F450385

General Info

Members Datasets Scaffolds Average Seq Length
470 252 940 121

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100234970|Ga0070665_1002349703
Length 118
Sequence MKEWLVFLSEYAILVINAMALVVVVYATTEAFIKAVGLAAITHPPIEHTRAVWLRFARWLVAALTFQLAADIVETSITSSWEALGRIAVIAVLRTFLNYFLEKDVTEMDSRRQEIAKA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
246 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 2.98
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 22.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100234970 3300005548 Bacteria 1833
2 Ga0065712_10102692 3300005290 Bacteria 2003
3 Ga0065715_10010241 3300005293 Bacteria 3161
4 Ga0065707_11081347 3300005295 Bacteria 520
5 Ga0070658_10361200 3300005327 Unclassified 1244
6 Ga0070676_10019343 3300005328 Bacteria 3787
7 Ga0070676_10051788 3300005328 Bacteria 2411
8 Ga0070676_10084108 3300005328 Unclassified 1937
9 Ga0070676_10195772 3300005328 Unclassified 1322
10 Ga0070676_11014098 3300005328 Bacteria 624
11 Ga0070683_100298154 3300005329 Bacteria 1533
12 Ga0070690_100050903 3300005330 Bacteria 2642
13 Ga0070690_100521879 3300005330 Bacteria 891
14 Ga0070670_100254796 3300005331 Bacteria 1529
15 Ga0070670_100927177 3300005331 Unclassified 790
16 Ga0068869_100017948 3300005334 Bacteria 4809
17 Ga0068869_100029343 3300005334 Bacteria 3853
18 Ga0068869_100303374 3300005334 Unclassified 1290
19 Ga0070666_10163225 3300005335 Bacteria 1557
20 Ga0070666_11463912 3300005335 Unclassified 511
21 Ga0070680_100132336 3300005336 Bacteria 2087
22 Ga0070680_100518166 3300005336 Bacteria 1021
23 Ga0070680_100833952 3300005336 Unclassified 795
24 Ga0068868_100042321 3300005338 Unclassified 3554
25 Ga0068868_100133569 3300005338 Bacteria 2033
26 Ga0068868_100142396 3300005338 Unclassified 1969
27 Ga0070660_101337614 3300005339 Unclassified 608
28 Ga0070689_100013226 3300005340 Bacteria 5966
29 Ga0070689_100100424 3300005340 Bacteria 2289
30 Ga0070689_100158867 3300005340 Bacteria 1826
31 Ga0070689_100245717 3300005340 Bacteria 1475
32 Ga0070689_100989430 3300005340 Bacteria 748
33 Ga0070687_100106037 3300005343 Unclassified 1582
34 Ga0070687_100143901 3300005343 Unclassified 1392
35 Ga0070661_100037609 3300005344 Bacteria 3521
36 Ga0070661_100158473 3300005344 Unclassified 1713
37 Ga0070692_10047871 3300005345 Bacteria 2213
38 Ga0070692_10139783 3300005345 Bacteria 1369
39 Ga0070668_100035210 3300005347 Bacteria 3817
40 Ga0070668_100133288 3300005347 Bacteria 1996
41 Ga0070669_100105875 3300005353 Unclassified 2128
42 Ga0070669_101494869 3300005353 Unclassified 587
43 Ga0070675_100111558 3300005354 Bacteria 2314
44 Ga0070675_100143319 3300005354 Bacteria 2044
45 Ga0070675_100187076 3300005354 Bacteria 1793
46 Ga0070671_100086548 3300005355 Bacteria 2622
47 Ga0070671_100102806 3300005355 Bacteria 2397
48 Ga0070671_100149954 3300005355 Unclassified 1969
49 Ga0070671_101033662 3300005355 Unclassified 720
50 Ga0070673_100116379 3300005364 Bacteria 2224
51 Ga0070673_100331878 3300005364 Bacteria 1346
52 Ga0070688_100019630 3300005365 Unclassified 3918
53 Ga0070688_100023208 3300005365 Bacteria 3647
54 Ga0070659_100086205 3300005366 Bacteria 2512
55 Ga0070659_100268518 3300005366 Unclassified 1417
56 Ga0070667_100395108 3300005367 Bacteria 1258
57 Ga0070667_100839468 3300005367 Bacteria 854
58 Ga0070667_101452921 3300005367 Unclassified 643
59 Ga0070713_100145309 3300005436 Bacteria 2104
60 Ga0070713_100267532 3300005436 Bacteria 1564
61 Ga0070710_10012002 3300005437 Bacteria 4294
62 Ga0070701_10041655 3300005438 Bacteria 2341
63 Ga0070701_10221152 3300005438 Bacteria 1129
64 Ga0070711_100227715 3300005439 Bacteria 1452
65 Ga0070711_100570831 3300005439 Unclassified 940
66 Ga0070700_100008317 3300005441 Bacteria 5647
67 Ga0070700_100118032 3300005441 Unclassified 1773
68 Ga0070700_100927430 3300005441 Bacteria 711
69 Ga0070694_100571659 3300005444 Bacteria 907
70 Ga0070694_100696782 3300005444 Bacteria 826
71 Ga0070678_100025111 3300005456 Bacteria 4003
72 Ga0070678_100229582 3300005456 Bacteria 1547
73 Ga0070678_100494360 3300005456 Unclassified 1078
74 Ga0070678_100968273 3300005456 Bacteria 781
75 Ga0070678_102124659 3300005456 Unclassified 532
76 Ga0070662_100016373 3300005457 Bacteria 4977
77 Ga0070662_100026590 3300005457 Bacteria 4009
78 Ga0070662_101105361 3300005457 Unclassified 680
79 Ga0070681_10170788 3300005458 Bacteria 2096
80 Ga0068867_100115068 3300005459 Bacteria 2071
81 Ga0068867_100236231 3300005459 Unclassified 1480
82 Ga0070685_10196198 3300005466 Unclassified 1309
83 Ga0070685_10389009 3300005466 Bacteria 963
84 Ga0070698_101126596 3300005471 Unclassified 733
85 Ga0070699_100420827 3300005518 Bacteria 1209
86 Ga0070699_101256187 3300005518 Unclassified 679
87 Ga0070679_100142388 3300005530 Bacteria 2376
88 Ga0070684_100037797 3300005535 Bacteria 4143
89 Ga0070684_100050139 3300005535 Bacteria 3625
90 Ga0070697_100367082 3300005536 Bacteria 1245
91 Ga0068853_100016407 3300005539 Bacteria 6095
92 Ga0068853_100512976 3300005539 Bacteria 1133
93 Ga0068853_101194077 3300005539 Unclassified 734
94 Ga0070672_100045724 3300005543 Bacteria 3388
95 Ga0070672_100454595 3300005543 Bacteria 1103
96 Ga0070672_100968208 3300005543 Unclassified 753
97 Ga0070672_101300277 3300005543 Bacteria 649
98 Ga0070686_100147769 3300005544 Bacteria 1643
99 Ga0070686_101529482 3300005544 Unclassified 563
100 Ga0070695_100266118 3300005545 Bacteria 1254
101 Ga0070693_100192285 3300005547 Unclassified 1321
102 Ga0070665_100179042 3300005548 Bacteria 2121
103 Ga0070665_100268785 3300005548 Bacteria 1706
104 Ga0070665_100437241 3300005548 Unclassified 1317
105 Ga0070665_101147969 3300005548 Bacteria 788
106 Ga0070704_100023559 3300005549 Bacteria 4025
107 Ga0070704_100250391 3300005549 Bacteria 1454
108 Ga0068855_100266499 3300005563 Unclassified 1906
109 Ga0068857_100065786 3300005577 Unclassified 3224
110 Ga0068854_100057541 3300005578 Bacteria 2805
111 Ga0068856_100122881 3300005614 Bacteria 2599
112 Ga0068856_100602462 3300005614 Unclassified 1120
113 Ga0070702_100096470 3300005615 Bacteria 1804
114 Ga0070702_100805000 3300005615 Unclassified 727
115 Ga0070702_101474133 3300005615 Bacteria 559
116 Ga0070702_101495933 3300005615 Unclassified 555
117 Ga0068852_100108754 3300005616 Bacteria 2516
118 Ga0068859_100035766 3300005617 Bacteria 4984
119 Ga0068859_100104948 3300005617 Bacteria 2885
120 Ga0068859_100121888 3300005617 Bacteria 2674
121 Ga0068859_100166635 3300005617 Bacteria 2283
122 Ga0068859_100234780 3300005617 Bacteria 1922
123 Ga0068859_100476889 3300005617 Bacteria 1343
124 Ga0068864_100142377 3300005618 Bacteria 2164
125 Ga0068864_102003811 3300005618 Unclassified 585
126 Ga0068866_10211584 3300005718 Bacteria 1164
127 Ga0068866_10234988 3300005718 Bacteria 1113
128 Ga0068861_100035068 3300005719 Bacteria 3715
129 Ga0068861_100097460 3300005719 Bacteria 2332
130 Ga0068851_10019395 3300005834 Bacteria 3285
131 Ga0068851_10074846 3300005834 Bacteria 1758
132 Ga0068863_100235679 3300005841 Bacteria 1766
133 Ga0068863_100397532 3300005841 Unclassified 1347
134 Ga0068858_100080576 3300005842 Bacteria 3025
135 Ga0068858_100196253 3300005842 Bacteria 1908
136 Ga0068858_100668713 3300005842 Bacteria 1009
137 Ga0068860_100109636 3300005843 Bacteria 2638
138 Ga0068860_100946223 3300005843 Unclassified 878
139 Ga0068860_101927110 3300005843 Unclassified 612
140 Ga0068862_100030353 3300005844 Bacteria 4555
141 Ga0068862_100073589 3300005844 Bacteria 2953
142 Ga0068862_100194532 3300005844 Unclassified 1826
143 Ga0075365_10006265 3300006038 Bacteria 6526
144 Ga0075363_100116440 3300006048 Bacteria 1489
145 Ga0070716_100034552 3300006173 Bacteria 2773
146 Ga0070712_100049747 3300006175 Bacteria 2912
147 Ga0075362_10008652 3300006177 Bacteria 3907
148 Ga0097621_100405141 3300006237 Bacteria 1222
149 Ga0097621_100867462 3300006237 Bacteria 839
150 Ga0097621_101423758 3300006237 Unclassified 656
151 Ga0068871_100036967 3300006358 Bacteria 3891
152 Ga0075428_100352952 3300006844 Bacteria 1578
153 Ga0075428_100352964 3300006844 Bacteria 1578
154 Ga0075428_101225082 3300006844 Bacteria 791
155 Ga0075430_100094361 3300006846 Bacteria 2501
156 Ga0075430_100221409 3300006846 Bacteria 1570
157 Ga0075431_100000771 3300006847 Bacteria 27793
158 Ga0075431_100106248 3300006847 Bacteria 2896
159 Ga0075431_100314064 3300006847 Bacteria 1581
160 Ga0075431_100360670 3300006847 Unclassified 1460
161 Ga0075431_100619833 3300006847 Bacteria 1064
162 Ga0075431_101297320 3300006847 Unclassified 689
163 Ga0075431_101330159 3300006847 Bacteria 679
164 Ga0075433_10331174 3300006852 Bacteria 1346
165 Ga0075434_100006219 3300006871 Bacteria 10940
166 Ga0075429_100012530 3300006880 Bacteria 7357
167 Ga0075429_100044953 3300006880 Bacteria 3842
168 Ga0075429_100725550 3300006880 Bacteria 870
169 Ga0068865_100067317 3300006881 Bacteria 2529
170 Ga0068865_100158993 3300006881 Bacteria 1722
171 Ga0068865_100332314 3300006881 Bacteria 1226
172 Ga0075436_100187741 3300006914 Bacteria 1462
173 Ga0097620_100035764 3300006931 Bacteria 4984
174 Ga0097620_100104948 3300006931 Bacteria 2885
175 Ga0097620_100121893 3300006931 Bacteria 2674
176 Ga0097620_100166644 3300006931 Bacteria 2283
177 Ga0097620_100234773 3300006931 Bacteria 1922
178 Ga0097620_100476960 3300006931 Bacteria 1343
179 Ga0075435_100784353 3300007076 Unclassified 829
180 Ga0105240_10889083 3300009093 Bacteria 959
181 Ga0111539_10006798 3300009094 Bacteria 14713
182 Ga0111539_10324141 3300009094 Bacteria 1793
183 Ga0111539_10433919 3300009094 Bacteria 1530
184 Ga0105245_10027281 3300009098 Bacteria 5033
185 Ga0105245_10335030 3300009098 Bacteria 1495
186 Ga0105245_10840464 3300009098 Unclassified 958
187 Ga0105247_10003873 3300009101 Bacteria 9682
188 Ga0105247_10033520 3300009101 Bacteria 3124
189 Ga0114129_10293607 3300009147 Bacteria 2168
190 Ga0114129_10838824 3300009147 Bacteria 1169
191 Ga0114129_11112555 3300009147 Bacteria 988
192 Ga0105243_10400562 3300009148 Bacteria 1275
193 Ga0105243_10546241 3300009148 Bacteria 1106
194 Ga0105243_10717682 3300009148 Unclassified 976
195 Ga0105241_10127027 3300009174 Bacteria 2060
196 Ga0105241_11491937 3300009174 Unclassified 650
197 Ga0105242_10044669 3300009176 Bacteria 3589
198 Ga0105242_10403301 3300009176 Unclassified 1277
199 Ga0105248_10055286 3300009177 Bacteria 4452
200 Ga0105248_10064191 3300009177 Unclassified 4122
201 Ga0105248_10185468 3300009177 Bacteria 2344
202 Ga0105248_10321664 3300009177 Unclassified 1742
203 Ga0105248_11796257 3300009177 Bacteria 695
204 Ga0105237_10207905 3300009545 Bacteria 1957
205 Ga0105238_10031644 3300009551 Bacteria 5386
206 Ga0105249_10187535 3300009553 Bacteria 2016
207 Ga0105249_10829613 3300009553 Bacteria 989
208 Ga0105249_11741552 3300009553 Bacteria 696
209 Ga0105249_11842663 3300009553 Unclassified 678
210 Ga0105249_12303637 3300009553 Unclassified 611
211 Ga0105239_10073969 3300010375 Bacteria 3746
212 Ga0105239_10185787 3300010375 Bacteria 2326
213 Ga0105239_13646974 3300010375 Unclassified 500
214 Ga0105246_10258134 3300011119 Unclassified 1387
215 Ga0157371_10450455 3300013102 Bacteria 946
216 Ga0157374_10250075 3300013296 Bacteria 1744
217 Ga0157374_10712053 3300013296 Bacteria 1017
218 Ga0157378_10033038 3300013297 Bacteria 4573
219 Ga0157378_10128633 3300013297 Bacteria 2342
220 Ga0157378_10193831 3300013297 Bacteria 1918
221 Ga0163162_10036194 3300013306 Bacteria 4918
222 Ga0157372_10656850 3300013307 Bacteria 1221
223 Ga0157372_10873846 3300013307 Unclassified 1043
224 Ga0157375_10051592 3300013308 Unclassified 4040
225 Ga0157375_10065655 3300013308 Bacteria 3618
226 Ga0157375_12082027 3300013308 Unclassified 675
227 Ga0157375_12929142 3300013308 Unclassified 570
228 Ga0163163_10049164 3300014325 Bacteria 4149
229 Ga0157380_10021137 3300014326 Bacteria 4878
230 Ga0157380_10138946 3300014326 Bacteria 2084
231 Ga0157380_10180092 3300014326 Bacteria 1856
232 Ga0157380_10233835 3300014326 Unclassified 1652
233 Ga0157380_10304067 3300014326 Bacteria 1471
234 Ga0157380_11810808 3300014326 Unclassified 670
235 Ga0157377_10319466 3300014745 Unclassified 1031
236 Ga0157379_10066484 3300014968 Bacteria 3223
237 Ga0163161_10037107 3300017792 Bacteria 3492
238 Ga0163161_10069640 3300017792 Bacteria 2571
239 Ga0213871_10024410 3300021441 Unclassified 1531
240 Ga0207697_10029443 3300025315 Bacteria 2247
241 Ga0207697_10264099 3300025315 Bacteria 762
242 Ga0207656_10007197 3300025321 Bacteria 4044
243 Ga0207656_10138242 3300025321 Bacteria 1146
244 Ga0207692_10737954 3300025898 Unclassified 641
245 Ga0207710_10002117 3300025900 Bacteria 9378
246 Ga0207688_10007280 3300025901 Bacteria 6022
247 Ga0207680_10100718 3300025903 Unclassified 1856
248 Ga0207680_10314223 3300025903 Unclassified 1094
249 Ga0207647_10718379 3300025904 Unclassified 543
250 Ga0207685_10046719 3300025905 Bacteria 1649
251 Ga0207699_10110851 3300025906 Bacteria 1758
252 Ga0207645_10013080 3300025907 Bacteria 5606
253 Ga0207645_10182222 3300025907 Bacteria 1378
254 Ga0207645_10621594 3300025907 Bacteria 734
255 Ga0207707_10188569 3300025912 Bacteria 1799
256 Ga0207671_10204186 3300025914 Bacteria 1544
257 Ga0207693_10002007 3300025915 Bacteria 17864
258 Ga0207663_10009105 3300025916 Bacteria 5233
259 Ga0207660_10045569 3300025917 Bacteria 3090
260 Ga0207660_10070636 3300025917 Bacteria 2539
261 Ga0207660_10453671 3300025917 Bacteria 1037
262 Ga0207662_10063442 3300025918 Bacteria 2222
263 Ga0207662_10182030 3300025918 Bacteria 1352
264 Ga0207657_10353608 3300025919 Bacteria 1158
265 Ga0207649_10230062 3300025920 Unclassified 1325
266 Ga0207652_10270382 3300025921 Unclassified 1533
267 Ga0207681_10224967 3300025923 Bacteria 1453
268 Ga0207694_10133947 3300025924 Bacteria 1988
269 Ga0207650_10294382 3300025925 Unclassified 1324
270 Ga0207650_11003117 3300025925 Unclassified 710
271 Ga0207659_10056631 3300025926 Bacteria 2808
272 Ga0207659_10144711 3300025926 Bacteria 1849
273 Ga0207687_10206137 3300025927 Bacteria 1540
274 Ga0207700_11503950 3300025928 Unclassified 597
275 Ga0207644_10034924 3300025931 Bacteria 3520
276 Ga0207644_10188110 3300025931 Bacteria 1622
277 Ga0207644_10325460 3300025931 Unclassified 1244
278 Ga0207690_10119241 3300025932 Bacteria 1914
279 Ga0207690_10176475 3300025932 Unclassified 1605
280 Ga0207690_10357340 3300025932 Unclassified 1156
281 Ga0207706_10017087 3300025933 Bacteria 6542
282 Ga0207706_10209454 3300025933 Bacteria 1709
283 Ga0207706_10458637 3300025933 Unclassified 1102
284 Ga0207706_11584770 3300025933 Unclassified 531
285 Ga0207686_11406653 3300025934 Unclassified 574
286 Ga0207709_10480545 3300025935 Bacteria 966
287 Ga0207670_10165118 3300025936 Bacteria 1656
288 Ga0207670_10235734 3300025936 Bacteria 1407
289 Ga0207670_10517648 3300025936 Unclassified 971
290 Ga0207704_10252642 3300025938 Bacteria 1324
291 Ga0207704_10374855 3300025938 Bacteria 1115
292 Ga0207665_10030584 3300025939 Bacteria 3560
293 Ga0207691_10023311 3300025940 Bacteria 5827
294 Ga0207691_10025041 3300025940 Bacteria 5607
295 Ga0207691_10109177 3300025940 Bacteria 2461
296 Ga0207691_10550699 3300025940 Unclassified 978
297 Ga0207711_10060370 3300025941 Bacteria 3267
298 Ga0207711_10225396 3300025941 Bacteria 1715
299 Ga0207711_10268426 3300025941 Bacteria 1569
300 Ga0207689_10017424 3300025942 Bacteria 6078
301 Ga0207689_10142896 3300025942 Bacteria 1972
302 Ga0207689_10279710 3300025942 Unclassified 1382
303 Ga0207661_10150151 3300025944 Bacteria 2013
304 Ga0207679_10323904 3300025945 Unclassified 1335
305 Ga0207667_10156387 3300025949 Bacteria 2345
306 Ga0207651_10155000 3300025960 Bacteria 1788
307 Ga0207651_10219863 3300025960 Unclassified 1535
308 Ga0207651_10717439 3300025960 Bacteria 882
309 Ga0207712_10669295 3300025961 Bacteria 904
310 Ga0207668_10127463 3300025972 Bacteria 1938
311 Ga0207640_10397082 3300025981 Bacteria 1122
312 Ga0207640_10718858 3300025981 Unclassified 858
313 Ga0207658_10166211 3300025986 Bacteria 1813
314 Ga0207658_11579958 3300025986 Bacteria 600
315 Ga0207677_10015533 3300026023 Bacteria 4482
316 Ga0207677_10067876 3300026023 Bacteria 2500
317 Ga0207677_10475978 3300026023 Unclassified 1075
318 Ga0207703_10527734 3300026035 Unclassified 1111
319 Ga0207703_10958329 3300026035 Unclassified 820
320 Ga0207639_10521622 3300026041 Unclassified 1088
321 Ga0207678_10017309 3300026067 Bacteria 6328
322 Ga0207678_10044895 3300026067 Bacteria 3821
323 Ga0207678_12001352 3300026067 Unclassified 504
324 Ga0207708_10009548 3300026075 Bacteria 7192
325 Ga0207708_10014190 3300026075 Bacteria 5957
326 Ga0207702_10277664 3300026078 Bacteria 1583
327 Ga0207648_10228674 3300026089 Bacteria 1654
328 Ga0207648_11361328 3300026089 Bacteria 667
329 Ga0207648_11562707 3300026089 Bacteria 620
330 Ga0207676_10080415 3300026095 Bacteria 2645
331 Ga0207674_10075296 3300026116 Bacteria 3385
332 Ga0207674_10085350 3300026116 Bacteria 3152
333 Ga0207675_100008467 3300026118 Bacteria 9690
334 Ga0207675_100021091 3300026118 Bacteria 6071
335 Ga0207675_100535248 3300026118 Unclassified 1169
336 Ga0207683_10114722 3300026121 Bacteria 2414
337 Ga0207683_10422971 3300026121 Unclassified 1227
338 Ga0207683_10937102 3300026121 Bacteria 804
339 Ga0207698_10026285 3300026142 Bacteria 4116
340 Ga0207698_10044591 3300026142 Bacteria 3333
341 Ga0209970_1037626 3300027614 Bacteria 855
342 Ga0209983_1032827 3300027665 Bacteria 1110
343 Ga0209971_1058734 3300027682 Bacteria 931
344 Ga0209966_1051264 3300027695 Bacteria 878
345 Ga0207428_11315441 3300027907 Bacteria 501
346 Ga0268266_10127367 3300028379 Bacteria 2274
347 Ga0268266_10139216 3300028379 Bacteria 2177
348 Ga0268266_10701807 3300028379 Bacteria 975
349 Ga0268266_10857773 3300028379 Bacteria 878
350 Ga0268266_10949823 3300028379 Unclassified 832
351 Ga0268265_10078557 3300028380 Bacteria 2596
352 Ga0268265_10098922 3300028380 Bacteria 2350
353 Ga0268264_10056253 3300028381 Bacteria 3288
354 Ga0307515_10537609 3300028794 Bacteria 778
355 Ga0307513_10139101 3300031456 Bacteria 2358
356 Ga0307513_10383106 3300031456 Bacteria 1145
357 Ga0307513_10410703 3300031456 Bacteria 1086
358 Ga0307516_10124502 3300031730 Bacteria 2364
359 Ga0373958_0168057 3300034819 Bacteria 558
360 Ga0373953_0433885 3300035117 Bacteria 580
361 Ga0373954_0117453 3300035118 Bacteria 1290
362 Ga0373935_0723406 3300035692 Unclassified 733
363 Ga0373933_0020611 3300035724 Bacteria 3739
364 Ga0373937_0027826 3300036401 Bacteria 5114
365 Ga0436360_0729957 3300039438 Bacteria 4232
366 Ga0451833_1425923 3300041491 Bacteria 639
367 Ga0451855_0582285 3300041511 Bacteria 596
368 Ga0451577_0670436 3300042876 Unclassified 940
369 Ga0453684_1636916 3300044712 Bacteria 660
370 Ga0495638_0001644 3300046460 Bacteria 19838
371 Ga0495650_0072039 3300046471 Bacteria 1353
372 Ga0495580_0029453 3300046472 Bacteria 3985
373 Ga0495585_0035955 3300046492 Bacteria 2797
374 Ga0495618_0426511 3300046514 Bacteria 808
375 Ga0495598_0247108 3300046537 Unclassified 659
376 Ga0495621_0015729 3300046539 Bacteria 2416
377 Ga0495656_0007537 3300046615 Bacteria 3850
378 Ga0495659_0003944 3300046664 Bacteria 4699
379 Ga0495661_0319512 3300046665 Bacteria 772
380 Ga0495670_0017314 3300046691 Bacteria 3545
381 Ga0495672_0020648 3300047320 Bacteria 4310
382 Ga0495683_0237321 3300047323 Unclassified 806
383 Ga0495677_0367748 3300047445 Unclassified 568
384 Ga0496100_0780387 3300048903 Bacteria 748
385 Ga0496101_0069070 3300048904 Bacteria 2584
386 Ga0496101_0122378 3300048904 Unclassified 1968
387 Ga0496104_0066977 3300048907 Bacteria 3410
388 Ga0496104_1216392 3300048907 Unclassified 657
389 Ga0496105_0101059 3300048908 Bacteria 2381
390 Ga0496107_0622144 3300048910 Unclassified 797
391 Ga0496109_0150789 3300048912 Bacteria 2177
392 Ga0496109_0188747 3300048912 Unclassified 1936
393 Ga0496110_0500331 3300048913 Bacteria 1106
394 Ga0496113_0069869 3300048916 Bacteria 2668
395 Ga0496113_0599641 3300048916 Bacteria 882
396 Ga0496115_0057273 3300048918 Bacteria 3134
397 Ga0496115_0512812 3300048918 Bacteria 962
398 Ga0496117_0216613 3300048920 Bacteria 1069
399 Ga0496126_0030622 3300048929 Bacteria 5095
400 Ga0501032_0010576 3300049569 Bacteria 6654
401 Ga0501033_0612110 3300049570 Bacteria 746
402 Ga0501034_0111485 3300049571 Bacteria 2726
403 Ga0501034_0225596 3300049571 Bacteria 1824
404 Ga0501036_0703959 3300049572 Bacteria 835
405 Ga0501038_0990280 3300049574 Bacteria 617
406 Ga0501039_0013568 3300049575 Bacteria 6231
407 Ga0501043_0718380 3300049579 Bacteria 728
408 Ga0501046_0000023 3300049580 Bacteria 213965
409 Ga0501046_0019967 3300049580 Bacteria 5547
410 Ga0501047_0036600 3300049581 Bacteria 4744
411 Ga0501047_0694958 3300049581 Bacteria 835
412 Ga0501048_0265279 3300049582 Bacteria 1220
413 Ga0501048_0749097 3300049582 Bacteria 702
414 Ga0501068_0532405 3300049584 Bacteria 763
415 Ga0501068_0961427 3300049584 Bacteria 563
416 Ga0501070_0027764 3300049586 Bacteria 4748
417 Ga0501072_0067614 3300049588 Bacteria 2819
418 Ga0501072_0067946 3300049588 Bacteria 2813
419 Ga0501072_0542906 3300049588 Bacteria 918
420 Ga0501073_0059773 3300049589 Bacteria 2661
421 Ga0501073_0513365 3300049589 Bacteria 828
422 Ga0501074_0493901 3300049590 Unclassified 867
423 Ga0501074_1321138 3300049590 Unclassified 505
424 Ga0501075_1107404 3300049591 Bacteria 601
425 Ga0501076_0430446 3300049592 Bacteria 1086
426 Ga0501076_0984223 3300049592 Bacteria 695
427 Ga0501077_0122881 3300049593 Bacteria 1646
428 Ga0501079_0064579 3300049741 Bacteria 2824
429 Ga0501079_0744942 3300049741 Bacteria 771
430 Ga0501080_0106188 3300049742 Unclassified 2602
431 Ga0501080_0500968 3300049742 Bacteria 1085
432 Ga0501080_0745645 3300049742 Bacteria 861
433 Ga0501081_0451596 3300049743 Bacteria 955
434 Ga0501035_0063622 3300049822 Bacteria 3281
435 Ga0501035_0126752 3300049822 Bacteria 2228
436 Ga0501035_0983200 3300049822 Bacteria 664
437 Ga0501045_0314407 3300049824 Bacteria 1165
438 nmdc:mga03683_8990_c1 3300050489 Bacteria 3534
439 nmdc:mga03n38_59651_c1 3300050490 Bacteria 1732
440 nmdc:mga05p37_239604_c1 3300050507 Bacteria 2182
441 nmdc:mga05p37_829630_c1 3300050507 Bacteria 1007
442 nmdc:mga05p37_917866_c1 3300050507 Bacteria 942
443 nmdc:mga09592_13854_c1 3300050508 Bacteria 6589
444 nmdc:mga09592_418512_c1 3300050508 Bacteria 1158
445 nmdc:mga09592_82160_c1 3300050508 Bacteria 2746
446 nmdc:mga0qj67_230384_c1 3300050509 Bacteria 1503
447 nmdc:mga0qj67_81548_c1 3300050509 Bacteria 2594
448 nmdc:mga06r32_1758_c1 3300050510 Bacteria 19446
449 nmdc:mga06r32_241318_c1 3300050510 Bacteria 1795
450 nmdc:mga06r32_355412_c1 3300050510 Bacteria 1449
451 nmdc:mga06r32_611681_c1 3300050510 Unclassified 1060
452 nmdc:mga06r32_804466_c1 3300050510 Bacteria 900
453 nmdc:mga08y16_413686_c1 3300050511 Bacteria 1379
454 nmdc:mga08y16_6186_c1 3300050511 Bacteria 12561
455 nmdc:mga08y16_985543_c1 3300050511 Bacteria 824
456 nmdc:mga0n895_821615_c1 3300050512 Bacteria 919
457 nmdc:mga0a205_395150_c1 3300050515 Bacteria 1247
458 Ga0500643_000707 3300053087 Bacteria 22129
459 Ga0500651_0342986 3300053093 Bacteria 849
460 Ga0500562_003332 3300053108 Bacteria 4019
461 Ga0500593_118630 3300053117 Bacteria 1076
462 Ga0500604_0006209 3300053151 Bacteria 3158
463 Ga0500616_0011874 3300053153 Bacteria 5120
464 Ga0500627_0250608 3300053158 Bacteria 784
465 Ga0500645_037777 3300053730 Bacteria 1434
466 Ga0501084_0835255 3300054114 Bacteria 775
467 Ga0501082_0359383 3300060353 Bacteria 1270
468 Ga0501082_0359833 3300060353 Bacteria 1269
469 Ga0501082_1122836 3300060353 Bacteria 687
470 2888427427 2888419890 Bacteria 7857137
471 Ga0070665_100234970
472 Ga0065712_10102692
473 Ga0065715_10010241
474 Ga0065707_11081347
475 Ga0070658_10361200
476 Ga0070676_10019343
477 Ga0070676_10051788
478 Ga0070676_10084108
479 Ga0070676_10195772
480 Ga0070676_11014098
481 Ga0070683_100298154
482 Ga0070690_100050903
483 Ga0070690_100521879
484 Ga0070670_100254796
485 Ga0070670_100927177
486 Ga0068869_100017948
487 Ga0068869_100029343
488 Ga0068869_100303374
489 Ga0070666_10163225
490 Ga0070666_11463912
491 Ga0070680_100132336
492 Ga0070680_100518166
493 Ga0070680_100833952
494 Ga0068868_100042321
495 Ga0068868_100133569
496 Ga0068868_100142396
497 Ga0070660_101337614
498 Ga0070689_100013226
499 Ga0070689_100100424
500 Ga0070689_100158867
501 Ga0070689_100245717
502 Ga0070689_100989430
503 Ga0070687_100106037
504 Ga0070687_100143901
505 Ga0070661_100037609
506 Ga0070661_100158473
507 Ga0070692_10047871
508 Ga0070692_10139783
509 Ga0070668_100035210
510 Ga0070668_100133288
511 Ga0070669_100105875
512 Ga0070669_101494869
513 Ga0070675_100111558
514 Ga0070675_100143319
515 Ga0070675_100187076
516 Ga0070671_100086548
517 Ga0070671_100102806
518 Ga0070671_100149954
519 Ga0070671_101033662
520 Ga0070673_100116379
521 Ga0070673_100331878
522 Ga0070688_100019630
523 Ga0070688_100023208
524 Ga0070659_100086205
525 Ga0070659_100268518
526 Ga0070667_100395108
527 Ga0070667_100839468
528 Ga0070667_101452921
529 Ga0070713_100145309
530 Ga0070713_100267532
531 Ga0070710_10012002
532 Ga0070701_10041655
533 Ga0070701_10221152
534 Ga0070711_100227715
535 Ga0070711_100570831
536 Ga0070700_100008317
537 Ga0070700_100118032
538 Ga0070700_100927430
539 Ga0070694_100571659
540 Ga0070694_100696782
541 Ga0070678_100025111
542 Ga0070678_100229582
543 Ga0070678_100494360
544 Ga0070678_100968273
545 Ga0070678_102124659
546 Ga0070662_100016373
547 Ga0070662_100026590
548 Ga0070662_101105361
549 Ga0070681_10170788
550 Ga0068867_100115068
551 Ga0068867_100236231
552 Ga0070685_10196198
553 Ga0070685_10389009
554 Ga0070698_101126596
555 Ga0070699_100420827
556 Ga0070699_101256187
557 Ga0070679_100142388
558 Ga0070684_100037797
559 Ga0070684_100050139
560 Ga0070697_100367082
561 Ga0068853_100016407
562 Ga0068853_100512976
563 Ga0068853_101194077
564 Ga0070672_100045724
565 Ga0070672_100454595
566 Ga0070672_100968208
567 Ga0070672_101300277
568 Ga0070686_100147769
569 Ga0070686_101529482
570 Ga0070695_100266118
571 Ga0070693_100192285
572 Ga0070665_100179042
573 Ga0070665_100268785
574 Ga0070665_100437241
575 Ga0070665_101147969
576 Ga0070704_100023559
577 Ga0070704_100250391
578 Ga0068855_100266499
579 Ga0068857_100065786
580 Ga0068854_100057541
581 Ga0068856_100122881
582 Ga0068856_100602462
583 Ga0070702_100096470
584 Ga0070702_100805000
585 Ga0070702_101474133
586 Ga0070702_101495933
587 Ga0068852_100108754
588 Ga0068859_100035766
589 Ga0068859_100104948
590 Ga0068859_100121888
591 Ga0068859_100166635
592 Ga0068859_100234780
593 Ga0068859_100476889
594 Ga0068864_100142377
595 Ga0068864_102003811
596 Ga0068866_10211584
597 Ga0068866_10234988
598 Ga0068861_100035068
599 Ga0068861_100097460
600 Ga0068851_10019395
601 Ga0068851_10074846
602 Ga0068863_100235679
603 Ga0068863_100397532
604 Ga0068858_100080576
605 Ga0068858_100196253
606 Ga0068858_100668713
607 Ga0068860_100109636
608 Ga0068860_100946223
609 Ga0068860_101927110
610 Ga0068862_100030353
611 Ga0068862_100073589
612 Ga0068862_100194532
613 Ga0075365_10006265
614 Ga0075363_100116440
615 Ga0070716_100034552
616 Ga0070712_100049747
617 Ga0075362_10008652
618 Ga0097621_100405141
619 Ga0097621_100867462
620 Ga0097621_101423758
621 Ga0068871_100036967
622 Ga0075428_100352952
623 Ga0075428_100352964
624 Ga0075428_101225082
625 Ga0075430_100094361
626 Ga0075430_100221409
627 Ga0075431_100000771
628 Ga0075431_100106248
629 Ga0075431_100314064
630 Ga0075431_100360670
631 Ga0075431_100619833
632 Ga0075431_101297320
633 Ga0075431_101330159
634 Ga0075433_10331174
635 Ga0075434_100006219
636 Ga0075429_100012530
637 Ga0075429_100044953
638 Ga0075429_100725550
639 Ga0068865_100067317
640 Ga0068865_100158993
641 Ga0068865_100332314
642 Ga0075436_100187741
643 Ga0097620_100035764
644 Ga0097620_100104948
645 Ga0097620_100121893
646 Ga0097620_100166644
647 Ga0097620_100234773
648 Ga0097620_100476960
649 Ga0075435_100784353
650 Ga0105240_10889083
651 Ga0111539_10006798
652 Ga0111539_10324141
653 Ga0111539_10433919
654 Ga0105245_10027281
655 Ga0105245_10335030
656 Ga0105245_10840464
657 Ga0105247_10003873
658 Ga0105247_10033520
659 Ga0114129_10293607
660 Ga0114129_10838824
661 Ga0114129_11112555
662 Ga0105243_10400562
663 Ga0105243_10546241
664 Ga0105243_10717682
665 Ga0105241_10127027
666 Ga0105241_11491937
667 Ga0105242_10044669
668 Ga0105242_10403301
669 Ga0105248_10055286
670 Ga0105248_10064191
671 Ga0105248_10185468
672 Ga0105248_10321664
673 Ga0105248_11796257
674 Ga0105237_10207905
675 Ga0105238_10031644
676 Ga0105249_10187535
677 Ga0105249_10829613
678 Ga0105249_11741552
679 Ga0105249_11842663
680 Ga0105249_12303637
681 Ga0105239_10073969
682 Ga0105239_10185787
683 Ga0105239_13646974
684 Ga0105246_10258134
685 Ga0157371_10450455
686 Ga0157374_10250075
687 Ga0157374_10712053
688 Ga0157378_10033038
689 Ga0157378_10128633
690 Ga0157378_10193831
691 Ga0163162_10036194
692 Ga0157372_10656850
693 Ga0157372_10873846
694 Ga0157375_10051592
695 Ga0157375_10065655
696 Ga0157375_12082027
697 Ga0157375_12929142
698 Ga0163163_10049164
699 Ga0157380_10021137
700 Ga0157380_10138946
701 Ga0157380_10180092
702 Ga0157380_10233835
703 Ga0157380_10304067
704 Ga0157380_11810808
705 Ga0157377_10319466
706 Ga0157379_10066484
707 Ga0163161_10037107
708 Ga0163161_10069640
709 Ga0213871_10024410
710 Ga0207697_10029443
711 Ga0207697_10264099
712 Ga0207656_10007197
713 Ga0207656_10138242
714 Ga0207692_10737954
715 Ga0207710_10002117
716 Ga0207688_10007280
717 Ga0207680_10100718
718 Ga0207680_10314223
719 Ga0207647_10718379
720 Ga0207685_10046719
721 Ga0207699_10110851
722 Ga0207645_10013080
723 Ga0207645_10182222
724 Ga0207645_10621594
725 Ga0207707_10188569
726 Ga0207671_10204186
727 Ga0207693_10002007
728 Ga0207663_10009105
729 Ga0207660_10045569
730 Ga0207660_10070636
731 Ga0207660_10453671
732 Ga0207662_10063442
733 Ga0207662_10182030
734 Ga0207657_10353608
735 Ga0207649_10230062
736 Ga0207652_10270382
737 Ga0207681_10224967
738 Ga0207694_10133947
739 Ga0207650_10294382
740 Ga0207650_11003117
741 Ga0207659_10056631
742 Ga0207659_10144711
743 Ga0207687_10206137
744 Ga0207700_11503950
745 Ga0207644_10034924
746 Ga0207644_10188110
747 Ga0207644_10325460
748 Ga0207690_10119241
749 Ga0207690_10176475
750 Ga0207690_10357340
751 Ga0207706_10017087
752 Ga0207706_10209454
753 Ga0207706_10458637
754 Ga0207706_11584770
755 Ga0207686_11406653
756 Ga0207709_10480545
757 Ga0207670_10165118
758 Ga0207670_10235734
759 Ga0207670_10517648
760 Ga0207704_10252642
761 Ga0207704_10374855
762 Ga0207665_10030584
763 Ga0207691_10023311
764 Ga0207691_10025041
765 Ga0207691_10109177
766 Ga0207691_10550699
767 Ga0207711_10060370
768 Ga0207711_10225396
769 Ga0207711_10268426
770 Ga0207689_10017424
771 Ga0207689_10142896
772 Ga0207689_10279710
773 Ga0207661_10150151
774 Ga0207679_10323904
775 Ga0207667_10156387
776 Ga0207651_10155000
777 Ga0207651_10219863
778 Ga0207651_10717439
779 Ga0207712_10669295
780 Ga0207668_10127463
781 Ga0207640_10397082
782 Ga0207640_10718858
783 Ga0207658_10166211
784 Ga0207658_11579958
785 Ga0207677_10015533
786 Ga0207677_10067876
787 Ga0207677_10475978
788 Ga0207703_10527734
789 Ga0207703_10958329
790 Ga0207639_10521622
791 Ga0207678_10017309
792 Ga0207678_10044895
793 Ga0207678_12001352
794 Ga0207708_10009548
795 Ga0207708_10014190
796 Ga0207702_10277664
797 Ga0207648_10228674
798 Ga0207648_11361328
799 Ga0207648_11562707
800 Ga0207676_10080415
801 Ga0207674_10075296
802 Ga0207674_10085350
803 Ga0207675_100008467
804 Ga0207675_100021091
805 Ga0207675_100535248
806 Ga0207683_10114722
807 Ga0207683_10422971
808 Ga0207683_10937102
809 Ga0207698_10026285
810 Ga0207698_10044591
811 Ga0209970_1037626
812 Ga0209983_1032827
813 Ga0209971_1058734
814 Ga0209966_1051264
815 Ga0207428_11315441
816 Ga0268266_10127367
817 Ga0268266_10139216
818 Ga0268266_10701807
819 Ga0268266_10857773
820 Ga0268266_10949823
821 Ga0268265_10078557
822 Ga0268265_10098922
823 Ga0268264_10056253
824 Ga0307515_10537609
825 Ga0307513_10139101
826 Ga0307513_10383106
827 Ga0307513_10410703
828 Ga0307516_10124502
829 Ga0373958_0168057
830 Ga0373953_0433885
831 Ga0373954_0117453
832 Ga0373935_0723406
833 Ga0373933_0020611
834 Ga0373937_0027826
835 Ga0436360_0729957
836 Ga0451833_1425923
837 Ga0451855_0582285
838 Ga0451577_0670436
839 Ga0453684_1636916
840 Ga0495638_0001644
841 Ga0495650_0072039
842 Ga0495580_0029453
843 Ga0495585_0035955
844 Ga0495618_0426511
845 Ga0495598_0247108
846 Ga0495621_0015729
847 Ga0495656_0007537
848 Ga0495659_0003944
849 Ga0495661_0319512
850 Ga0495670_0017314
851 Ga0495672_0020648
852 Ga0495683_0237321
853 Ga0495677_0367748
854 Ga0496100_0780387
855 Ga0496101_0069070
856 Ga0496101_0122378
857 Ga0496104_0066977
858 Ga0496104_1216392
859 Ga0496105_0101059
860 Ga0496107_0622144
861 Ga0496109_0150789
862 Ga0496109_0188747
863 Ga0496110_0500331
864 Ga0496113_0069869
865 Ga0496113_0599641
866 Ga0496115_0057273
867 Ga0496115_0512812
868 Ga0496117_0216613
869 Ga0496126_0030622
870 Ga0501032_0010576
871 Ga0501033_0612110
872 Ga0501034_0111485
873 Ga0501034_0225596
874 Ga0501036_0703959
875 Ga0501038_0990280
876 Ga0501039_0013568
877 Ga0501043_0718380
878 Ga0501046_0000023
879 Ga0501046_0019967
880 Ga0501047_0036600
881 Ga0501047_0694958
882 Ga0501048_0265279
883 Ga0501048_0749097
884 Ga0501068_0532405
885 Ga0501068_0961427
886 Ga0501070_0027764
887 Ga0501072_0067614
888 Ga0501072_0067946
889 Ga0501072_0542906
890 Ga0501073_0059773
891 Ga0501073_0513365
892 Ga0501074_0493901
893 Ga0501074_1321138
894 Ga0501075_1107404
895 Ga0501076_0430446
896 Ga0501076_0984223
897 Ga0501077_0122881
898 Ga0501079_0064579
899 Ga0501079_0744942
900 Ga0501080_0106188
901 Ga0501080_0500968
902 Ga0501080_0745645
903 Ga0501081_0451596
904 Ga0501035_0063622
905 Ga0501035_0126752
906 Ga0501035_0983200
907 Ga0501045_0314407
908 nmdc:mga03683_8990_c1
909 nmdc:mga03n38_59651_c1
910 nmdc:mga05p37_239604_c1
911 nmdc:mga05p37_829630_c1
912 nmdc:mga05p37_917866_c1
913 nmdc:mga09592_13854_c1
914 nmdc:mga09592_418512_c1
915 nmdc:mga09592_82160_c1
916 nmdc:mga0qj67_230384_c1
917 nmdc:mga0qj67_81548_c1
918 nmdc:mga06r32_1758_c1
919 nmdc:mga06r32_241318_c1
920 nmdc:mga06r32_355412_c1
921 nmdc:mga06r32_611681_c1
922 nmdc:mga06r32_804466_c1
923 nmdc:mga08y16_413686_c1
924 nmdc:mga08y16_6186_c1
925 nmdc:mga08y16_985543_c1
926 nmdc:mga0n895_821615_c1
927 nmdc:mga0a205_395150_c1
928 Ga0500643_000707
929 Ga0500651_0342986
930 Ga0500562_003332
931 Ga0500593_118630
932 Ga0500604_0006209
933 Ga0500616_0011874
934 Ga0500627_0250608
935 Ga0500645_037777
936 Ga0501084_0835255
937 Ga0501082_0359383
938 Ga0501082_0359833
939 Ga0501082_1122836
940 2888427427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07784

DUF1622

Protein of unknown function (DUF1622)

24

105

0.87

Map