F450376

General Info

Members Datasets Scaffolds Average Seq Length
470 277 940 235

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100028888|Ga0070707_1000288883
Length 267
Sequence VACWWGREALRRTTSATLDTRCIGKGAFQPTETVMTVVGRVVALWRYPVKSMAAEELDGVEVSWHGLAGDRRWAFIRDGQVRSGFPWLTIRELPELAHHRPRFSEPGRPDASPTLVRTPSGAELDVADPALAAGFGPGVRVIKQNRGVFDTMPLSLLTTQTLAGLGRLVGADLAAGRFRPNLLVDASARDFPEDAWVGRVLRIGGLRMRVDQRDQRCVMVTIDPVTLRRNPAVLRAIARKRDSRLGVYGSTVAPGRVAVGDPVELEP

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
252 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
253 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
254 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
255 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
256 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
257 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
260 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
261 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
272 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
273 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
274 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
277 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0.85
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 4.04
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 17.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100028888 3300005468 Bacteria 5277
2 JGI25407J50210_10016358 3300003373 Bacteria 1921
3 JGI25405J52794_10054896 3300003911 Bacteria 857
4 Ga0065715_10127920 3300005293 Bacteria 2076
5 Ga0070683_100070555 3300005329 Bacteria 3259
6 Ga0070683_100345102 3300005329 Bacteria 1418
7 Ga0070690_100044067 3300005330 Bacteria 2831
8 Ga0068869_100008621 3300005334 Bacteria 6584
9 Ga0068869_100032279 3300005334 Bacteria 3689
10 Ga0068869_100046263 3300005334 Bacteria 3137
11 Ga0068869_100278163 3300005334 Bacteria 1345
12 Ga0070680_100092127 3300005336 Unclassified 2509
13 Ga0070680_100172570 3300005336 Bacteria 1820
14 Ga0070680_100290281 3300005336 Unclassified 1386
15 Ga0070680_100652608 3300005336 Bacteria 904
16 Ga0070682_100292738 3300005337 Bacteria 1191
17 Ga0068868_100020819 3300005338 Bacteria 4936
18 Ga0068868_100066735 3300005338 Bacteria 2861
19 Ga0070660_100050267 3300005339 Bacteria 3207
20 Ga0070689_100084248 3300005340 Unclassified 2498
21 Ga0070689_100086750 3300005340 Bacteria 2462
22 Ga0070689_100276125 3300005340 Bacteria 1393
23 Ga0070691_10121166 3300005341 Unclassified 1317
24 Ga0070687_100034798 3300005343 Bacteria 2496
25 Ga0070661_100037230 3300005344 Bacteria 3538
26 Ga0070661_100077016 3300005344 Bacteria 2458
27 Ga0070675_100001081 3300005354 Bacteria 19671
28 Ga0070688_100174643 3300005365 Unclassified 1486
29 Ga0070659_100121580 3300005366 Unclassified 2115
30 Ga0070659_100282249 3300005366 Bacteria 1382
31 Ga0070709_10003238 3300005434 Bacteria 8737
32 Ga0070709_10179031 3300005434 Bacteria 1487
33 Ga0070714_100002931 3300005435 Bacteria 12628
34 Ga0070714_100004938 3300005435 Bacteria 10137
35 Ga0070714_100016362 3300005435 Bacteria 5986
36 Ga0070714_100019862 3300005435 Bacteria 5481
37 Ga0070714_100122649 3300005435 Bacteria 2313
38 Ga0070714_100291296 3300005435 Bacteria 1519
39 Ga0070713_100007310 3300005436 Bacteria 7735
40 Ga0070713_100035189 3300005436 Bacteria 4029
41 Ga0070713_100043319 3300005436 Bacteria 3679
42 Ga0070713_100223925 3300005436 Bacteria 1707
43 Ga0070713_100271220 3300005436 Unclassified 1554
44 Ga0070713_100321861 3300005436 Unclassified 1428
45 Ga0070710_10000628 3300005437 Bacteria 16816
46 Ga0070711_100002609 3300005439 Bacteria 10320
47 Ga0070711_100038314 3300005439 Bacteria 3223
48 Ga0070711_100270532 3300005439 Bacteria 1340
49 Ga0070705_100013266 3300005440 Bacteria 4210
50 Ga0070700_100082117 3300005441 Bacteria 2083
51 Ga0070700_100246010 3300005441 Bacteria 1280
52 Ga0070700_100362515 3300005441 Bacteria 1078
53 Ga0070694_100024259 3300005444 Bacteria 3914
54 Ga0070694_100035678 3300005444 Bacteria 3290
55 Ga0070694_100255795 3300005444 Bacteria 1327
56 Ga0070708_100000689 3300005445 Bacteria 25705
57 Ga0070708_100021259 3300005445 Bacteria 5484
58 Ga0070708_100044529 3300005445 Bacteria 3902
59 Ga0070663_100000967 3300005455 Bacteria 15634
60 Ga0070663_100085744 3300005455 Bacteria 2324
61 Ga0070678_100138141 3300005456 Unclassified 1946
62 Ga0070662_100001373 3300005457 Bacteria 14973
63 Ga0070662_100052094 3300005457 Bacteria 2958
64 Ga0070662_100249765 3300005457 Unclassified 1425
65 Ga0070681_10000029 3300005458 Bacteria 104346
66 Ga0070681_10078090 3300005458 Bacteria 3267
67 Ga0070681_10240812 3300005458 Unclassified 1723
68 Ga0070685_10002157 3300005466 Bacteria 10142
69 Ga0070685_10003813 3300005466 Bacteria 7626
70 Ga0070706_100037601 3300005467 Bacteria 4470
71 Ga0070706_100053296 3300005467 Bacteria 3733
72 Ga0070707_100093800 3300005468 Bacteria 2906
73 Ga0070707_100350736 3300005468 Unclassified 1433
74 Ga0070698_100008172 3300005471 Bacteria 11313
75 Ga0070698_100035471 3300005471 Bacteria 5158
76 Ga0070698_100398883 3300005471 Unclassified 1309
77 Ga0070699_100005208 3300005518 Bacteria 11429
78 Ga0070699_100347182 3300005518 Unclassified 1336
79 Ga0070679_100111160 3300005530 Unclassified 2726
80 Ga0070684_100314342 3300005535 Unclassified 1438
81 Ga0070697_100007959 3300005536 Bacteria 8261
82 Ga0070697_100074685 3300005536 Bacteria 2786
83 Ga0070672_100144661 3300005543 Unclassified 1964
84 Ga0070686_100000051 3300005544 Bacteria 97285
85 Ga0070686_100047878 3300005544 Bacteria 2705
86 Ga0070695_100221385 3300005545 Unclassified 1364
87 Ga0070696_100050731 3300005546 Bacteria 2884
88 Ga0070693_100063871 3300005547 Bacteria 2147
89 Ga0070665_100269771 3300005548 Unclassified 1703
90 Ga0070704_100377217 3300005549 Bacteria 1204
91 Ga0068855_100390267 3300005563 Bacteria 1527
92 Ga0070664_100000851 3300005564 Bacteria 23587
93 Ga0070664_100092595 3300005564 Bacteria 2617
94 Ga0070664_100116445 3300005564 Bacteria 2337
95 Ga0070664_100374835 3300005564 Bacteria 1298
96 Ga0068857_100114940 3300005577 Unclassified 2420
97 Ga0068856_100089893 3300005614 Bacteria 3054
98 Ga0068856_100128144 3300005614 Bacteria 2541
99 Ga0068856_100721349 3300005614 Bacteria 1017
100 Ga0068852_100133064 3300005616 Unclassified 2292
101 Ga0068852_100187887 3300005616 Bacteria 1947
102 Ga0068852_100356946 3300005616 Bacteria 1429
103 Ga0068859_100253131 3300005617 Bacteria 1851
104 Ga0068864_100035393 3300005618 Bacteria 4251
105 Ga0068866_10096613 3300005718 Unclassified 1621
106 Ga0068870_10066261 3300005840 Bacteria 1956
107 Ga0068863_100161149 3300005841 Unclassified 2149
108 Ga0068863_100346663 3300005841 Bacteria 1446
109 Ga0068858_100131765 3300005842 Bacteria 2345
110 Ga0068858_100433957 3300005842 Unclassified 1264
111 Ga0068860_100080849 3300005843 Bacteria 3090
112 Ga0068860_100210460 3300005843 Unclassified 1886
113 Ga0068862_100030217 3300005844 Bacteria 4566
114 Ga0068862_100333677 3300005844 Unclassified 1403
115 Ga0081455_10001878 3300005937 Bacteria 25279
116 Ga0081455_10015143 3300005937 Bacteria 7506
117 Ga0081455_10088794 3300005937 Bacteria 2510
118 Ga0081538_10001150 3300005981 Bacteria 27987
119 Ga0081538_10029263 3300005981 Bacteria 3768
120 Ga0070717_10004179 3300006028 Bacteria 10406
121 Ga0070717_10014129 3300006028 Bacteria 6137
122 Ga0070717_10016149 3300006028 Bacteria 5784
123 Ga0070717_10180502 3300006028 Unclassified 1840
124 Ga0070715_10034221 3300006163 Bacteria 2081
125 Ga0070716_100052698 3300006173 Bacteria 2317
126 Ga0070716_100053657 3300006173 Bacteria 2299
127 Ga0070716_100226876 3300006173 Unclassified 1258
128 Ga0097621_100110261 3300006237 Bacteria 2325
129 Ga0097621_100162693 3300006237 Unclassified 1919
130 Ga0068871_100013882 3300006358 Bacteria 5989
131 Ga0068871_100295941 3300006358 Unclassified 1419
132 Ga0075431_100002131 3300006847 Bacteria 18915
133 Ga0075431_100094646 3300006847 Bacteria 3083
134 Ga0075434_100210662 3300006871 Bacteria 1964
135 Ga0075429_100069756 3300006880 Bacteria 3060
136 Ga0075429_100571272 3300006880 Bacteria 991
137 Ga0068865_100139391 3300006881 Unclassified 1827
138 Ga0097620_100253135 3300006931 Bacteria 1851
139 Ga0097620_101016316 3300006931 Bacteria 911
140 Ga0105251_10085252 3300009011 Unclassified 1456
141 Ga0105240_10307212 3300009093 Unclassified 1813
142 Ga0111539_10041175 3300009094 Bacteria 5555
143 Ga0105245_10010082 3300009098 Bacteria 8231
144 Ga0105247_10064551 3300009101 Unclassified 2275
145 Ga0105247_10416121 3300009101 Unclassified 961
146 Ga0105241_10142976 3300009174 Unclassified 1950
147 Ga0105242_10045069 3300009176 Bacteria 3573
148 Ga0105237_10378631 3300009545 Bacteria 1420
149 Ga0105238_10000012 3300009551 Bacteria 258862
150 Ga0105238_10313213 3300009551 Bacteria 1555
151 Ga0105249_10727525 3300009553 Bacteria 1054
152 Ga0105239_10140672 3300010375 Bacteria 2689
153 Ga0105239_10202773 3300010375 Unclassified 2222
154 Ga0105246_10195228 3300011119 Unclassified 1570
155 Ga0105246_10783382 3300011119 Bacteria 844
156 Ga0157339_1001414 3300012505 Bacteria 1465
157 Ga0157373_10015745 3300013100 Bacteria 5522
158 Ga0157373_10080223 3300013100 Bacteria 2301
159 Ga0157371_10096421 3300013102 Unclassified 2096
160 Ga0157370_10065612 3300013104 Bacteria 3434
161 Ga0157370_10137157 3300013104 Bacteria 2280
162 Ga0157369_10353095 3300013105 Bacteria 1527
163 Ga0157374_10195478 3300013296 Bacteria 1979
164 Ga0163162_10089756 3300013306 Bacteria 3155
165 Ga0157375_10087750 3300013308 Bacteria 3164
166 Ga0163163_10023935 3300014325 Bacteria 5807
167 Ga0163163_10115407 3300014325 Bacteria 2717
168 Ga0157380_10809889 3300014326 Bacteria 954
169 Ga0157377_10011096 3300014745 Bacteria 4485
170 Ga0157379_10017573 3300014968 Bacteria 6296
171 Ga0197907_10920391 3300020069 Unclassified 1248
172 Ga0206356_11433260 3300020070 Bacteria 1922
173 Ga0206353_10269845 3300020082 Bacteria 1860
174 Ga0213876_10004096 3300021384 Bacteria 8192
175 Ga0224712_10007830 3300022467 Bacteria 3131
176 Ga0207692_10027921 3300025898 Bacteria 2663
177 Ga0207692_10066683 3300025898 Bacteria 1882
178 Ga0207692_10088474 3300025898 Bacteria 1674
179 Ga0207692_10091281 3300025898 Unclassified 1652
180 Ga0207642_10021968 3300025899 Bacteria 2522
181 Ga0207642_10176797 3300025899 Bacteria 1159
182 Ga0207688_10068165 3300025901 Bacteria 2014
183 Ga0207688_10236010 3300025901 Bacteria 1105
184 Ga0207680_10393750 3300025903 Unclassified 978
185 Ga0207685_10005506 3300025905 Bacteria 3350
186 Ga0207685_10064627 3300025905 Bacteria 1462
187 Ga0207699_10009354 3300025906 Bacteria 4875
188 Ga0207699_10010005 3300025906 Bacteria 4744
189 Ga0207699_10262676 3300025906 Bacteria 1194
190 Ga0207643_10029651 3300025908 Bacteria 3044
191 Ga0207684_10085338 3300025910 Bacteria 2690
192 Ga0207684_10197696 3300025910 Bacteria 1734
193 Ga0207654_10297328 3300025911 Bacteria 1097
194 Ga0207707_10001755 3300025912 Bacteria 19921
195 Ga0207707_10071842 3300025912 Bacteria 3016
196 Ga0207695_10244480 3300025913 Unclassified 1695
197 Ga0207671_10336548 3300025914 Unclassified 1196
198 Ga0207693_10008629 3300025915 Bacteria 8339
199 Ga0207693_10049415 3300025915 Bacteria 3303
200 Ga0207693_10054344 3300025915 Bacteria 3142
201 Ga0207693_10092322 3300025915 Bacteria 2373
202 Ga0207693_10227376 3300025915 Bacteria 1465
203 Ga0207660_10104557 3300025917 Unclassified 2120
204 Ga0207662_10415191 3300025918 Bacteria 915
205 Ga0207657_10035141 3300025919 Bacteria 4498
206 Ga0207649_10012030 3300025920 Bacteria 4787
207 Ga0207649_10100580 3300025920 Bacteria 1912
208 Ga0207646_10101724 3300025922 Bacteria 2576
209 Ga0207646_10280473 3300025922 Unclassified 1506
210 Ga0207694_10000025 3300025924 Bacteria 258871
211 Ga0207659_10060397 3300025926 Bacteria 2728
212 Ga0207687_10105823 3300025927 Bacteria 2079
213 Ga0207700_10004027 3300025928 Bacteria 8603
214 Ga0207700_10026366 3300025928 Bacteria 4050
215 Ga0207700_10056878 3300025928 Bacteria 2947
216 Ga0207700_10060045 3300025928 Bacteria 2878
217 Ga0207700_10147720 3300025928 Bacteria 1939
218 Ga0207700_10208395 3300025928 Unclassified 1651
219 Ga0207700_10209768 3300025928 Bacteria 1646
220 Ga0207664_10004975 3300025929 Bacteria 9034
221 Ga0207664_10024533 3300025929 Bacteria 4533
222 Ga0207664_10028748 3300025929 Bacteria 4227
223 Ga0207664_10056111 3300025929 Bacteria 3128
224 Ga0207664_10091873 3300025929 Bacteria 2490
225 Ga0207664_10121207 3300025929 Bacteria 2189
226 Ga0207664_10124361 3300025929 Bacteria 2163
227 Ga0207690_10042400 3300025932 Bacteria 2988
228 Ga0207690_10115046 3300025932 Unclassified 1943
229 Ga0207706_10000696 3300025933 Bacteria 35110
230 Ga0207706_10034843 3300025933 Bacteria 4478
231 Ga0207706_10180637 3300025933 Bacteria 1853
232 Ga0207670_10160735 3300025936 Unclassified 1676
233 Ga0207670_10172114 3300025936 Bacteria 1625
234 Ga0207669_10282131 3300025937 Bacteria 1253
235 Ga0207704_10105986 3300025938 Bacteria 1887
236 Ga0207665_10002754 3300025939 Bacteria 11791
237 Ga0207665_10014577 3300025939 Bacteria 5176
238 Ga0207665_10067967 3300025939 Bacteria 2427
239 Ga0207665_10105603 3300025939 Bacteria 1972
240 Ga0207691_10048963 3300025940 Bacteria 3873
241 Ga0207689_10015139 3300025942 Bacteria 6538
242 Ga0207689_10044535 3300025942 Bacteria 3669
243 Ga0207661_10012485 3300025944 Bacteria 6173
244 Ga0207661_10212543 3300025944 Bacteria 1706
245 Ga0207679_10096674 3300025945 Bacteria 2299
246 Ga0207679_10124048 3300025945 Unclassified 2061
247 Ga0207679_10241726 3300025945 Bacteria 1530
248 Ga0207651_10072251 3300025960 Unclassified 2449
249 Ga0207712_10705098 3300025961 Bacteria 881
250 Ga0207640_10498041 3300025981 Bacteria 1014
251 Ga0207677_10000881 3300026023 Bacteria 16925
252 Ga0207677_10048076 3300026023 Bacteria 2870
253 Ga0207703_10173536 3300026035 Bacteria 1898
254 Ga0207703_10199989 3300026035 Unclassified 1775
255 Ga0207678_10002385 3300026067 Bacteria 17067
256 Ga0207678_10120354 3300026067 Bacteria 2240
257 Ga0207708_10088748 3300026075 Bacteria 2382
258 Ga0207708_10117916 3300026075 Bacteria 2066
259 Ga0207702_10012641 3300026078 Bacteria 7029
260 Ga0207702_10049918 3300026078 Bacteria 3531
261 Ga0207702_10156772 3300026078 Bacteria 2076
262 Ga0207702_10645573 3300026078 Bacteria 1041
263 Ga0207641_10070677 3300026088 Bacteria 3000
264 Ga0207641_10320981 3300026088 Unclassified 1468
265 Ga0207648_10066175 3300026089 Bacteria 3152
266 Ga0207676_10107798 3300026095 Bacteria 2324
267 Ga0207674_10068488 3300026116 Bacteria 3571
268 Ga0207674_10104958 3300026116 Bacteria 2804
269 Ga0207674_10373486 3300026116 Bacteria 1378
270 Ga0207675_100044057 3300026118 Bacteria 4167
271 Ga0207683_10003422 3300026121 Bacteria 13825
272 Ga0207698_10087064 3300026142 Bacteria 2543
273 Ga0207698_10403215 3300026142 Bacteria 1307
274 Ga0207428_10025357 3300027907 Bacteria 4963
275 Ga0268264_10083087 3300028381 Bacteria 2743
276 Ga0307515_10071519 3300028794 Bacteria 4699
277 Ga0265338_10009121 3300028800 Bacteria 11916
278 Ga0265338_10034533 3300028800 Bacteria 4885
279 Ga0265340_10003646 3300031247 Bacteria 8656
280 Ga0265340_10007356 3300031247 Bacteria 5982
281 Ga0307513_10044012 3300031456 Bacteria 4895
282 Ga0307509_10191194 3300031507 Bacteria 1897
283 Ga0307509_10275373 3300031507 Unclassified 1448
284 Ga0307408_100152839 3300031548 Bacteria 1824
285 Ga0307405_10008968 3300031731 Bacteria 5105
286 Ga0307405_10021680 3300031731 Bacteria 3616
287 Ga0307413_10762245 3300031824 Bacteria 810
288 Ga0307410_10138154 3300031852 Bacteria 1799
289 Ga0307406_10052815 3300031901 Bacteria 2586
290 Ga0307406_10568980 3300031901 Bacteria 930
291 Ga0307406_10763752 3300031901 Bacteria 813
292 Ga0307407_10020181 3300031903 Bacteria 3409
293 Ga0307412_10074546 3300031911 Bacteria 2325
294 Ga0307412_10488304 3300031911 Bacteria 1023
295 Ga0307409_100020474 3300031995 Bacteria 4510
296 Ga0307409_100245517 3300031995 Bacteria 1633
297 Ga0307409_100247433 3300031995 Bacteria 1628
298 Ga0307409_100402808 3300031995 Bacteria 1307
299 Ga0307416_100001108 3300032002 Bacteria 14458
300 Ga0307416_100411701 3300032002 Bacteria 1393
301 Ga0307415_100000022 3300032126 Bacteria 65606
302 Ga0307415_100047647 3300032126 Bacteria 2886
303 Ga0307415_100047811 3300032126 Bacteria 2882
304 Ga0373930_0007374 3300034816 Bacteria 1891
305 Ga0373959_0000047 3300034820 Bacteria 27481
306 Ga0373934_0015143 3300035086 Bacteria 2923
307 Ga0373934_0058326 3300035086 Unclassified 1536
308 Ga0373944_0011368 3300035089 Bacteria 2438
309 Ga0373936_0002488 3300035113 Bacteria 6899
310 Ga0373936_0016180 3300035113 Bacteria 2867
311 Ga0373936_0092441 3300035113 Bacteria 1269
312 Ga0373936_0161712 3300035113 Bacteria 976
313 Ga0373939_0075408 3300035114 Unclassified 1108
314 Ga0373941_0102730 3300035115 Bacteria 997
315 Ga0373945_0000278 3300035116 Bacteria 14458
316 Ga0373945_0030790 3300035116 Bacteria 1892
317 Ga0373945_0040706 3300035116 Bacteria 1678
318 Ga0373956_0047605 3300035119 Bacteria 1918
319 Ga0373943_0023879 3300035170 Bacteria 2846
320 Ga0373943_0147146 3300035170 Bacteria 1273
321 Ga0373946_0000090 3300035171 Bacteria 25070
322 Ga0373946_0153941 3300035171 Bacteria 1074
323 Ga0373955_0077223 3300035172 Bacteria 1875
324 Ga0373955_0097628 3300035172 Unclassified 1682
325 Ga0373961_0000074 3300035241 Bacteria 54115
326 Ga0373924_0137062 3300035410 Bacteria 1066
327 Ga0373931_0201952 3300035691 Bacteria 1188
328 Ga0373935_0045847 3300035692 Bacteria 2759
329 Ga0373935_0065870 3300035692 Unclassified 2326
330 Ga0373935_0070306 3300035692 Bacteria 2256
331 Ga0373935_0097956 3300035692 Bacteria 1929
332 Ga0373927_0068721 3300035695 Bacteria 2292
333 Ga0373933_0570701 3300035724 Bacteria 742
334 Ga0373933_0588466 3300035724 Unclassified 730
335 Ga0373947_0001630 3300035725 Bacteria 13765
336 Ga0373947_0149958 3300035725 Unclassified 1501
337 Ga0373937_0183708 3300036401 Bacteria 1964
338 Ga0373937_0445498 3300036401 Unclassified 1229
339 Ga0373937_1069581 3300036401 Unclassified 755
340 Ga0373925_0009367 3300037068 Bacteria 7130
341 Ga0436365_0045443 3300039437 Bacteria 10852
342 Ga0436365_0176025 3300039437 Bacteria 1033
343 Ga0439434_0018739 3300042435 Bacteria 2074
344 Ga0439440_0072745 3300042993 Bacteria 897
345 Ga0466966_0020905 3300044684 Bacteria 4303
346 Ga0466961_0001688 3300044693 Bacteria 13748
347 Ga0466963_0048600 3300044694 Bacteria 2804
348 Ga0453684_0113554 3300044712 Bacteria 3286
349 Ga0466957_0292906 3300044842 Bacteria 1092
350 Ga0466967_0811045 3300045976 Bacteria 929
351 Ga0495592_0108673 3300046454 Bacteria 1965
352 Ga0495603_0017071 3300046455 Bacteria 4394
353 Ga0495629_0028934 3300046459 Bacteria 3932
354 Ga0495629_0123938 3300046459 Unclassified 1800
355 Ga0495641_0005298 3300046461 Bacteria 8760
356 Ga0495651_0001803 3300046462 Bacteria 16519
357 Ga0495651_0025592 3300046462 Bacteria 4594
358 Ga0495651_0127565 3300046462 Bacteria 1861
359 Ga0495653_0001009 3300046463 Bacteria 21733
360 Ga0495653_0017085 3300046463 Bacteria 5902
361 Ga0495653_0020207 3300046463 Bacteria 5399
362 Ga0495580_0071279 3300046472 Bacteria 2427
363 Ga0495582_0015932 3300046473 Bacteria 4120
364 Ga0495639_0189975 3300046475 Bacteria 1002
365 Ga0495662_0132954 3300046476 Bacteria 1223
366 Ga0495662_0368714 3300046476 Unclassified 705
367 Ga0495664_0000476 3300046477 Bacteria 19912
368 Ga0495664_0051147 3300046477 Bacteria 2453
369 Ga0495664_0083590 3300046477 Unclassified 1915
370 Ga0495664_0189561 3300046477 Bacteria 1247
371 Ga0495594_0017341 3300046499 Bacteria 3803
372 Ga0495608_0017848 3300046511 Bacteria 4904
373 Ga0495608_0071900 3300046511 Bacteria 2256
374 Ga0495608_0075327 3300046511 Bacteria 2199
375 Ga0495618_0006109 3300046514 Bacteria 7305
376 Ga0495630_0023179 3300046517 Bacteria 4588
377 Ga0495630_0392877 3300046517 Bacteria 1062
378 Ga0495630_0790506 3300046517 Unclassified 724
379 Ga0495643_0000069 3300046522 Bacteria 172047
380 Ga0495666_0062422 3300046526 Bacteria 1779
381 Ga0495652_0042673 3300046529 Bacteria 3910
382 Ga0495652_0078087 3300046529 Bacteria 2741
383 Ga0495665_0101292 3300046531 Bacteria 1511
384 Ga0495640_0012413 3300046533 Bacteria 6507
385 Ga0495586_0074321 3300046535 Bacteria 1860
386 Ga0495587_0002185 3300046536 Bacteria 13084
387 Ga0495645_0104878 3300046543 Bacteria 2006
388 Ga0495645_0108573 3300046543 Bacteria 1965
389 Ga0495645_0209387 3300046543 Bacteria 1317
390 Ga0495667_0035760 3300046559 Bacteria 3318
391 Ga0495667_0071340 3300046559 Bacteria 2265
392 Ga0495634_0359505 3300046642 Bacteria 870
393 Ga0495635_0030908 3300046663 Bacteria 3719
394 Ga0495635_0369386 3300046663 Unclassified 955
395 Ga0495657_0012408 3300046675 Bacteria 6332
396 Ga0495599_0064576 3300046678 Bacteria 2286
397 Ga0495623_0015250 3300046679 Bacteria 4965
398 Ga0495623_0188376 3300046679 Bacteria 1194
399 Ga0495646_0043324 3300046680 Bacteria 2756
400 Ga0495658_0070645 3300046683 Unclassified 2026
401 Ga0495613_0006819 3300046689 Bacteria 8529
402 Ga0495613_0256079 3300046689 Bacteria 1220
403 Ga0495624_0041296 3300046690 Bacteria 2951
404 Ga0495600_0043618 3300046809 Bacteria 2925
405 Ga0495581_0030072 3300047315 Bacteria 3149
406 Ga0495581_0036758 3300047315 Bacteria 2833
407 Ga0495581_0096098 3300047315 Bacteria 1720
408 Ga0495604_0008417 3300047317 Bacteria 8150
409 Ga0495604_0125804 3300047317 Bacteria 1848
410 Ga0495674_0004661 3300047319 Bacteria 13182
411 Ga0495674_0011413 3300047319 Bacteria 8383
412 Ga0495674_0255322 3300047319 Bacteria 1441
413 Ga0495676_0566398 3300047321 Unclassified 741
414 Ga0495680_0003722 3300047322 Bacteria 14871
415 Ga0495675_0050445 3300047444 Bacteria 2645
416 Ga0495675_0069169 3300047444 Bacteria 2230
417 Ga0495593_0108138 3300047673 Unclassified 1421
418 Ga0495593_0128191 3300047673 Bacteria 1289
419 Ga0495602_0226003 3300048088 Bacteria 1409
420 Ga0495614_0055309 3300048089 Unclassified 1702
421 Ga0496101_0135647 3300048904 Unclassified 1872
422 Ga0496104_0088658 3300048907 Bacteria 2955
423 Ga0496105_0006079 3300048908 Bacteria 9239
424 Ga0496105_0048849 3300048908 Unclassified 3493
425 Ga0496106_0041332 3300048909 Bacteria 3454
426 Ga0496107_0107905 3300048910 Unclassified 2044
427 Ga0496108_0017915 3300048911 Bacteria 5794
428 Ga0496108_0032833 3300048911 Bacteria 4311
429 Ga0496109_0014126 3300048912 Bacteria 6941
430 Ga0496109_0078756 3300048912 Bacteria 3035
431 Ga0496110_0028255 3300048913 Bacteria 4815
432 Ga0496111_0036695 3300048914 Bacteria 3505
433 Ga0496111_0104624 3300048914 Bacteria 2082
434 Ga0496111_0266889 3300048914 Bacteria 1270
435 Ga0496113_0323869 3300048916 Bacteria 1235
436 Ga0496114_0142038 3300048917 Bacteria 2079
437 Ga0496114_0176198 3300048917 Bacteria 1866
438 Ga0496115_0063387 3300048918 Bacteria 2982
439 Ga0496115_0245619 3300048918 Bacteria 1475
440 Ga0501070_0017614 3300049586 Bacteria 5997
441 Ga0501070_0206246 3300049586 Unclassified 1614
442 Ga0501216_013628 3300049660 Unclassified 1350
443 Ga0501217_010950 3300049661 Bacteria 1998
444 Ga0501223_039211 3300049663 Unclassified 920
445 Ga0501235_001687 3300049669 Bacteria 4737
446 Ga0501239_005308 3300049672 Bacteria 1295
447 Ga0501249_010579 3300049679 Bacteria 1932
448 Ga0501257_022732 3300049686 Bacteria 1485
449 Ga0501225_0014325 3300049705 Bacteria 2215
450 Ga0501234_011938 3300049707 Bacteria 1359
451 Ga0501268_002771 3300049765 Bacteria 2337
452 Ga0501270_028820 3300049767 Bacteria 902
453 nmdc:mga05p37_716387_c1 3300050507 Bacteria 1109
454 nmdc:mga09592_137328_c1 3300050508 Unclassified 2106
455 nmdc:mga09592_69931_c1 3300050508 Bacteria 2978
456 nmdc:mga06r32_12048_c1 3300050510 Bacteria 7793
457 nmdc:mga08y16_953286_c1 3300050511 Unclassified 841
458 nmdc:mga08x19_169220_c1 3300050514 Unclassified 1488
459 nmdc:mga08x19_261105_c1 3300050514 Bacteria 1197
460 Ga0495601_0162532 3300053077 Bacteria 1459
461 Ga0495612_0036806 3300053078 Bacteria 1986
462 Ga0495595_0052101 3300053084 Bacteria 1898
463 Ga0495619_0036649 3300053085 Bacteria 3194
464 Ga0500578_0154559 3300053086 Bacteria 1427
465 Ga0500646_0021845 3300053090 Bacteria 1707
466 Ga0500583_0168309 3300053092 Unclassified 1091
467 Ga0500642_0013031 3300053130 Bacteria 3040
468 Ga0500658_0011430 3300053134 Bacteria 3271
469 Ga0500637_0006117 3300053178 Bacteria 5895
470 2990091633 2990088156 Bacteria 6657676
471 Ga0070707_100028888
472 JGI25407J50210_10016358
473 JGI25405J52794_10054896
474 Ga0065715_10127920
475 Ga0070683_100070555
476 Ga0070683_100345102
477 Ga0070690_100044067
478 Ga0068869_100008621
479 Ga0068869_100032279
480 Ga0068869_100046263
481 Ga0068869_100278163
482 Ga0070680_100092127
483 Ga0070680_100172570
484 Ga0070680_100290281
485 Ga0070680_100652608
486 Ga0070682_100292738
487 Ga0068868_100020819
488 Ga0068868_100066735
489 Ga0070660_100050267
490 Ga0070689_100084248
491 Ga0070689_100086750
492 Ga0070689_100276125
493 Ga0070691_10121166
494 Ga0070687_100034798
495 Ga0070661_100037230
496 Ga0070661_100077016
497 Ga0070675_100001081
498 Ga0070688_100174643
499 Ga0070659_100121580
500 Ga0070659_100282249
501 Ga0070709_10003238
502 Ga0070709_10179031
503 Ga0070714_100002931
504 Ga0070714_100004938
505 Ga0070714_100016362
506 Ga0070714_100019862
507 Ga0070714_100122649
508 Ga0070714_100291296
509 Ga0070713_100007310
510 Ga0070713_100035189
511 Ga0070713_100043319
512 Ga0070713_100223925
513 Ga0070713_100271220
514 Ga0070713_100321861
515 Ga0070710_10000628
516 Ga0070711_100002609
517 Ga0070711_100038314
518 Ga0070711_100270532
519 Ga0070705_100013266
520 Ga0070700_100082117
521 Ga0070700_100246010
522 Ga0070700_100362515
523 Ga0070694_100024259
524 Ga0070694_100035678
525 Ga0070694_100255795
526 Ga0070708_100000689
527 Ga0070708_100021259
528 Ga0070708_100044529
529 Ga0070663_100000967
530 Ga0070663_100085744
531 Ga0070678_100138141
532 Ga0070662_100001373
533 Ga0070662_100052094
534 Ga0070662_100249765
535 Ga0070681_10000029
536 Ga0070681_10078090
537 Ga0070681_10240812
538 Ga0070685_10002157
539 Ga0070685_10003813
540 Ga0070706_100037601
541 Ga0070706_100053296
542 Ga0070707_100093800
543 Ga0070707_100350736
544 Ga0070698_100008172
545 Ga0070698_100035471
546 Ga0070698_100398883
547 Ga0070699_100005208
548 Ga0070699_100347182
549 Ga0070679_100111160
550 Ga0070684_100314342
551 Ga0070697_100007959
552 Ga0070697_100074685
553 Ga0070672_100144661
554 Ga0070686_100000051
555 Ga0070686_100047878
556 Ga0070695_100221385
557 Ga0070696_100050731
558 Ga0070693_100063871
559 Ga0070665_100269771
560 Ga0070704_100377217
561 Ga0068855_100390267
562 Ga0070664_100000851
563 Ga0070664_100092595
564 Ga0070664_100116445
565 Ga0070664_100374835
566 Ga0068857_100114940
567 Ga0068856_100089893
568 Ga0068856_100128144
569 Ga0068856_100721349
570 Ga0068852_100133064
571 Ga0068852_100187887
572 Ga0068852_100356946
573 Ga0068859_100253131
574 Ga0068864_100035393
575 Ga0068866_10096613
576 Ga0068870_10066261
577 Ga0068863_100161149
578 Ga0068863_100346663
579 Ga0068858_100131765
580 Ga0068858_100433957
581 Ga0068860_100080849
582 Ga0068860_100210460
583 Ga0068862_100030217
584 Ga0068862_100333677
585 Ga0081455_10001878
586 Ga0081455_10015143
587 Ga0081455_10088794
588 Ga0081538_10001150
589 Ga0081538_10029263
590 Ga0070717_10004179
591 Ga0070717_10014129
592 Ga0070717_10016149
593 Ga0070717_10180502
594 Ga0070715_10034221
595 Ga0070716_100052698
596 Ga0070716_100053657
597 Ga0070716_100226876
598 Ga0097621_100110261
599 Ga0097621_100162693
600 Ga0068871_100013882
601 Ga0068871_100295941
602 Ga0075431_100002131
603 Ga0075431_100094646
604 Ga0075434_100210662
605 Ga0075429_100069756
606 Ga0075429_100571272
607 Ga0068865_100139391
608 Ga0097620_100253135
609 Ga0097620_101016316
610 Ga0105251_10085252
611 Ga0105240_10307212
612 Ga0111539_10041175
613 Ga0105245_10010082
614 Ga0105247_10064551
615 Ga0105247_10416121
616 Ga0105241_10142976
617 Ga0105242_10045069
618 Ga0105237_10378631
619 Ga0105238_10000012
620 Ga0105238_10313213
621 Ga0105249_10727525
622 Ga0105239_10140672
623 Ga0105239_10202773
624 Ga0105246_10195228
625 Ga0105246_10783382
626 Ga0157339_1001414
627 Ga0157373_10015745
628 Ga0157373_10080223
629 Ga0157371_10096421
630 Ga0157370_10065612
631 Ga0157370_10137157
632 Ga0157369_10353095
633 Ga0157374_10195478
634 Ga0163162_10089756
635 Ga0157375_10087750
636 Ga0163163_10023935
637 Ga0163163_10115407
638 Ga0157380_10809889
639 Ga0157377_10011096
640 Ga0157379_10017573
641 Ga0197907_10920391
642 Ga0206356_11433260
643 Ga0206353_10269845
644 Ga0213876_10004096
645 Ga0224712_10007830
646 Ga0207692_10027921
647 Ga0207692_10066683
648 Ga0207692_10088474
649 Ga0207692_10091281
650 Ga0207642_10021968
651 Ga0207642_10176797
652 Ga0207688_10068165
653 Ga0207688_10236010
654 Ga0207680_10393750
655 Ga0207685_10005506
656 Ga0207685_10064627
657 Ga0207699_10009354
658 Ga0207699_10010005
659 Ga0207699_10262676
660 Ga0207643_10029651
661 Ga0207684_10085338
662 Ga0207684_10197696
663 Ga0207654_10297328
664 Ga0207707_10001755
665 Ga0207707_10071842
666 Ga0207695_10244480
667 Ga0207671_10336548
668 Ga0207693_10008629
669 Ga0207693_10049415
670 Ga0207693_10054344
671 Ga0207693_10092322
672 Ga0207693_10227376
673 Ga0207660_10104557
674 Ga0207662_10415191
675 Ga0207657_10035141
676 Ga0207649_10012030
677 Ga0207649_10100580
678 Ga0207646_10101724
679 Ga0207646_10280473
680 Ga0207694_10000025
681 Ga0207659_10060397
682 Ga0207687_10105823
683 Ga0207700_10004027
684 Ga0207700_10026366
685 Ga0207700_10056878
686 Ga0207700_10060045
687 Ga0207700_10147720
688 Ga0207700_10208395
689 Ga0207700_10209768
690 Ga0207664_10004975
691 Ga0207664_10024533
692 Ga0207664_10028748
693 Ga0207664_10056111
694 Ga0207664_10091873
695 Ga0207664_10121207
696 Ga0207664_10124361
697 Ga0207690_10042400
698 Ga0207690_10115046
699 Ga0207706_10000696
700 Ga0207706_10034843
701 Ga0207706_10180637
702 Ga0207670_10160735
703 Ga0207670_10172114
704 Ga0207669_10282131
705 Ga0207704_10105986
706 Ga0207665_10002754
707 Ga0207665_10014577
708 Ga0207665_10067967
709 Ga0207665_10105603
710 Ga0207691_10048963
711 Ga0207689_10015139
712 Ga0207689_10044535
713 Ga0207661_10012485
714 Ga0207661_10212543
715 Ga0207679_10096674
716 Ga0207679_10124048
717 Ga0207679_10241726
718 Ga0207651_10072251
719 Ga0207712_10705098
720 Ga0207640_10498041
721 Ga0207677_10000881
722 Ga0207677_10048076
723 Ga0207703_10173536
724 Ga0207703_10199989
725 Ga0207678_10002385
726 Ga0207678_10120354
727 Ga0207708_10088748
728 Ga0207708_10117916
729 Ga0207702_10012641
730 Ga0207702_10049918
731 Ga0207702_10156772
732 Ga0207702_10645573
733 Ga0207641_10070677
734 Ga0207641_10320981
735 Ga0207648_10066175
736 Ga0207676_10107798
737 Ga0207674_10068488
738 Ga0207674_10104958
739 Ga0207674_10373486
740 Ga0207675_100044057
741 Ga0207683_10003422
742 Ga0207698_10087064
743 Ga0207698_10403215
744 Ga0207428_10025357
745 Ga0268264_10083087
746 Ga0307515_10071519
747 Ga0265338_10009121
748 Ga0265338_10034533
749 Ga0265340_10003646
750 Ga0265340_10007356
751 Ga0307513_10044012
752 Ga0307509_10191194
753 Ga0307509_10275373
754 Ga0307408_100152839
755 Ga0307405_10008968
756 Ga0307405_10021680
757 Ga0307413_10762245
758 Ga0307410_10138154
759 Ga0307406_10052815
760 Ga0307406_10568980
761 Ga0307406_10763752
762 Ga0307407_10020181
763 Ga0307412_10074546
764 Ga0307412_10488304
765 Ga0307409_100020474
766 Ga0307409_100245517
767 Ga0307409_100247433
768 Ga0307409_100402808
769 Ga0307416_100001108
770 Ga0307416_100411701
771 Ga0307415_100000022
772 Ga0307415_100047647
773 Ga0307415_100047811
774 Ga0373930_0007374
775 Ga0373959_0000047
776 Ga0373934_0015143
777 Ga0373934_0058326
778 Ga0373944_0011368
779 Ga0373936_0002488
780 Ga0373936_0016180
781 Ga0373936_0092441
782 Ga0373936_0161712
783 Ga0373939_0075408
784 Ga0373941_0102730
785 Ga0373945_0000278
786 Ga0373945_0030790
787 Ga0373945_0040706
788 Ga0373956_0047605
789 Ga0373943_0023879
790 Ga0373943_0147146
791 Ga0373946_0000090
792 Ga0373946_0153941
793 Ga0373955_0077223
794 Ga0373955_0097628
795 Ga0373961_0000074
796 Ga0373924_0137062
797 Ga0373931_0201952
798 Ga0373935_0045847
799 Ga0373935_0065870
800 Ga0373935_0070306
801 Ga0373935_0097956
802 Ga0373927_0068721
803 Ga0373933_0570701
804 Ga0373933_0588466
805 Ga0373947_0001630
806 Ga0373947_0149958
807 Ga0373937_0183708
808 Ga0373937_0445498
809 Ga0373937_1069581
810 Ga0373925_0009367
811 Ga0436365_0045443
812 Ga0436365_0176025
813 Ga0439434_0018739
814 Ga0439440_0072745
815 Ga0466966_0020905
816 Ga0466961_0001688
817 Ga0466963_0048600
818 Ga0453684_0113554
819 Ga0466957_0292906
820 Ga0466967_0811045
821 Ga0495592_0108673
822 Ga0495603_0017071
823 Ga0495629_0028934
824 Ga0495629_0123938
825 Ga0495641_0005298
826 Ga0495651_0001803
827 Ga0495651_0025592
828 Ga0495651_0127565
829 Ga0495653_0001009
830 Ga0495653_0017085
831 Ga0495653_0020207
832 Ga0495580_0071279
833 Ga0495582_0015932
834 Ga0495639_0189975
835 Ga0495662_0132954
836 Ga0495662_0368714
837 Ga0495664_0000476
838 Ga0495664_0051147
839 Ga0495664_0083590
840 Ga0495664_0189561
841 Ga0495594_0017341
842 Ga0495608_0017848
843 Ga0495608_0071900
844 Ga0495608_0075327
845 Ga0495618_0006109
846 Ga0495630_0023179
847 Ga0495630_0392877
848 Ga0495630_0790506
849 Ga0495643_0000069
850 Ga0495666_0062422
851 Ga0495652_0042673
852 Ga0495652_0078087
853 Ga0495665_0101292
854 Ga0495640_0012413
855 Ga0495586_0074321
856 Ga0495587_0002185
857 Ga0495645_0104878
858 Ga0495645_0108573
859 Ga0495645_0209387
860 Ga0495667_0035760
861 Ga0495667_0071340
862 Ga0495634_0359505
863 Ga0495635_0030908
864 Ga0495635_0369386
865 Ga0495657_0012408
866 Ga0495599_0064576
867 Ga0495623_0015250
868 Ga0495623_0188376
869 Ga0495646_0043324
870 Ga0495658_0070645
871 Ga0495613_0006819
872 Ga0495613_0256079
873 Ga0495624_0041296
874 Ga0495600_0043618
875 Ga0495581_0030072
876 Ga0495581_0036758
877 Ga0495581_0096098
878 Ga0495604_0008417
879 Ga0495604_0125804
880 Ga0495674_0004661
881 Ga0495674_0011413
882 Ga0495674_0255322
883 Ga0495676_0566398
884 Ga0495680_0003722
885 Ga0495675_0050445
886 Ga0495675_0069169
887 Ga0495593_0108138
888 Ga0495593_0128191
889 Ga0495602_0226003
890 Ga0495614_0055309
891 Ga0496101_0135647
892 Ga0496104_0088658
893 Ga0496105_0006079
894 Ga0496105_0048849
895 Ga0496106_0041332
896 Ga0496107_0107905
897 Ga0496108_0017915
898 Ga0496108_0032833
899 Ga0496109_0014126
900 Ga0496109_0078756
901 Ga0496110_0028255
902 Ga0496111_0036695
903 Ga0496111_0104624
904 Ga0496111_0266889
905 Ga0496113_0323869
906 Ga0496114_0142038
907 Ga0496114_0176198
908 Ga0496115_0063387
909 Ga0496115_0245619
910 Ga0501070_0017614
911 Ga0501070_0206246
912 Ga0501216_013628
913 Ga0501217_010950
914 Ga0501223_039211
915 Ga0501235_001687
916 Ga0501239_005308
917 Ga0501249_010579
918 Ga0501257_022732
919 Ga0501225_0014325
920 Ga0501234_011938
921 Ga0501268_002771
922 Ga0501270_028820
923 nmdc:mga05p37_716387_c1
924 nmdc:mga09592_137328_c1
925 nmdc:mga09592_69931_c1
926 nmdc:mga06r32_12048_c1
927 nmdc:mga08y16_953286_c1
928 nmdc:mga08x19_169220_c1
929 nmdc:mga08x19_261105_c1
930 Ga0495601_0162532
931 Ga0495612_0036806
932 Ga0495595_0052101
933 Ga0495619_0036649
934 Ga0500578_0154559
935 Ga0500646_0021845
936 Ga0500583_0168309
937 Ga0500642_0013031
938 Ga0500658_0011430
939 Ga0500637_0006117
940 2990091633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

143

264

0.9

PF03476

MOSC_N

MOSC N-terminal beta barrel domain

38

130

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.8108 117 232
6fw2-assembly1.cif.gz_A crystal structure of human marc1 0.7662 1 232
6fw2-assembly1.cif.gz_A crystal structure of human marc1 0.763 1 232
7p41-assembly1.cif.gz_D crystal structure of human marc1 a165t variant 0.7614 1 232
7p41-assembly1.cif.gz_D crystal structure of human marc1 a165t variant 0.7583 1 232
ID Description Score Start End Superfamily
af_A1Z803_208_336_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9029 112 229 2.40.33.20
af_Q58EJ9_194_321_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8949 115 229 2.40.33.20
af_P75863_136_262_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8909 115 229 2.40.33.20
af_Q559G8_830_968_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8782 115 217 2.40.33.20
af_I1KZR4_670_814_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8708 115 218 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A6F8XVA2-F1-model_v4 MOSC domain-containing protein 0.989 2 232 GO:0003824
GO:0030151
GO:0030170
AF-A0A4R4TYH3-F1-model_v4 MOSC domain-containing protein 0.984 2 232 GO:0003824
GO:0030151
GO:0030170
AF-A0A848XK58-F1-model_v4 MOSC domain-containing protein 0.982 147 232 GO:0003824
GO:0030151
GO:0030170
AF-A0A7V9U2U0-F1-model_v4 MOSC domain-containing protein 0.9818 1 232 GO:0003824
GO:0030151
GO:0030170
AF-A0A6F8XVA2-F1-model_v4 MOSC domain-containing protein 0.9806 2 232 GO:0003824
GO:0030151
GO:0030170

Map