273 Ga0207683_10312495 3300026121 Bacteria 1439
274 Ga0207698_10314580 3300026142 Unclassified 1464
275 Ga0207698_11105642 3300026142 Bacteria 805
276 Ga0207428_10055754 3300027907 Bacteria 3141
277 Ga0207428_10356225 3300027907 Bacteria 1076
278 Ga0268264_10148341 3300028381 Bacteria 2100
279 Ga0268264_10148411 3300028381 Bacteria 2099
280 Ga0265334_10110642 3300028573 Bacteria 987
281 Ga0265336_10084840 3300028666 Bacteria 945
282 Ga0265338_10004996 3300028800 Bacteria 17542
283 Ga0265320_10029510 3300031240 Bacteria 2837
284 Ga0265325_10203139 3300031241 Bacteria 913
285 Ga0265327_10022061 3300031251 Bacteria 3821
286 Ga0265316_10711362 3300031344 Bacteria 707
287 Ga0307413_10487380 3300031824 Bacteria 987
288 Ga0307416_100033921 3300032002 Bacteria 3877
289 Ga0307415_100335304 3300032126 Bacteria 1267
290 Ga0373959_0007016 3300034820 Bacteria 1886
291 Ga0373959_0130616 3300034820 Unclassified 621
292 Ga0373928_0112642 3300035084 Bacteria 721
293 Ga0373928_0141336 3300035084 Unclassified 660
294 Ga0373929_0030032 3300035085 Bacteria 1157
295 Ga0373940_0029312 3300035088 Bacteria 1458
296 Ga0373949_0026740 3300035090 Unclassified 1353
297 Ga0373951_0008979 3300035091 Bacteria 2253
298 Ga0373939_0009741 3300035114 Unclassified 2388
299 Ga0373945_0004317 3300035116 Bacteria 4517
300 Ga0373960_0009363 3300035121 Bacteria 2371
301 Ga0373946_0238509 3300035171 Bacteria 883
302 Ga0373955_0191234 3300035172 Bacteria 1217
303 Ga0373942_0012494 3300035207 Bacteria 2029
304 Ga0373942_0026317 3300035207 Bacteria 1505
305 Ga0373961_0027021 3300035241 Bacteria 1573
306 Ga0373961_0035271 3300035241 Bacteria 1419
307 Ga0373931_0003698 3300035691 Bacteria 6920
308 Ga0373931_0058513 3300035691 Bacteria 2070
309 Ga0373931_0190691 3300035691 Bacteria 1219
310 Ga0373935_0106422 3300035692 Bacteria 1856
311 Ga0373947_0000387 3300035725 Bacteria 24881
312 Ga0373947_0219546 3300035725 Bacteria 1249
313 Ga0373937_0029339 3300036401 Bacteria 4982
314 Ga0373925_0011713 3300037068 Bacteria 6342
315 Ga0373925_0033283 3300037068 Bacteria 3799
316 Ga0395899_0013015 3300037312 Bacteria 6364
317 Ga0395899_0017990 3300037312 Bacteria 5378
318 Ga0395899_0054926 3300037312 Bacteria 2946
319 Ga0395899_0127230 3300037312 Bacteria 1821
320 Ga0395900_0007452 3300037418 Bacteria 11307
321 Ga0395900_0009328 3300037418 Bacteria 10061
322 Ga0395900_0011480 3300037418 Bacteria 9068
323 Ga0395900_0040998 3300037418 Bacteria 4773
324 Ga0395900_0083204 3300037418 Bacteria 3288
325 Ga0395900_0450774 3300037418 Unclassified 1243
326 Ga0395900_0695574 3300037418 Unclassified 950
327 Ga0395900_0865148 3300037418 Unclassified 829
328 Ga0395900_1328135 3300037418 Bacteria 633
329 Ga0395898_0005043 3300037466 Bacteria 14316
330 Ga0395898_0006302 3300037466 Bacteria 12680
331 Ga0395898_0009900 3300037466 Bacteria 9990
332 Ga0395898_0026502 3300037466 Bacteria 5830
333 Ga0395898_0033012 3300037466 Bacteria 5167
334 Ga0395898_0088920 3300037466 Bacteria 2973
335 Ga0395898_0390793 3300037466 Bacteria 1326
336 Ga0395905_0004127 3300037471 Bacteria 15208
337 Ga0395905_0010677 3300037471 Bacteria 8906
338 Ga0395905_0023607 3300037471 Bacteria 5808
339 Ga0395905_0055097 3300037471 Bacteria 3722
340 Ga0395905_0129201 3300037471 Bacteria 2376
341 Ga0395905_0388655 3300037471 Bacteria 1290
342 Ga0395905_0730699 3300037471 Bacteria 892
343 Ga0395901_0003190 3300038443 Bacteria 16503
344 Ga0395901_0007031 3300038443 Bacteria 11373
345 Ga0395901_0009816 3300038443 Bacteria 9705
346 Ga0395901_0028488 3300038443 Bacteria 5743
347 Ga0395901_0057094 3300038443 Bacteria 4060
348 Ga0395901_0409352 3300038443 Bacteria 1392
349 Ga0395901_0912864 3300038443 Unclassified 859
350 Ga0242420_001426 3300038996 Bacteria 3189
351 Ga0451847_0567758 3300041503 Bacteria 877
352 Ga0451853_0245269 3300041512 Bacteria 4591
353 Ga0439448_0011546 3300042005 Bacteria 2634
354 Ga0466964_0006668 3300044706 Bacteria 4305
355 Ga0451576_0037167 3300045051 Bacteria 5158
356 Ga0451576_0165510 3300045051 Bacteria 2308
357 Ga0495603_0000339 3300046455 Bacteria 25130
358 Ga0495641_0001321 3300046461 Bacteria 21234
359 Ga0495641_0515057 3300046461 Bacteria 546
360 Ga0495651_0120693 3300046462 Unclassified 1926
361 Ga0495653_0039131 3300046463 Bacteria 3717
362 Ga0495582_0178909 3300046473 Unclassified 1208
363 Ga0495639_0152910 3300046475 Bacteria 1114
364 Ga0495584_0142113 3300046491 Unclassified 1219
365 Ga0495584_0143827 3300046491 Bacteria 1211
366 Ga0495594_0001020 3300046499 Bacteria 14595
367 Ga0495596_0194599 3300046500 Bacteria 788
368 Ga0495628_0183787 3300046516 Bacteria 1580
369 Ga0495630_0302166 3300046517 Unclassified 1223
370 Ga0495644_0083051 3300046523 Bacteria 1208
371 Ga0495642_0092927 3300046528 Bacteria 1278
372 Ga0495652_0127880 3300046529 Bacteria 2016
373 Ga0495652_0192976 3300046529 Bacteria 1553
374 Ga0495586_0275651 3300046535 Bacteria 962
375 Ga0495609_0213237 3300046538 Unclassified 804
376 Ga0495634_0070534 3300046642 Bacteria 2303
377 Ga0495659_0076763 3300046664 Bacteria 1261
378 Ga0495588_0000863 3300046674 Bacteria 13378
379 Ga0495647_0076154 3300046681 Bacteria 1352
380 Ga0495658_0031745 3300046683 Bacteria 2879
381 Ga0495658_0047018 3300046683 Bacteria 2428
382 Ga0495624_0200575 3300046690 Bacteria 1212
383 Ga0495581_0076146 3300047315 Bacteria 1941
384 Ga0495581_0099845 3300047315 Bacteria 1686
385 Ga0495676_0000942 3300047321 Bacteria 24422
386 Ga0495676_0074771 3300047321 Bacteria 2593
387 Ga0495676_0102630 3300047321 Bacteria 2113
388 Ga0495676_0138291 3300047321 Bacteria 1748
389 Ga0495676_0183210 3300047321 Bacteria 1466
390 Ga0495676_0544448 3300047321 Bacteria 759
391 Ga0495680_0019236 3300047322 Bacteria 5774
392 Ga0495684_0126474 3300047471 Bacteria 1922
393 Ga0495684_0227190 3300047471 Bacteria 1366
394 Ga0495602_0354720 3300048088 Bacteria 1058
395 Ga0496100_0004102 3300048903 Bacteria 7683
396 Ga0496100_0096734 3300048903 Bacteria 2026
397 Ga0496100_0256366 3300048903 Bacteria 1295
398 Ga0496101_0025082 3300048904 Bacteria 4132
399 Ga0496102_0106114 3300048905 Bacteria 2614
400 Ga0496102_0180753 3300048905 Bacteria 1987
401 Ga0496102_0189602 3300048905 Bacteria 1937
402 Ga0496103_0022103 3300048906 Bacteria 3829
403 Ga0496103_0022485 3300048906 Bacteria 3797
404 Ga0496103_0177980 3300048906 Unclassified 1367
405 Ga0496103_0182786 3300048906 Unclassified 1348
406 Ga0496104_0002528 3300048907 Bacteria 15757
407 Ga0496104_0019953 3300048907 Bacteria 6138
408 Ga0496104_0196250 3300048907 Bacteria 1930
409 Ga0496105_0000143 3300048908 Bacteria 47026
410 Ga0496105_0042605 3300048908 Bacteria 3742
411 Ga0496105_0101539 3300048908 Bacteria 2375
412 Ga0496106_0021495 3300048909 Bacteria 4790
413 Ga0496106_0024785 3300048909 Bacteria 4460
414 Ga0496106_0355388 3300048909 Unclassified 1177
415 Ga0496106_0446979 3300048909 Bacteria 1038
416 Ga0496107_0134439 3300048910 Bacteria 1827
417 Ga0496107_0145809 3300048910 Bacteria 1750
418 Ga0496107_0205832 3300048910 Bacteria 1462
419 Ga0496107_0685623 3300048910 Bacteria 754
420 Ga0496108_0000358 3300048911 Bacteria 38553
421 Ga0496109_0000728 3300048912 Bacteria 27411
422 Ga0496109_0129854 3300048912 Bacteria 2351
423 Ga0496109_0395331 3300048912 Unclassified 1306
424 Ga0496110_0000442 3300048913 Bacteria 28245
425 Ga0496110_0051015 3300048913 Bacteria 3635
426 Ga0496110_0160578 3300048913 Bacteria 2037
427 Ga0496110_0175884 3300048913 Unclassified 1943
428 Ga0496110_0240084 3300048913 Bacteria 1649
429 Ga0496110_0241146 3300048913 Bacteria 1645
430 Ga0496110_0250538 3300048913 Bacteria 1612
431 Ga0496110_0257900 3300048913 Bacteria 1587
432 Ga0496111_0000280 3300048914 Bacteria 24699
433 Ga0496111_0104752 3300048914 Bacteria 2081
434 Ga0496111_0302972 3300048914 Bacteria 1185
435 Ga0496112_0000247 3300048915 Bacteria 34526
436 Ga0496112_0015203 3300048915 Bacteria 7174
437 Ga0496112_0046168 3300048915 Bacteria 4271
438 Ga0496112_0174443 3300048915 Bacteria 2115
439 Ga0496112_1292588 3300048915 Unclassified 645
440 Ga0496113_0000870 3300048916 Bacteria 15818
441 Ga0496113_0012922 3300048916 Bacteria 5631
442 Ga0496113_0047086 3300048916 Bacteria 3204
443 Ga0496113_0417146 3300048916 Unclassified 1078
444 Ga0496114_0204001 3300048917 Bacteria 1732
445 Ga0496114_0239478 3300048917 Bacteria 1595
446 Ga0496114_0252524 3300048917 Bacteria 1552
447 Ga0496115_0076723 3300048918 Bacteria 2716
448 Ga0496115_0108936 3300048918 Bacteria 2274
449 Ga0496115_0394487 3300048918 Bacteria 1123
450 Ga0501036_0336088 3300049572 Bacteria 1262
451 Ga0501067_0001771 3300049583 Bacteria 11862
452 Ga0501069_0000368 3300049585 Bacteria 20334
453 Ga0501079_0594656 3300049741 Bacteria 871
454 Ga0501045_0128731 3300049824 Unclassified 1882
455 nmdc:mga05p37_226193_c1 3300050507 Bacteria 2256
456 nmdc:mga05p37_53616_c1 3300050507 Bacteria 4960
457 nmdc:mga05p37_67137_c2 3300050507 Bacteria 2175
458 nmdc:mga06r32_455232_c1 3300050510 Bacteria 1259
459 nmdc:mga08y16_1194863_c1 3300050511 Unclassified 731
460 nmdc:mga08y16_167178_c1 3300050511 Bacteria 2285
461 nmdc:mga08y16_190993_c1 3300050511 Bacteria 2124
462 nmdc:mga0n895_1454680_c1 3300050512 Bacteria 653
463 nmdc:mga0n895_192316_c1 3300050512 Bacteria 2072
464 nmdc:mga0n895_237690_c1 3300050512 Bacteria 1849
465 nmdc:mga0n895_482352_c1 3300050512 Bacteria 1250
466 nmdc:mga0rr50_30434_c1 3300050513 Bacteria 3821
467 nmdc:mga08x19_104550_c1 3300050514 Unclassified 1882
468 nmdc:mga08x19_65182_c1 3300050514 Bacteria 2365
469 nmdc:mga0a205_386864_c1 3300050515 Bacteria 1264
470 Ga0495619_0050083 3300053085 Bacteria 2756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025932 Ga0207690_11174751 Ga0207690_111747512 144
2 3300037312 Ga0395899_0127230 Ga0395899_0127230_120_593 154
3 3300037418 Ga0395900_0011480 Ga0395900_0011480_530_1003 154
4 3300037466 Ga0395898_0005043 Ga0395898_0005043_13276_13749 154
5 3300037471 Ga0395905_0010677 Ga0395905_0010677_7806_8279 154
6 3300038443 Ga0395901_0003190 Ga0395901_0003190_9001_9474 154
7 3300005337 Ga0070682_100063183 Ga0070682_1000631834 167
8 3300005339 Ga0070660_100615080 Ga0070660_1006150802 167
9 3300005458 Ga0070681_10109698 Ga0070681_101096985 167
10 3300005459 Ga0068867_100249223 Ga0068867_1002492234 167
11 3300005530 Ga0070679_100307878 Ga0070679_1003078782 167
12 3300009098 Ga0105245_10037828 Ga0105245_100378286 167
13 3300025917 Ga0207660_10179126 Ga0207660_101791262 167
14 3300025981 Ga0207640_10063312 Ga0207640_100633122 167
15 3300026023 Ga0207677_10317553 Ga0207677_103175534 167
16 3300026089 Ga0207648_10008245 Ga0207648_100082454 167
17 3300026121 Ga0207683_10312495 Ga0207683_103124952 167
18 3300046461 Ga0495641_0515057 Ga0495641_0515057_19_525 167
19 3300048905 Ga0496102_0106114 Ga0496102_0106114_1718_2239 167
20 3300005364 Ga0070673_100531211 Ga0070673_1005312112 168
21 3300032126 Ga0307415_100335304 Ga0307415_1003353043 169
22 3300006914 Ga0075436_100076247 Ga0075436_1000762474 170
23 3300007076 Ga0075435_100026951 Ga0075435_1000269517 170
24 3300025926 Ga0207659_11519952 Ga0207659_115199521 170
25 3300050514 nmdc:mga08x19_65182_c1 nmdc:mga08x19_65182_c1_1763_2329 170
26 3300005546 Ga0070696_100040543 Ga0070696_1000405435 171
27 3300005547 Ga0070693_100131059 Ga0070693_1001310592 171
28 3300014969 Ga0157376_10035691 Ga0157376_100356914 171
29 3300035088 Ga0373940_0029312 Ga0373940_0029312_394_960 171
30 3300042005 Ga0439448_0011546 Ga0439448_0011546_1501_2028 172
31 3300005614 Ga0068856_101588856 Ga0068856_1015888562 173
32 3300005329 Ga0070683_100393300 Ga0070683_1003933003 174
33 3300005337 Ga0070682_100283655 Ga0070682_1002836552 174
34 3300005338 Ga0068868_100084121 Ga0068868_1000841212 174
35 3300005441 Ga0070700_100118888 Ga0070700_1001188882 174
36 3300005535 Ga0070684_100161558 Ga0070684_1001615582 174
37 3300005549 Ga0070704_100077960 Ga0070704_1000779605 174
38 3300005564 Ga0070664_100791783 Ga0070664_1007917832 174
39 3300005615 Ga0070702_100257198 Ga0070702_1002571982 174
40 3300005616 Ga0068852_101154151 Ga0068852_1011541512 174
41 3300006880 Ga0075429_100564668 Ga0075429_1005646682 174
42 3300009098 Ga0105245_10029500 Ga0105245_100295007 174
43 3300013308 Ga0157375_10263252 Ga0157375_102632522 174
44 3300014745 Ga0157377_10119896 Ga0157377_101198962 174
45 3300025901 Ga0207688_10030270 Ga0207688_100302706 174
46 3300025927 Ga0207687_10688563 Ga0207687_106885632 174
47 3300025944 Ga0207661_10032454 Ga0207661_100324542 174
48 3300026023 Ga0207677_10171234 Ga0207677_101712342 174
49 3300026075 Ga0207708_10070886 Ga0207708_100708862 174
50 3300026142 Ga0207698_11105642 Ga0207698_111056422 174
51 3300037418 Ga0395900_0040998 Ga0395900_0040998_1642_2166 174
52 3300037466 Ga0395898_0088920 Ga0395898_0088920_1659_2183 174
53 3300037466 Ga0395898_0390793 Ga0395898_0390793_206_730 174
54 3300037471 Ga0395905_0730699 Ga0395905_0730699_244_786 174
55 3300038443 Ga0395901_0057094 Ga0395901_0057094_2634_3158 174
56 3300038443 Ga0395901_0912864 Ga0395901_0912864_87_611 174
57 3300041512 Ga0451853_0245269 Ga0451853_0245269_93_617 174
58 3300048906 Ga0496103_0177980 Ga0496103_0177980_543_1067 174
59 3300048913 Ga0496110_0257900 Ga0496110_0257900_379_903 174
60 3300049572 Ga0501036_0336088 Ga0501036_0336088_72_596 174
61 3300049741 Ga0501079_0594656 Ga0501079_0594656_224_748 174
62 3300049824 Ga0501045_0128731 Ga0501045_0128731_1344_1868 174
63 3300050510 nmdc:mga06r32_455232_c1 nmdc:mga06r32_455232_c1_160_684 174
64 3300050511 nmdc:mga08y16_1194863_c1 nmdc:mga08y16_1194863_c1_70_594 174
65 3300005329 Ga0070683_100003762 Ga0070683_1000037623 176
66 3300005456 Ga0070678_100582101 Ga0070678_1005821011 176
67 3300005459 Ga0068867_100248301 Ga0068867_1002483012 176
68 3300005471 Ga0070698_100143658 Ga0070698_1001436582 176
69 3300005535 Ga0070684_100007824 Ga0070684_1000078244 176
70 3300005535 Ga0070684_100031622 Ga0070684_1000316223 176
71 3300005564 Ga0070664_100219613 Ga0070664_1002196132 176
72 3300005577 Ga0068857_100008881 Ga0068857_1000088814 176
73 3300005577 Ga0068857_100062043 Ga0068857_1000620433 176
74 3300005577 Ga0068857_100396469 Ga0068857_1003964692 176
75 3300005719 Ga0068861_100190221 Ga0068861_1001902212 176
76 3300007076 Ga0075435_100057825 Ga0075435_1000578255 176
77 3300009148 Ga0105243_10071510 Ga0105243_100715101 176
78 3300025944 Ga0207661_10410128 Ga0207661_104101282 176
79 3300025945 Ga0207679_10067452 Ga0207679_100674522 176
80 3300026078 Ga0207702_10066736 Ga0207702_100667362 176
81 3300026089 Ga0207648_10323651 Ga0207648_103236512 176
82 3300026116 Ga0207674_10001139 Ga0207674_100011396 176
83 3300026116 Ga0207674_10289434 Ga0207674_102894342 176
84 3300026118 Ga0207675_100502206 Ga0207675_1005022062 176
85 3300037312 Ga0395899_0017990 Ga0395899_0017990_1921_2454 176
86 3300037418 Ga0395900_0007452 Ga0395900_0007452_9011_9544 176
87 3300037466 Ga0395898_0033012 Ga0395898_0033012_1850_2383 176
88 3300037471 Ga0395905_0129201 Ga0395905_0129201_1326_1859 176
89 3300038443 Ga0395901_0028488 Ga0395901_0028488_1614_2147 176
90 3300041503 Ga0451847_0567758 Ga0451847_0567758_183_770 176
91 3300046473 Ga0495582_0178909 Ga0495582_0178909_271_804 176
92 3300046683 Ga0495658_0031745 Ga0495658_0031745_59_592 176
93 3300047321 Ga0495676_0074771 Ga0495676_0074771_11_544 176
94 3300047321 Ga0495676_0183210 Ga0495676_0183210_819_1352 176
95 3300047321 Ga0495676_0544448 Ga0495676_0544448_52_585 176
96 3300048912 Ga0496109_0129854 Ga0496109_0129854_843_1376 176
97 3300048913 Ga0496110_0160578 Ga0496110_0160578_1208_1741 176
98 3300048914 Ga0496111_0104752 Ga0496111_0104752_1525_2058 176
99 3300048915 Ga0496112_1292588 Ga0496112_1292588_44_577 176
100 3300048916 Ga0496113_0417146 Ga0496113_0417146_347_880 176
101 3300050513 nmdc:mga0rr50_30434_c1 nmdc:mga0rr50_30434_c1_1840_2373 176
102 3300005337 Ga0070682_100124811 Ga0070682_1001248114 177
103 3300005434 Ga0070709_10005956 Ga0070709_100059568 177
104 3300006028 Ga0070717_10079859 Ga0070717_100798594 177
105 3300009174 Ga0105241_10121805 Ga0105241_101218052 177
106 3300009553 Ga0105249_12370454 Ga0105249_123704541 177
107 3300025915 Ga0207693_10076327 Ga0207693_100763273 177
108 3300026075 Ga0207708_10328633 Ga0207708_103286332 177
109 3300035116 Ga0373945_0004317 Ga0373945_0004317_3159_3698 177
110 3300035692 Ga0373935_0106422 Ga0373935_0106422_1244_1783 177
111 3300035725 Ga0373947_0000387 Ga0373947_0000387_18274_18813 177
112 3300035725 Ga0373947_0219546 Ga0373947_0219546_306_884 177
113 3300037068 Ga0373925_0011713 Ga0373925_0011713_873_1412 177
114 3300046455 Ga0495603_0000339 Ga0495603_0000339_10604_11143 177
115 3300046461 Ga0495641_0001321 Ga0495641_0001321_565_1104 177
116 3300046499 Ga0495594_0001020 Ga0495594_0001020_664_1203 177
117 3300046674 Ga0495588_0000863 Ga0495588_0000863_2473_3012 177
118 3300046681 Ga0495647_0076154 Ga0495647_0076154_79_618 177
119 3300047315 Ga0495581_0099845 Ga0495581_0099845_637_1176 177
120 3300047321 Ga0495676_0000942 Ga0495676_0000942_8805_9344 177
121 3300047321 Ga0495676_0102630 Ga0495676_0102630_885_1463 177
122 3300048903 Ga0496100_0256366 Ga0496100_0256366_29_595 177
123 3300048907 Ga0496104_0196250 Ga0496104_0196250_1058_1624 177
124 3300048908 Ga0496105_0042605 Ga0496105_0042605_307_873 177
125 3300048909 Ga0496106_0024785 Ga0496106_0024785_3091_3657 177
126 3300048910 Ga0496107_0145809 Ga0496107_0145809_587_1153 177
127 3300048913 Ga0496110_0241146 Ga0496110_0241146_134_700 177
128 3300048917 Ga0496114_0204001 Ga0496114_0204001_307_873 177
129 3300048918 Ga0496115_0394487 Ga0496115_0394487_531_1097 177
130 3300047315 Ga0495581_0076146 Ga0495581_0076146_550_1092 178
131 3300005338 Ga0068868_100323232 Ga0068868_1003232323 179
132 3300005406 Ga0070703_10011160 Ga0070703_100111602 179
133 3300005434 Ga0070709_10017392 Ga0070709_100173922 179
134 3300005434 Ga0070709_10243753 Ga0070709_102437532 179
135 3300005439 Ga0070711_100013007 Ga0070711_1000130073 179
136 3300005439 Ga0070711_100036017 Ga0070711_1000360174 179
137 3300005440 Ga0070705_100007795 Ga0070705_1000077952 179
138 3300005440 Ga0070705_100022184 Ga0070705_1000221845 179
139 3300005444 Ga0070694_100038862 Ga0070694_1000388625 179
140 3300005445 Ga0070708_100108429 Ga0070708_1001084292 179
141 3300005456 Ga0070678_100023722 Ga0070678_1000237225 179
142 3300005467 Ga0070706_100077596 Ga0070706_1000775964 179
143 3300005467 Ga0070706_100196648 Ga0070706_1001966483 179
144 3300005468 Ga0070707_100005312 Ga0070707_10000531210 179
145 3300005471 Ga0070698_101122431 Ga0070698_1011224311 179
146 3300005518 Ga0070699_100060067 Ga0070699_1000600672 179
147 3300005518 Ga0070699_100194636 Ga0070699_1001946362 179
148 3300005530 Ga0070679_100628439 Ga0070679_1006284392 179
149 3300005536 Ga0070697_100062410 Ga0070697_1000624106 179
150 3300005536 Ga0070697_100069513 Ga0070697_1000695133 179
151 3300005536 Ga0070697_100114054 Ga0070697_1001140543 179
152 3300005536 Ga0070697_100128375 Ga0070697_1001283756 179
153 3300005545 Ga0070695_100068053 Ga0070695_1000680534 179
154 3300005549 Ga0070704_100927398 Ga0070704_1009273982 179
155 3300005615 Ga0070702_100049852 Ga0070702_1000498522 179
156 3300005615 Ga0070702_100283725 Ga0070702_1002837252 179
157 3300005719 Ga0068861_100057363 Ga0068861_1000573635 179
158 3300005844 Ga0068862_100696844 Ga0068862_1006968442 179
159 3300006058 Ga0075432_10036064 Ga0075432_100360642 179
160 3300006163 Ga0070715_10046564 Ga0070715_100465643 179
161 3300006175 Ga0070712_100107775 Ga0070712_1001077753 179
162 3300006358 Ga0068871_100057131 Ga0068871_1000571313 179
163 3300006847 Ga0075431_100057987 Ga0075431_1000579874 179
164 3300006852 Ga0075433_10183926 Ga0075433_101839262 179
165 3300006871 Ga0075434_100424050 Ga0075434_1004240502 179
166 3300006880 Ga0075429_100517726 Ga0075429_1005177262 179
167 3300006914 Ga0075436_100011278 Ga0075436_1000112781 179
168 3300006914 Ga0075436_100116877 Ga0075436_1001168772 179
169 3300006914 Ga0075436_100326098 Ga0075436_1003260982 179
170 3300007076 Ga0075435_100174922 Ga0075435_1001749221 179
171 3300009094 Ga0111539_10025778 Ga0111539_100257785 179
172 3300009098 Ga0105245_10917781 Ga0105245_109177811 179
173 3300009147 Ga0114129_10145480 Ga0114129_101454803 179
174 3300009147 Ga0114129_10294168 Ga0114129_102941681 179
175 3300009148 Ga0105243_10018503 Ga0105243_100185032 179
176 3300009148 Ga0105243_10433564 Ga0105243_104335642 179
177 3300009553 Ga0105249_10772436 Ga0105249_107724362 179
178 3300013297 Ga0157378_10852529 Ga0157378_108525292 179
179 3300013308 Ga0157375_10511229 Ga0157375_105112292 179
180 3300017792 Ga0163161_10728454 Ga0163161_107284542 179
181 3300025885 Ga0207653_10022467 Ga0207653_100224673 179
182 3300025898 Ga0207692_10086116 Ga0207692_100861162 179
183 3300025905 Ga0207685_10104350 Ga0207685_101043502 179
184 3300025910 Ga0207684_10109353 Ga0207684_101093534 179
185 3300025915 Ga0207693_10002382 Ga0207693_100023826 179
186 3300025915 Ga0207693_10020573 Ga0207693_100205731 179
187 3300025915 Ga0207693_10758473 Ga0207693_107584732 179
188 3300025916 Ga0207663_10373830 Ga0207663_103738302 179
189 3300025922 Ga0207646_10028892 Ga0207646_100288926 179
190 3300025922 Ga0207646_10270638 Ga0207646_102706382 179
191 3300025927 Ga0207687_10681853 Ga0207687_106818531 179
192 3300025928 Ga0207700_10157736 Ga0207700_101577363 179
193 3300025932 Ga0207690_10475724 Ga0207690_104757242 179
194 3300025934 Ga0207686_10221524 Ga0207686_102215244 179
195 3300025939 Ga0207665_10502937 Ga0207665_105029372 179
196 3300025949 Ga0207667_10125182 Ga0207667_101251823 179
197 3300025972 Ga0207668_10039802 Ga0207668_100398025 179
198 3300026118 Ga0207675_100006012 Ga0207675_1000060124 179
199 3300026121 Ga0207683_10076708 Ga0207683_100767084 179
200 3300027907 Ga0207428_10055754 Ga0207428_100557542 179
201 3300034820 Ga0373959_0130616 Ga0373959_0130616_53_601 179
202 3300035084 Ga0373928_0141336 Ga0373928_0141336_79_627 179
203 3300035090 Ga0373949_0026740 Ga0373949_0026740_750_1298 179
204 3300035091 Ga0373951_0008979 Ga0373951_0008979_1091_1639 179
205 3300035114 Ga0373939_0009741 Ga0373939_0009741_26_574 179
206 3300035121 Ga0373960_0009363 Ga0373960_0009363_1000_1548 179
207 3300035207 Ga0373942_0012494 Ga0373942_0012494_21_569 179
208 3300035241 Ga0373961_0035271 Ga0373961_0035271_34_582 179
209 3300035691 Ga0373931_0003698 Ga0373931_0003698_276_824 179
210 3300037312 Ga0395899_0013015 Ga0395899_0013015_4602_5150 179
211 3300037418 Ga0395900_0083204 Ga0395900_0083204_133_681 179
212 3300037418 Ga0395900_0695574 Ga0395900_0695574_165_713 179
213 3300037466 Ga0395898_0009900 Ga0395898_0009900_238_786 179
214 3300037466 Ga0395898_0026502 Ga0395898_0026502_125_673 179
215 3300037471 Ga0395905_0023607 Ga0395905_0023607_2297_2845 179
216 3300037471 Ga0395905_0055097 Ga0395905_0055097_2757_3305 179
217 3300038443 Ga0395901_0007031 Ga0395901_0007031_7793_8341 179
218 3300038443 Ga0395901_0409352 Ga0395901_0409352_352_900 179
219 3300038996 Ga0242420_001426 Ga0242420_001426_60_611 179
220 3300046528 Ga0495642_0092927 Ga0495642_0092927_523_1071 179
221 3300048903 Ga0496100_0004102 Ga0496100_0004102_987_1535 179
222 3300048904 Ga0496101_0025082 Ga0496101_0025082_1756_2304 179
223 3300048905 Ga0496102_0189602 Ga0496102_0189602_498_1046 179
224 3300048906 Ga0496103_0022103 Ga0496103_0022103_2640_3188 179
225 3300048906 Ga0496103_0182786 Ga0496103_0182786_660_1208 179
226 3300048907 Ga0496104_0019953 Ga0496104_0019953_2862_3410 179
227 3300048908 Ga0496105_0101539 Ga0496105_0101539_908_1456 179
228 3300048909 Ga0496106_0021495 Ga0496106_0021495_4058_4606 179
229 3300048909 Ga0496106_0446979 Ga0496106_0446979_368_916 179
230 3300048910 Ga0496107_0134439 Ga0496107_0134439_1075_1623 179
231 3300048910 Ga0496107_0205832 Ga0496107_0205832_47_595 179
232 3300048913 Ga0496110_0051015 Ga0496110_0051015_932_1480 179
233 3300048913 Ga0496110_0240084 Ga0496110_0240084_700_1248 179
234 3300048914 Ga0496111_0302972 Ga0496111_0302972_144_692 179
235 3300048915 Ga0496112_0046168 Ga0496112_0046168_185_733 179
236 3300048916 Ga0496113_0012922 Ga0496113_0012922_3913_4461 179
237 3300048917 Ga0496114_0239478 Ga0496114_0239478_119_667 179
238 3300048918 Ga0496115_0076723 Ga0496115_0076723_265_813 179
239 3300050507 nmdc:mga05p37_226193_c1 nmdc:mga05p37_226193_c1_228_776 179
240 3300050507 nmdc:mga05p37_53616_c1 nmdc:mga05p37_53616_c1_722_1270 179
241 3300050507 nmdc:mga05p37_67137_c2 nmdc:mga05p37_67137_c2_451_999 179
242 3300050511 nmdc:mga08y16_167178_c1 nmdc:mga08y16_167178_c1_1449_1997 179
243 3300050512 nmdc:mga0n895_1454680_c1 nmdc:mga0n895_1454680_c1_75_623 179
244 3300050512 nmdc:mga0n895_192316_c1 nmdc:mga0n895_192316_c1_1450_1998 179
245 3300050512 nmdc:mga0n895_237690_c1 nmdc:mga0n895_237690_c1_597_1145 179
246 3300050514 nmdc:mga08x19_104550_c1 nmdc:mga08x19_104550_c1_932_1480 179
247 3300050515 nmdc:mga0a205_386864_c1 nmdc:mga0a205_386864_c1_359_907 179
248 3300005985 Ga0081539_10003990 Ga0081539_100039908 182
249 3300035171 Ga0373946_0238509 Ga0373946_0238509_260_826 183
250 3300037068 Ga0373925_0033283 Ga0373925_0033283_507_1064 183
251 3300046475 Ga0495639_0152910 Ga0495639_0152910_342_899 183
252 3300046690 Ga0495624_0200575 Ga0495624_0200575_583_1140 183
253 3300047321 Ga0495676_0138291 Ga0495676_0138291_309_866 183
254 3300049583 Ga0501067_0001771 Ga0501067_0001771_3134_3703 183
255 3300049585 Ga0501069_0000368 Ga0501069_0000368_10286_10855 183
256 3300005468 Ga0070707_100206675 Ga0070707_1002066753 184
257 3300005471 Ga0070698_100272288 Ga0070698_1002722883 184
258 3300005535 Ga0070684_100146223 Ga0070684_1001462234 184
259 3300005547 Ga0070693_100314860 Ga0070693_1003148602 184
260 3300005842 Ga0068858_100742147 Ga0068858_1007421472 184
261 3300013102 Ga0157371_10439546 Ga0157371_104395461 184
262 3300013307 Ga0157372_10303120 Ga0157372_103031202 184
263 3300025922 Ga0207646_10551861 Ga0207646_105518612 184
264 3300025928 Ga0207700_10087060 Ga0207700_100870602 184
265 3300025932 Ga0207690_10072006 Ga0207690_100720061 184
266 3300025949 Ga0207667_10255005 Ga0207667_102550052 184
267 3300026023 Ga0207677_10079839 Ga0207677_100798394 184
268 3300026078 Ga0207702_10452091 Ga0207702_104520912 184
269 3300028573 Ga0265334_10110642 Ga0265334_101106422 184
270 3300031240 Ga0265320_10029510 Ga0265320_100295102 184
271 3300031241 Ga0265325_10203139 Ga0265325_102031392 184
272 3300031344 Ga0265316_10711362 Ga0265316_107113621 184
273 3300037418 Ga0395900_0450774 Ga0395900_0450774_399_968 184
274 3300048903 Ga0496100_0096734 Ga0496100_0096734_1282_1842 184
275 3300048907 Ga0496104_0002528 Ga0496104_0002528_3773_4333 184
276 3300048908 Ga0496105_0000143 Ga0496105_0000143_8840_9400 184
277 3300048911 Ga0496108_0000358 Ga0496108_0000358_20403_20963 184
278 3300048912 Ga0496109_0000728 Ga0496109_0000728_5388_5948 184
279 3300048912 Ga0496109_0395331 Ga0496109_0395331_359_928 184
280 3300048913 Ga0496110_0000442 Ga0496110_0000442_26473_27033 184
281 3300048913 Ga0496110_0175884 Ga0496110_0175884_1175_1744 184
282 3300048914 Ga0496111_0000280 Ga0496111_0000280_10953_11513 184
283 3300048915 Ga0496112_0000247 Ga0496112_0000247_21295_21855 184
284 3300048915 Ga0496112_0174443 Ga0496112_0174443_803_1372 184
285 3300048916 Ga0496113_0000870 Ga0496113_0000870_10920_11480 184
286 3300048916 Ga0496113_0047086 Ga0496113_0047086_1037_1606 184
287 3300005330 Ga0070690_100255207 Ga0070690_1002552072 185
288 3300005335 Ga0070666_10441370 Ga0070666_104413702 185
289 3300005336 Ga0070680_100346604 Ga0070680_1003466042 185
290 3300005336 Ga0070680_100839143 Ga0070680_1008391431 185
291 3300005338 Ga0068868_100181463 Ga0068868_1001814634 185
292 3300005338 Ga0068868_100231973 Ga0068868_1002319732 185
293 3300005339 Ga0070660_100242174 Ga0070660_1002421742 185
294 3300005341 Ga0070691_10214769 Ga0070691_102147691 185
295 3300005341 Ga0070691_10519078 Ga0070691_105190781 185
296 3300005343 Ga0070687_100229445 Ga0070687_1002294452 185
297 3300005345 Ga0070692_10139015 Ga0070692_101390152 185
298 3300005347 Ga0070668_100032616 Ga0070668_1000326163 185
299 3300005347 Ga0070668_100156097 Ga0070668_1001560972 185
300 3300005356 Ga0070674_100112206 Ga0070674_1001122062 185
301 3300005366 Ga0070659_100168983 Ga0070659_1001689832 185
302 3300005406 Ga0070703_10062313 Ga0070703_100623131 185
303 3300005434 Ga0070709_10196347 Ga0070709_101963473 185
304 3300005435 Ga0070714_100012599 Ga0070714_1000125992 185
305 3300005436 Ga0070713_100481745 Ga0070713_1004817452 185
306 3300005437 Ga0070710_10123962 Ga0070710_101239623 185
307 3300005438 Ga0070701_10124189 Ga0070701_101241892 185
308 3300005439 Ga0070711_100252364 Ga0070711_1002523642 185
309 3300005439 Ga0070711_100891986 Ga0070711_1008919862 185
310 3300005440 Ga0070705_100008341 Ga0070705_1000083412 185
311 3300005441 Ga0070700_100137091 Ga0070700_1001370912 185
312 3300005441 Ga0070700_100827967 Ga0070700_1008279672 185
313 3300005455 Ga0070663_100006551 Ga0070663_1000065516 185
314 3300005456 Ga0070678_100174877 Ga0070678_1001748772 185
315 3300005457 Ga0070662_100044601 Ga0070662_1000446014 185
316 3300005457 Ga0070662_100083097 Ga0070662_1000830972 185
317 3300005458 Ga0070681_10988434 Ga0070681_109884342 185
318 3300005459 Ga0068867_100071484 Ga0068867_1000714842 185
319 3300005459 Ga0068867_100646276 Ga0068867_1006462762 185
320 3300005467 Ga0070706_100026680 Ga0070706_1000266806 185
321 3300005468 Ga0070707_100473635 Ga0070707_1004736352 185
322 3300005468 Ga0070707_100628251 Ga0070707_1006282512 185
323 3300005471 Ga0070698_100082041 Ga0070698_1000820412 185
324 3300005544 Ga0070686_100012816 Ga0070686_1000128162 185
325 3300005544 Ga0070686_100359894 Ga0070686_1003598941 185
326 3300005545 Ga0070695_100098313 Ga0070695_1000983132 185
327 3300005546 Ga0070696_100043240 Ga0070696_1000432405 185
328 3300005546 Ga0070696_100065225 Ga0070696_1000652253 185
329 3300005547 Ga0070693_100007025 Ga0070693_1000070256 185
330 3300005547 Ga0070693_100155344 Ga0070693_1001553442 185
331 3300005549 Ga0070704_100640514 Ga0070704_1006405141 185
332 3300005563 Ga0068855_100110790 Ga0068855_1001107901 185
333 3300005563 Ga0068855_100666103 Ga0068855_1006661032 185
334 3300005615 Ga0070702_100077238 Ga0070702_1000772382 185
335 3300005615 Ga0070702_100107935 Ga0070702_1001079352 185
336 3300005616 Ga0068852_100132533 Ga0068852_1001325334 185
337 3300005617 Ga0068859_101668609 Ga0068859_1016686091 185
338 3300005718 Ga0068866_10135505 Ga0068866_101355052 185
339 3300005719 Ga0068861_100016632 Ga0068861_1000166325 185
340 3300005719 Ga0068861_100337656 Ga0068861_1003376562 185
341 3300005843 Ga0068860_100115472 Ga0068860_1001154725 185
342 3300005843 Ga0068860_100233760 Ga0068860_1002337604 185
343 3300005844 Ga0068862_100112647 Ga0068862_1001126475 185
344 3300006163 Ga0070715_10032313 Ga0070715_100323133 185
345 3300006175 Ga0070712_100163196 Ga0070712_1001631961 185
346 3300006175 Ga0070712_100193427 Ga0070712_1001934272 185
347 3300006237 Ga0097621_100034316 Ga0097621_1000343164 185
348 3300006358 Ga0068871_100398531 Ga0068871_1003985311 185
349 3300006852 Ga0075433_10319924 Ga0075433_103199242 185
350 3300006881 Ga0068865_100387397 Ga0068865_1003873972 185
351 3300006931 Ga0097620_101668242 Ga0097620_1016682421 185
352 3300009093 Ga0105240_10153988 Ga0105240_101539882 185
353 3300009094 Ga0111539_10585302 Ga0111539_105853022 185
354 3300009098 Ga0105245_10329631 Ga0105245_103296312 185
355 3300009148 Ga0105243_10527823 Ga0105243_105278232 185
356 3300009174 Ga0105241_10082506 Ga0105241_100825062 185
357 3300009176 Ga0105242_11351772 Ga0105242_113517721 185
358 3300009177 Ga0105248_10640011 Ga0105248_106400112 185
359 3300009545 Ga0105237_10306005 Ga0105237_103060053 185
360 3300009553 Ga0105249_10005501 Ga0105249_1000550112 185
361 3300009553 Ga0105249_10215540 Ga0105249_102155402 185
362 3300010375 Ga0105239_10153627 Ga0105239_101536272 185
363 3300010375 Ga0105239_10938281 Ga0105239_109382812 185
364 3300012515 Ga0157338_1017165 Ga0157338_10171651 185
365 3300013100 Ga0157373_10037815 Ga0157373_100378154 185
366 3300013297 Ga0157378_10428891 Ga0157378_104288913 185
367 3300013306 Ga0163162_10486222 Ga0163162_104862222 185
368 3300013307 Ga0157372_10185879 Ga0157372_101858792 185
369 3300013308 Ga0157375_10445758 Ga0157375_104457582 185
370 3300014745 Ga0157377_10103066 Ga0157377_101030662 185
371 3300017792 Ga0163161_10169661 Ga0163161_101696614 185
372 3300025899 Ga0207642_10400956 Ga0207642_104009562 185
373 3300025906 Ga0207699_10099681 Ga0207699_100996812 185
374 3300025911 Ga0207654_10030703 Ga0207654_100307035 185
375 3300025911 Ga0207654_10519746 Ga0207654_105197462 185
376 3300025913 Ga0207695_10515962 Ga0207695_105159623 185
377 3300025915 Ga0207693_10031153 Ga0207693_100311534 185
378 3300025916 Ga0207663_10038863 Ga0207663_100388632 185
379 3300025918 Ga0207662_10154811 Ga0207662_101548112 185
380 3300025919 Ga0207657_10028020 Ga0207657_100280205 185
381 3300025922 Ga0207646_10352478 Ga0207646_103524783 185
382 3300025923 Ga0207681_10060475 Ga0207681_100604752 185
383 3300025927 Ga0207687_10029321 Ga0207687_100293215 185
384 3300025927 Ga0207687_10271146 Ga0207687_102711462 185
385 3300025929 Ga0207664_10107841 Ga0207664_101078413 185
386 3300025933 Ga0207706_10001859 Ga0207706_100018596 185
387 3300025933 Ga0207706_10229229 Ga0207706_102292292 185
388 3300025934 Ga0207686_10123853 Ga0207686_101238532 185
389 3300025934 Ga0207686_10747270 Ga0207686_107472701 185
390 3300025937 Ga0207669_10228296 Ga0207669_102282962 185
391 3300025938 Ga0207704_10064151 Ga0207704_100641512 185
392 3300025939 Ga0207665_10002122 Ga0207665_100021226 185
393 3300025940 Ga0207691_10465564 Ga0207691_104655642 185
394 3300025942 Ga0207689_10700502 Ga0207689_107005021 185
395 3300025949 Ga0207667_10068117 Ga0207667_100681176 185
396 3300025949 Ga0207667_11273591 Ga0207667_112735912 185
397 3300025961 Ga0207712_10220899 Ga0207712_102208992 185
398 3300025961 Ga0207712_10595620 Ga0207712_105956202 185
399 3300025972 Ga0207668_11187031 Ga0207668_111870311 185
400 3300026023 Ga0207677_10939865 Ga0207677_109398652 185
401 3300026041 Ga0207639_10124938 Ga0207639_101249382 185
402 3300026067 Ga0207678_10109294 Ga0207678_101092945 185
403 3300026075 Ga0207708_10002458 Ga0207708_100024587 185
404 3300026089 Ga0207648_10126122 Ga0207648_101261222 185
405 3300026089 Ga0207648_10578815 Ga0207648_105788152 185
406 3300026118 Ga0207675_100005395 Ga0207675_1000053952 185
407 3300026121 Ga0207683_10000656 Ga0207683_1000065622 185
408 3300026142 Ga0207698_10314580 Ga0207698_103145802 185
409 3300027907 Ga0207428_10356225 Ga0207428_103562252 185
410 3300028381 Ga0268264_10148341 Ga0268264_101483412 185
411 3300028381 Ga0268264_10148411 Ga0268264_101484113 185
412 3300031824 Ga0307413_10487380 Ga0307413_104873802 185
413 3300032002 Ga0307416_100033921 Ga0307416_1000339212 185
414 3300034820 Ga0373959_0007016 Ga0373959_0007016_111_677 185
415 3300035084 Ga0373928_0112642 Ga0373928_0112642_119_685 185
416 3300035085 Ga0373929_0030032 Ga0373929_0030032_89_655 185
417 3300035207 Ga0373942_0026317 Ga0373942_0026317_178_744 185
418 3300035241 Ga0373961_0027021 Ga0373961_0027021_826_1392 185
419 3300035691 Ga0373931_0058513 Ga0373931_0058513_1005_1571 185
420 3300035691 Ga0373931_0190691 Ga0373931_0190691_523_1089 185
421 3300037418 Ga0395900_0865148 Ga0395900_0865148_131_706 185
422 3300037418 Ga0395900_1328135 Ga0395900_1328135_20_598 185
423 3300037471 Ga0395905_0388655 Ga0395905_0388655_288_866 185
424 3300044706 Ga0466964_0006668 Ga0466964_0006668_2661_3239 185
425 3300045051 Ga0451576_0037167 Ga0451576_0037167_181_750 185
426 3300045051 Ga0451576_0165510 Ga0451576_0165510_409_972 185
427 3300046491 Ga0495584_0143827 Ga0495584_0143827_478_1044 185
428 3300046500 Ga0495596_0194599 Ga0495596_0194599_97_663 185
429 3300046523 Ga0495644_0083051 Ga0495644_0083051_232_798 185
430 3300046664 Ga0495659_0076763 Ga0495659_0076763_65_631 185
431 3300046683 Ga0495658_0047018 Ga0495658_0047018_1052_1630 185
432 3300048905 Ga0496102_0180753 Ga0496102_0180753_451_1017 185
433 3300048906 Ga0496103_0022485 Ga0496103_0022485_26_592 185
434 3300048909 Ga0496106_0355388 Ga0496106_0355388_406_972 185
435 3300048910 Ga0496107_0685623 Ga0496107_0685623_137_700 185
436 3300048913 Ga0496110_0250538 Ga0496110_0250538_807_1385 185
437 3300048915 Ga0496112_0015203 Ga0496112_0015203_662_1228 185
438 3300048917 Ga0496114_0252524 Ga0496114_0252524_497_1063 185
439 3300048918 Ga0496115_0108936 Ga0496115_0108936_1467_2033 185
440 3300050511 nmdc:mga08y16_190993_c1 nmdc:mga08y16_190993_c1_1198_1761 185
441 3300050512 nmdc:mga0n895_482352_c1 nmdc:mga0n895_482352_c1_68_631 185
442 3300028666 Ga0265336_10084840 Ga0265336_100848402 186
443 3300028800 Ga0265338_10004996 Ga0265338_100049966 186
444 3300031251 Ga0265327_10022061 Ga0265327_100220612 186
445 3300035172 Ga0373955_0191234 Ga0373955_0191234_537_1106 186
446 3300036401 Ga0373937_0029339 Ga0373937_0029339_2155_2724 186
447 3300046462 Ga0495651_0120693 Ga0495651_0120693_433_1002 186
448 3300046463 Ga0495653_0039131 Ga0495653_0039131_695_1264 186
449 3300046516 Ga0495628_0183787 Ga0495628_0183787_417_986 186
450 3300046517 Ga0495630_0302166 Ga0495630_0302166_244_813 186
451 3300046529 Ga0495652_0127880 Ga0495652_0127880_178_747 186
452 3300046529 Ga0495652_0192976 Ga0495652_0192976_414_983 186
453 3300046535 Ga0495586_0275651 Ga0495586_0275651_182_751 186
454 3300046642 Ga0495634_0070534 Ga0495634_0070534_1590_2159 186
455 3300047322 Ga0495680_0019236 Ga0495680_0019236_2746_3315 186
456 3300047471 Ga0495684_0126474 Ga0495684_0126474_35_604 186
457 3300047471 Ga0495684_0227190 Ga0495684_0227190_244_813 186
458 3300048088 Ga0495602_0354720 Ga0495602_0354720_314_883 186
459 3300053085 Ga0495619_0050083 Ga0495619_0050083_1360_1929 186
460 3300037312 Ga0395899_0054926 Ga0395899_0054926_1159_1734 188
461 3300037418 Ga0395900_0009328 Ga0395900_0009328_671_1246 188
462 3300037466 Ga0395898_0006302 Ga0395898_0006302_1680_2255 188
463 3300037471 Ga0395905_0004127 Ga0395905_0004127_5022_5597 188
464 3300038443 Ga0395901_0009816 Ga0395901_0009816_1022_1597 188
465 3300046491 Ga0495584_0142113 Ga0495584_0142113_577_1152 188
466 3300046538 Ga0495609_0213237 Ga0495609_0213237_193_768 188
467 3300005327 Ga0070658_10202908 Ga0070658_102029081 192
468 3300005530 Ga0070679_100693755 Ga0070679_1006937552 192
469 3300009093 Ga0105240_10361427 Ga0105240_103614272 192
470 3300025949 Ga0207667_10194780 Ga0207667_101947802 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

11

159

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kg3-assembly2.cif.gz_C crystal structure of nicotinic acid mononucleotide adenylyltransferase mutant p22k/y84v/y118d/c132q/w176f from escherichia coli 0.8566 2 182
4rpi-assembly2.cif.gz_B crystal structure of nicotinate mononucleotide adenylyltransferase from mycobacterium tuberculosis 0.8557 2 182
4ybr-assembly1.cif.gz_A structure of mycobacterium tuberculosis nadd in complex with nadp, p21212 0.8551 2 182
6kh2-assembly3.cif.gz_C crystal structure of nicotinic acid mononucleotide adenylyltransferase mutant p22k/y84v/y118d/c132l/w176y from escherichia coli 0.8549 1 182
1k4k-assembly1.cif.gz_A crystal structure of e. coli nicotinic acid mononucleotide adenylyltransferase 0.8549 2 182
ID Description Score Start End Superfamily
4wsoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8526 2 184 3.40.50.620
af_Q9UT53_125_356_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8387 1 182 3.40.50.620
af_Q9XXM2_4_220_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8373 2 182 3.40.50.620
1yulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8361 2 182 3.40.50.620
af_Q0DWH7_26_248_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.834 1 187 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A538CJK6-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9654 1 185 GO:0004515
GO:0005524
GO:0009435
AF-A0A538CJK6-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9603 1 185 GO:0004515
GO:0005524
GO:0009435
AF-A0A537ZQX7-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9595 2 189 GO:0004515
GO:0005524
GO:0009435
AF-A0A7V9T9M1-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9584 2 182 GO:0004515
GO:0005524
GO:0009435
AF-A0A7W0SQJ5-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9499 2 185 GO:0004515
GO:0005524
GO:0009435

Feature Viewer

pLDDT pTM Quality
92.1 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map