F450343

General Info

Members Datasets Scaffolds Average Seq Length
470 263 930 114

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10125424|JGI24735J21928_101254242
Length 131
Sequence MTRIVIRLKLSTGGKRVKYVLMFIETEEYLKELDAMTPGEREQAYQRVYQWFDDHRDKISDRGNKLQGAETATTVRLDGGVAMTTDGPFIEGKEVVSGFTEIDVADLDEALRMVKTWPACPVVEIRPVAEM

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
211 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
212 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
213 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
214 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
215 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
262 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
263 2867319477 Micromonospora musae MS1-9 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 2.98
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 3.4
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10125424 3300002067 Bacteria 740
2 JGI24747J21853_1044295 3300001978 Bacteria 533
3 JGI24740J21852_10048274 3300001979 Bacteria 1237
4 JGI24740J21852_10130977 3300001979 Bacteria 626
5 JGI24739J22299_10011365 3300001989 Bacteria 3288
6 JGI24739J22299_10050512 3300001989 Bacteria 1345
7 JGI24737J22298_10003727 3300001990 Bacteria 5368
8 JGI24743J22301_10075006 3300001991 Bacteria 709
9 JGI24033J26618_1039117 3300002155 Bacteria 657
10 JGI24751J29686_10006841 3300002459 Bacteria 2325
11 JGI25405J52794_10042660 3300003911 Bacteria 961
12 Ga0070658_10031279 3300005327 Bacteria 4273
13 Ga0070676_10041419 3300005328 Bacteria 2671
14 Ga0070683_100107057 3300005329 Bacteria 2636
15 Ga0070683_100497362 3300005329 Bacteria 1165
16 Ga0070690_100018839 3300005330 Bacteria 4178
17 Ga0070670_100135459 3300005331 Bacteria 2128
18 Ga0068869_100003677 3300005334 Bacteria 9428
19 Ga0070680_100211185 3300005336 Bacteria 1637
20 Ga0070680_100470981 3300005336 Bacteria 1073
21 Ga0070682_100010668 3300005337 Bacteria 5221
22 Ga0070682_100049061 3300005337 Bacteria 2631
23 Ga0070660_100060127 3300005339 Bacteria 2948
24 Ga0070660_100112554 3300005339 Bacteria 2167
25 Ga0070689_100013046 3300005340 Bacteria 6004
26 Ga0070691_10001537 3300005341 Bacteria 9931
27 Ga0070691_10073211 3300005341 Bacteria 1665
28 Ga0070687_100014356 3300005343 Bacteria 3557
29 Ga0070661_100205408 3300005344 Bacteria 1506
30 Ga0070692_10010663 3300005345 Bacteria 4193
31 Ga0070692_10111915 3300005345 Bacteria 1511
32 Ga0070668_100126438 3300005347 Bacteria 2048
33 Ga0070669_100300786 3300005353 Bacteria 1290
34 Ga0070675_100019030 3300005354 Bacteria 5471
35 Ga0070675_100946378 3300005354 Bacteria 790
36 Ga0070671_100001540 3300005355 Bacteria 17331
37 Ga0070673_100042768 3300005364 Bacteria 3495
38 Ga0070673_101653504 3300005364 Bacteria 605
39 Ga0070688_100251661 3300005365 Bacteria 1258
40 Ga0070659_100521757 3300005366 Bacteria 1014
41 Ga0070667_100171959 3300005367 Bacteria 1913
42 Ga0070667_101143417 3300005367 Bacteria 728
43 Ga0070709_10058278 3300005434 Bacteria 2449
44 Ga0070714_100027233 3300005435 Bacteria 4731
45 Ga0070714_100146794 3300005435 Bacteria 2123
46 Ga0070714_100219018 3300005435 Bacteria 1749
47 Ga0070714_102146285 3300005435 Bacteria 544
48 Ga0070713_100020148 3300005436 Bacteria 5107
49 Ga0070713_100068827 3300005436 Bacteria 2983
50 Ga0070713_100217675 3300005436 Unclassified 1731
51 Ga0070713_100254935 3300005436 Bacteria 1601
52 Ga0070710_10237755 3300005437 Bacteria 1166
53 Ga0070701_10074219 3300005438 Bacteria 1826
54 Ga0070701_10611654 3300005438 Bacteria 723
55 Ga0070711_100103619 3300005439 Bacteria 2074
56 Ga0070711_100557534 3300005439 Bacteria 951
57 Ga0070700_100025928 3300005441 Bacteria 3456
58 Ga0070708_100023438 3300005445 Bacteria 5249
59 Ga0070708_100224871 3300005445 Bacteria 1760
60 Ga0070708_100370345 3300005445 Bacteria 1350
61 Ga0070663_100014293 3300005455 Bacteria 5093
62 Ga0070663_100016105 3300005455 Bacteria 4843
63 Ga0070678_100015317 3300005456 Bacteria 4870
64 Ga0070681_10015074 3300005458 Bacteria 7688
65 Ga0070685_10013701 3300005466 Bacteria 4283
66 Ga0070706_100039735 3300005467 Bacteria 4342
67 Ga0070706_101062554 3300005467 Bacteria 746
68 Ga0070707_100027964 3300005468 Bacteria 5364
69 Ga0070698_100041435 3300005471 Bacteria 4727
70 Ga0070698_100261244 3300005471 Bacteria 1664
71 Ga0070679_100038843 3300005530 Bacteria 4733
72 Ga0070684_100065779 3300005535 Bacteria 3182
73 Ga0070684_100245395 3300005535 Bacteria 1637
74 Ga0070684_101127220 3300005535 Bacteria 737
75 Ga0068853_100971326 3300005539 Bacteria 817
76 Ga0068853_101122234 3300005539 Bacteria 758
77 Ga0070686_100206459 3300005544 Bacteria 1411
78 Ga0070695_100425077 3300005545 Bacteria 1012
79 Ga0070693_100016536 3300005547 Bacteria 3820
80 Ga0070665_100015934 3300005548 Bacteria 7545
81 Ga0070665_100402823 3300005548 Bacteria 1376
82 Ga0070704_100093342 3300005549 Bacteria 2249
83 Ga0070704_101770944 3300005549 Bacteria 571
84 Ga0068855_100557749 3300005563 Bacteria 1239
85 Ga0068855_102000574 3300005563 Bacteria 585
86 Ga0070664_100618317 3300005564 Bacteria 1005
87 Ga0070664_101415178 3300005564 Bacteria 657
88 Ga0068857_100035074 3300005577 Bacteria 4441
89 Ga0068857_100280856 3300005577 Bacteria 1531
90 Ga0068854_100008172 3300005578 Bacteria 6711
91 Ga0068854_101782528 3300005578 Bacteria 564
92 Ga0068856_100050865 3300005614 Bacteria 4086
93 Ga0068856_100099594 3300005614 Bacteria 2898
94 Ga0068856_100655091 3300005614 Bacteria 1071
95 Ga0068856_100977380 3300005614 Bacteria 865
96 Ga0070702_100001350 3300005615 Bacteria 9996
97 Ga0068852_100321114 3300005616 Bacteria 1504
98 Ga0068859_100028540 3300005617 Bacteria 5595
99 Ga0068864_100291583 3300005618 Bacteria 1525
100 Ga0068861_100077233 3300005719 Bacteria 2597
101 Ga0068861_100443819 3300005719 Bacteria 1161
102 Ga0068861_101014960 3300005719 Bacteria 793
103 Ga0068851_10021385 3300005834 Bacteria 3140
104 Ga0068870_10001960 3300005840 Bacteria 8508
105 Ga0068863_100002571 3300005841 Bacteria 17988
106 Ga0068863_100043704 3300005841 Bacteria 4253
107 Ga0068858_100040808 3300005842 Bacteria 4305
108 Ga0068858_101033969 3300005842 Bacteria 805
109 Ga0068860_100261871 3300005843 Bacteria 1686
110 Ga0068862_102419600 3300005844 Bacteria 537
111 Ga0081455_10113681 3300005937 Bacteria 2147
112 Ga0081455_10315547 3300005937 Bacteria 1115
113 Ga0081455_10315856 3300005937 Bacteria 1115
114 Ga0081455_10397926 3300005937 Bacteria 957
115 Ga0081538_10003803 3300005981 Bacteria 14112
116 Ga0081538_10003809 3300005981 Bacteria 14102
117 Ga0081538_10009818 3300005981 Bacteria 7919
118 Ga0081538_10010040 3300005981 Bacteria 7807
119 Ga0081538_10171707 3300005981 Bacteria 945
120 Ga0070717_10320013 3300006028 Bacteria 1382
121 Ga0070717_10626969 3300006028 Bacteria 976
122 Ga0075364_10025491 3300006051 Bacteria 3764
123 Ga0070716_100223742 3300006173 Bacteria 1266
124 Ga0070716_100442942 3300006173 Bacteria 945
125 Ga0070712_100431390 3300006175 Bacteria 1094
126 Ga0070712_101960495 3300006175 Bacteria 513
127 Ga0097621_100009873 3300006237 Bacteria 6951
128 Ga0068871_100240641 3300006358 Bacteria 1573
129 Ga0075428_100000242 3300006844 Bacteria 53310
130 Ga0075428_100094853 3300006844 Bacteria 3252
131 Ga0075428_100139279 3300006844 Bacteria 2638
132 Ga0075428_101249544 3300006844 Bacteria 782
133 Ga0075430_100004561 3300006846 Bacteria 11665
134 Ga0075430_100849447 3300006846 Bacteria 752
135 Ga0075431_100006680 3300006847 Bacteria 11458
136 Ga0075431_100061905 3300006847 Bacteria 3861
137 Ga0075431_100066267 3300006847 Bacteria 3728
138 Ga0075431_100333613 3300006847 Bacteria 1527
139 Ga0075433_10032545 3300006852 Bacteria 4466
140 Ga0075434_100024162 3300006871 Bacteria 5938
141 Ga0075434_100714815 3300006871 Bacteria 1019
142 Ga0075429_100008652 3300006880 Bacteria 8852
143 Ga0075429_100507109 3300006880 Bacteria 1057
144 Ga0068865_100675046 3300006881 Bacteria 880
145 Ga0075436_100032074 3300006914 Bacteria 3620
146 Ga0097620_100028540 3300006931 Bacteria 5595
147 Ga0075435_100003883 3300007076 Bacteria 10204
148 Ga0099794_10251721 3300007265 Bacteria 911
149 Ga0105251_10098230 3300009011 Bacteria 1340
150 Ga0105244_10594648 3300009036 Bacteria 507
151 Ga0105240_10042764 3300009093 Bacteria 5771
152 Ga0111539_10110216 3300009094 Bacteria 3230
153 Ga0105245_10021909 3300009098 Bacteria 5607
154 Ga0105245_12409029 3300009098 Bacteria 580
155 Ga0105247_10004455 3300009101 Bacteria 8927
156 Ga0114129_10018383 3300009147 Bacteria 9957
157 Ga0114129_10147359 3300009147 Bacteria 3223
158 Ga0114129_10195357 3300009147 Bacteria 2744
159 Ga0114129_11529507 3300009147 Bacteria 819
160 Ga0105243_11221323 3300009148 Bacteria 766
161 Ga0105241_10021836 3300009174 Bacteria 4737
162 Ga0105241_11104244 3300009174 Bacteria 747
163 Ga0105248_10151310 3300009177 Bacteria 2618
164 Ga0105237_10043058 3300009545 Bacteria 4550
165 Ga0105238_10057455 3300009551 Bacteria 3901
166 Ga0105238_10744092 3300009551 Bacteria 994
167 Ga0105249_11416164 3300009553 Bacteria 767
168 Ga0105249_11702092 3300009553 Bacteria 703
169 Ga0105239_10293544 3300010375 Bacteria 1831
170 Ga0105246_10006941 3300011119 Bacteria 6926
171 Ga0105246_10918729 3300011119 Bacteria 786
172 Ga0157373_10069171 3300013100 Bacteria 2496
173 Ga0157371_10055504 3300013102 Bacteria 2811
174 Ga0157370_10027801 3300013104 Bacteria 5575
175 Ga0157370_10042642 3300013104 Bacteria 4371
176 Ga0157369_10035062 3300013105 Bacteria 5503
177 Ga0157369_10323391 3300013105 Bacteria 1603
178 Ga0157369_11041147 3300013105 Bacteria 837
179 Ga0157374_10016135 3300013296 Bacteria 6564
180 Ga0163162_10507615 3300013306 Bacteria 1336
181 Ga0157375_10093071 3300013308 Bacteria 3079
182 Ga0157375_11600433 3300013308 Bacteria 770
183 Ga0182008_10017123 3300014497 Bacteria 3761
184 Ga0157377_10013728 3300014745 Bacteria 4107
185 Ga0157379_10090351 3300014968 Bacteria 2747
186 Ga0157376_10049846 3300014969 Bacteria 3470
187 Ga0157376_10656915 3300014969 Bacteria 1049
188 Ga0163161_11950790 3300017792 Bacteria 522
189 Ga0197907_10883340 3300020069 Bacteria 1059
190 Ga0206356_11810783 3300020070 Bacteria 3272
191 Ga0206352_10342854 3300020078 Bacteria 671
192 Ga0206350_10427882 3300020080 Bacteria 1076
193 Ga0206350_10886131 3300020080 Unclassified 750
194 Ga0206354_10450324 3300020081 Bacteria 514
195 Ga0206354_10650146 3300020081 Bacteria 4078
196 Ga0206353_10444535 3300020082 Bacteria 1074
197 Ga0206353_12046711 3300020082 Bacteria 1140
198 Ga0213875_10539161 3300021388 Bacteria 562
199 Ga0224712_10065864 3300022467 Bacteria 1457
200 Ga0224712_10067098 3300022467 Bacteria 1446
201 Ga0224712_10117354 3300022467 Bacteria 1148
202 Ga0224712_10253018 3300022467 Bacteria 814
203 Ga0224712_10590109 3300022467 Unclassified 542
204 Ga0207656_10002357 3300025321 Bacteria 6341
205 Ga0207692_10140085 3300025898 Unclassified 1375
206 Ga0207642_10726686 3300025899 Bacteria 627
207 Ga0207710_10011267 3300025900 Bacteria 3764
208 Ga0207688_10021625 3300025901 Bacteria 3517
209 Ga0207647_10018499 3300025904 Bacteria 4709
210 Ga0207699_10086035 3300025906 Bacteria 1962
211 Ga0207645_10049764 3300025907 Bacteria 2676
212 Ga0207643_10000153 3300025908 Bacteria 47442
213 Ga0207705_10016996 3300025909 Bacteria 5211
214 Ga0207705_10150174 3300025909 Bacteria 1746
215 Ga0207684_10217054 3300025910 Bacteria 1650
216 Ga0207684_10403299 3300025910 Bacteria 1175
217 Ga0207684_10902731 3300025910 Bacteria 743
218 Ga0207654_10054983 3300025911 Bacteria 2303
219 Ga0207707_10044784 3300025912 Bacteria 3856
220 Ga0207707_10117956 3300025912 Bacteria 2320
221 Ga0207695_10565209 3300025913 Bacteria 1019
222 Ga0207671_10172138 3300025914 Bacteria 1682
223 Ga0207693_10164197 3300025915 Bacteria 1748
224 Ga0207693_10672286 3300025915 Bacteria 803
225 Ga0207663_10053652 3300025916 Bacteria 2520
226 Ga0207663_10479435 3300025916 Bacteria 963
227 Ga0207660_10022830 3300025917 Bacteria 4218
228 Ga0207660_10054624 3300025917 Bacteria 2851
229 Ga0207662_10040233 3300025918 Bacteria 2747
230 Ga0207657_10022266 3300025919 Bacteria 5938
231 Ga0207657_10170429 3300025919 Bacteria 1764
232 Ga0207649_10014885 3300025920 Bacteria 4362
233 Ga0207649_10682006 3300025920 Bacteria 796
234 Ga0207652_10003031 3300025921 Bacteria 14014
235 Ga0207652_10023465 3300025921 Bacteria 5111
236 Ga0207646_10121049 3300025922 Bacteria 2351
237 Ga0207681_10305160 3300025923 Bacteria 1261
238 Ga0207694_10361358 3300025924 Bacteria 1203
239 Ga0207650_10004138 3300025925 Bacteria 9916
240 Ga0207659_10323780 3300025926 Bacteria 1272
241 Ga0207659_10902562 3300025926 Bacteria 760
242 Ga0207687_10268837 3300025927 Bacteria 1362
243 Ga0207687_11812240 3300025927 Bacteria 522
244 Ga0207700_10028826 3300025928 Bacteria 3911
245 Ga0207700_10038346 3300025928 Bacteria 3477
246 Ga0207700_10156881 3300025928 Bacteria 1886
247 Ga0207700_10246190 3300025928 Bacteria 1525
248 Ga0207664_10043326 3300025929 Bacteria 3518
249 Ga0207664_10100282 3300025929 Unclassified 2391
250 Ga0207664_11649947 3300025929 Bacteria 563
251 Ga0207664_11862741 3300025929 Bacteria 524
252 Ga0207644_10021953 3300025931 Bacteria 4354
253 Ga0207690_10436411 3300025932 Bacteria 1050
254 Ga0207690_10606446 3300025932 Bacteria 894
255 Ga0207690_10668749 3300025932 Bacteria 852
256 Ga0207690_10849375 3300025932 Bacteria 756
257 Ga0207709_10484725 3300025935 Bacteria 962
258 Ga0207670_10146197 3300025936 Bacteria 1748
259 Ga0207704_10615597 3300025938 Bacteria 891
260 Ga0207665_10116354 3300025939 Bacteria 1884
261 Ga0207665_10151469 3300025939 Bacteria 1661
262 Ga0207665_10338683 3300025939 Bacteria 1133
263 Ga0207711_10415151 3300025941 Bacteria 1251
264 Ga0207689_10000633 3300025942 Bacteria 33571
265 Ga0207661_10002456 3300025944 Bacteria 12740
266 Ga0207661_10250925 3300025944 Bacteria 1572
267 Ga0207679_10005017 3300025945 Bacteria 8267
268 Ga0207667_10986967 3300025949 Bacteria 830
269 Ga0207651_10028828 3300025960 Bacteria 3508
270 Ga0207712_11527835 3300025961 Bacteria 598
271 Ga0207668_11189161 3300025972 Bacteria 685
272 Ga0207668_11540821 3300025972 Bacteria 600
273 Ga0207640_10418199 3300025981 Bacteria 1096
274 Ga0207658_10239667 3300025986 Bacteria 1536
275 Ga0207677_10021306 3300026023 Bacteria 3957
276 Ga0207703_10028171 3300026035 Bacteria 4425
277 Ga0207639_10164619 3300026041 Bacteria 1872
278 Ga0207639_11675627 3300026041 Bacteria 596
279 Ga0207678_10000461 3300026067 Bacteria 36900
280 Ga0207678_10150564 3300026067 Bacteria 1986
281 Ga0207678_10815524 3300026067 Bacteria 824
282 Ga0207708_10012460 3300026075 Bacteria 6338
283 Ga0207702_10002326 3300026078 Bacteria 18162
284 Ga0207702_10003979 3300026078 Bacteria 13271
285 Ga0207702_10057611 3300026078 Bacteria 3303
286 Ga0207702_10242413 3300026078 Bacteria 1689
287 Ga0207702_12170288 3300026078 Bacteria 544
288 Ga0207641_10010293 3300026088 Bacteria 7687
289 Ga0207641_10405270 3300026088 Bacteria 1310
290 Ga0207676_10007323 3300026095 Bacteria 7826
291 Ga0207674_10130570 3300026116 Bacteria 2476
292 Ga0207674_10239213 3300026116 Bacteria 1762
293 Ga0207674_10274343 3300026116 Bacteria 1634
294 Ga0207675_100035286 3300026118 Bacteria 4665
295 Ga0207675_100620309 3300026118 Bacteria 1086
296 Ga0207675_100853850 3300026118 Bacteria 925
297 Ga0207683_10000693 3300026121 Bacteria 30909
298 Ga0207698_10158570 3300026142 Bacteria 1975
299 Ga0207698_10423869 3300026142 Bacteria 1277
300 Ga0207428_10012364 3300027907 Bacteria 7500
301 Ga0268266_10168004 3300028379 Bacteria 1989
302 Ga0268265_10521021 3300028380 Bacteria 1124
303 Ga0307509_10608334 3300031507 Bacteria 765
304 Ga0307408_100012948 3300031548 Bacteria 5530
305 Ga0307408_100185057 3300031548 Bacteria 1674
306 Ga0307408_101243882 3300031548 Bacteria 696
307 Ga0307408_101445389 3300031548 Unclassified 649
308 Ga0307408_101542165 3300031548 Bacteria 629
309 Ga0307405_10010025 3300031731 Bacteria 4887
310 Ga0307405_10088815 3300031731 Bacteria 2040
311 Ga0307405_10384916 3300031731 Bacteria 1093
312 Ga0307405_11322451 3300031731 Bacteria 628
313 Ga0307413_10044336 3300031824 Bacteria 2628
314 Ga0307413_10120478 3300031824 Bacteria 1776
315 Ga0307413_10470577 3300031824 Bacteria 1002
316 Ga0307413_11429813 3300031824 Bacteria 609
317 Ga0307410_10034735 3300031852 Bacteria 3269
318 Ga0307410_10060581 3300031852 Bacteria 2587
319 Ga0307410_10104465 3300031852 Bacteria 2037
320 Ga0307410_10159540 3300031852 Bacteria 1688
321 Ga0307410_10241228 3300031852 Bacteria 1401
322 Ga0307406_10003278 3300031901 Bacteria 8823
323 Ga0307406_10046619 3300031901 Bacteria 2728
324 Ga0307406_10135833 3300031901 Bacteria 1733
325 Ga0307406_10191351 3300031901 Bacteria 1498
326 Ga0307406_10404025 3300031901 Bacteria 1084
327 Ga0307406_10472739 3300031901 Bacteria 1011
328 Ga0307406_12027613 3300031901 Bacteria 515
329 Ga0307407_10000681 3300031903 Bacteria 10972
330 Ga0307407_10447866 3300031903 Bacteria 936
331 Ga0307407_10617853 3300031903 Bacteria 809
332 Ga0307407_10778447 3300031903 Bacteria 726
333 Ga0307407_11207687 3300031903 Bacteria 591
334 Ga0307407_11570481 3300031903 Bacteria 522
335 Ga0307409_100001633 3300031995 Bacteria 11222
336 Ga0307409_100055688 3300031995 Bacteria 3055
337 Ga0307409_100088754 3300031995 Bacteria 2525
338 Ga0307409_100464458 3300031995 Bacteria 1224
339 Ga0307409_100917211 3300031995 Bacteria 890
340 Ga0307409_101020843 3300031995 Bacteria 846
341 Ga0307409_101228538 3300031995 Bacteria 773
342 Ga0307416_100006937 3300032002 Bacteria 7139
343 Ga0307416_100028876 3300032002 Bacteria 4133
344 Ga0307416_100033074 3300032002 Bacteria 3916
345 Ga0307416_100080845 3300032002 Bacteria 2745
346 Ga0307416_100127614 3300032002 Bacteria 2281
347 Ga0307416_100240790 3300032002 Bacteria 1753
348 Ga0307416_100328294 3300032002 Bacteria 1536
349 Ga0307416_100591068 3300032002 Bacteria 1188
350 Ga0307416_102089575 3300032002 Bacteria 668
351 Ga0307416_102180839 3300032002 Bacteria 655
352 Ga0307416_103102892 3300032002 Bacteria 556
353 Ga0307416_103651977 3300032002 Bacteria 515
354 Ga0307414_10324153 3300032004 Bacteria 1312
355 Ga0307411_10008426 3300032005 Bacteria 5341
356 Ga0307411_10232322 3300032005 Bacteria 1438
357 Ga0307411_10787929 3300032005 Bacteria 836
358 Ga0307415_100001975 3300032126 Bacteria 10091
359 Ga0307415_100002279 3300032126 Bacteria 9514
360 Ga0307415_100004595 3300032126 Bacteria 7199
361 Ga0307415_100016624 3300032126 Bacteria 4390
362 Ga0307415_100024319 3300032126 Bacteria 3779
363 Ga0307415_100025205 3300032126 Bacteria 3727
364 Ga0307415_100027493 3300032126 Bacteria 3605
365 Ga0307415_100829480 3300032126 Bacteria 846
366 Ga0373936_0137168 3300035113 Bacteria 1055
367 Ga0373954_0056385 3300035118 Bacteria 1849
368 Ga0373943_0324786 3300035170 Bacteria 878
369 Ga0373937_1169128 3300036401 Bacteria 718
370 Ga0395899_0224749 3300037312 Bacteria 1299
371 Ga0395899_0229278 3300037312 Bacteria 1283
372 Ga0395899_0237781 3300037312 Bacteria 1255
373 Ga0395899_0770311 3300037312 Bacteria 597
374 Ga0395900_0025968 3300037418 Bacteria 5998
375 Ga0395900_0041897 3300037418 Bacteria 4718
376 Ga0395900_0248928 3300037418 Bacteria 1779
377 Ga0395900_0796605 3300037418 Bacteria 873
378 Ga0395898_0023277 3300037466 Bacteria 6260
379 Ga0395898_0061843 3300037466 Bacteria 3637
380 Ga0395898_0065215 3300037466 Bacteria 3531
381 Ga0395898_0343259 3300037466 Bacteria 1424
382 Ga0395898_1493915 3300037466 Bacteria 602
383 Ga0395905_0057066 3300037471 Bacteria 3652
384 Ga0395905_0124683 3300037471 Bacteria 2422
385 Ga0395905_0152987 3300037471 Bacteria 2170
386 Ga0395905_0154064 3300037471 Bacteria 2161
387 Ga0436364_1059220 3300037853 Bacteria 2308
388 Ga0436364_1387460 3300037853 Bacteria 1343
389 Ga0436364_1399775 3300037853 Bacteria 1743
390 Ga0395901_0011999 3300038443 Bacteria 8790
391 Ga0395901_0073070 3300038443 Bacteria 3576
392 Ga0395901_0145820 3300038443 Bacteria 2488
393 Ga0395901_0277122 3300038443 Bacteria 1743
394 Ga0395901_0277138 3300038443 Bacteria 1743
395 Ga0395901_0483451 3300038443 Bacteria 1263
396 Ga0395901_1976742 3300038443 Bacteria 530
397 Ga0451853_3213159 3300041512 Bacteria 624
398 Ga0439448_0037525 3300042005 Bacteria 1556
399 Ga0439448_0153661 3300042005 Bacteria 799
400 Ga0439450_217635 3300042008 Bacteria 514
401 Ga0439463_004491 3300042016 Bacteria 3502
402 Ga0439463_050662 3300042016 Bacteria 1059
403 Ga0450914_000889 3300042118 Bacteria 1667
404 Ga0450922_029422 3300042124 Bacteria 594
405 Ga0450923_026640 3300042125 Bacteria 1159
406 Ga0450902_083633 3300042137 Bacteria 562
407 Ga0439458_0073466 3300042157 Bacteria 866
408 Ga0439459_0021873 3300042438 Bacteria 1232
409 Ga0439464_0040498 3300042439 Bacteria 1327
410 Ga0439460_0058023 3300042461 Bacteria 1176
411 Ga0466969_0224488 3300044656 Bacteria 854
412 Ga0466961_0439697 3300044693 Bacteria 790
413 Ga0466963_0023627 3300044694 Bacteria 3907
414 Ga0466964_0593019 3300044706 Bacteria 607
415 Ga0466957_0148281 3300044842 Bacteria 1516
416 Ga0466967_0037007 3300045976 Bacteria 4172
417 Ga0495585_0036505 3300046492 Bacteria 2771
418 Ga0495594_0286669 3300046499 Bacteria 938
419 Ga0495670_0127561 3300046691 Bacteria 1325
420 Ga0495676_0138576 3300047321 Bacteria 1746
421 Ga0496100_0088820 3300048903 Bacteria 2104
422 Ga0496101_0095921 3300048904 Bacteria 2213
423 Ga0496102_0013608 3300048905 Bacteria 7051
424 Ga0496103_0082922 3300048906 Bacteria 2018
425 Ga0496104_0145777 3300048907 Bacteria 2273
426 Ga0496105_0007277 3300048908 Bacteria 8551
427 Ga0496106_0052602 3300048909 Bacteria 3073
428 Ga0496107_0034897 3300048910 Bacteria 3605
429 Ga0496108_0101256 3300048911 Bacteria 2458
430 Ga0496108_0153956 3300048911 Bacteria 1984
431 Ga0496109_0536625 3300048912 Bacteria 1104
432 Ga0496109_0802509 3300048912 Bacteria 879
433 Ga0496110_0021174 3300048913 Bacteria 5498
434 Ga0496111_0004745 3300048914 Bacteria 8623
435 Ga0496112_0142007 3300048915 Bacteria 2370
436 Ga0496115_0243825 3300048918 Bacteria 1481
437 Ga0496126_0021590 3300048929 Bacteria 6286
438 Ga0501039_1081005 3300049575 Bacteria 622
439 Ga0501047_0002862 3300049581 Bacteria 16375
440 Ga0501044_0377109 3300049823 Bacteria 1334
441 Ga0501044_0788347 3300049823 Bacteria 830
442 nmdc:mga00v17_111643_c2 3300050491 Bacteria 778
443 nmdc:mga0yw44_318665_c1 3300050492 Bacteria 627
444 nmdc:mga05p37_116878_c1 3300050507 Bacteria 3278
445 nmdc:mga05p37_458818_c1 3300050507 Bacteria 1473
446 nmdc:mga05p37_87070_c1 3300050507 Bacteria 3850
447 nmdc:mga09592_6460_c1 3300050508 Bacteria 9543
448 nmdc:mga0qj67_1298731_c1 3300050509 Bacteria 564
449 nmdc:mga0qj67_3190_c1 3300050509 Bacteria 11811
450 nmdc:mga06r32_1074236_c1 3300050510 Bacteria 755
451 nmdc:mga06r32_22117_c1 3300050510 Bacteria 5876
452 nmdc:mga06r32_320333_c1 3300050510 Bacteria 1536
453 nmdc:mga06r32_3665_c1 3300050510 Bacteria 13713
454 nmdc:mga08y16_35108_c1 3300050511 Bacteria 5267
455 nmdc:mga08y16_395340_c1 3300050511 Bacteria 1415
456 nmdc:mga0n895_1131850_c1 3300050512 Bacteria 759
457 nmdc:mga0n895_30845_c1 3300050512 Bacteria 5128
458 nmdc:mga0rr50_157500_c1 3300050513 Bacteria 1841
459 nmdc:mga08x19_254237_c1 3300050514 Bacteria 1214
460 nmdc:mga0a205_29392_c1 3300050515 Bacteria 5259
461 Ga0590074_069912 3300059423 Bacteria 661
462 Ga0590075_034852 3300059424 Bacteria 1281
463 2837270009 2837268691 Bacteria 7850704
464 2867314682 2867312974 Bacteria 7058875
465 2867322300 2867319477 Bacteria 7069771
466 JGI24735J21928_10125424
467 JGI24747J21853_1044295
468 JGI24740J21852_10048274
469 JGI24740J21852_10130977
470 JGI24739J22299_10011365
471 JGI24739J22299_10050512
472 JGI24737J22298_10003727
473 JGI24743J22301_10075006
474 JGI24033J26618_1039117
475 JGI24751J29686_10006841
476 JGI25405J52794_10042660
477 Ga0070658_10031279
478 Ga0070676_10041419
479 Ga0070683_100107057
480 Ga0070683_100497362
481 Ga0070690_100018839
482 Ga0070670_100135459
483 Ga0068869_100003677
484 Ga0070680_100211185
485 Ga0070680_100470981
486 Ga0070682_100010668
487 Ga0070682_100049061
488 Ga0070660_100060127
489 Ga0070660_100112554
490 Ga0070689_100013046
491 Ga0070691_10001537
492 Ga0070691_10073211
493 Ga0070687_100014356
494 Ga0070661_100205408
495 Ga0070692_10010663
496 Ga0070692_10111915
497 Ga0070668_100126438
498 Ga0070669_100300786
499 Ga0070675_100019030
500 Ga0070675_100946378
501 Ga0070671_100001540
502 Ga0070673_100042768
503 Ga0070673_101653504
504 Ga0070688_100251661
505 Ga0070659_100521757
506 Ga0070667_100171959
507 Ga0070667_101143417
508 Ga0070709_10058278
509 Ga0070714_100027233
510 Ga0070714_100146794
511 Ga0070714_100219018
512 Ga0070714_102146285
513 Ga0070713_100020148
514 Ga0070713_100068827
515 Ga0070713_100217675
516 Ga0070713_100254935
517 Ga0070710_10237755
518 Ga0070701_10074219
519 Ga0070701_10611654
520 Ga0070711_100103619
521 Ga0070711_100557534
522 Ga0070700_100025928
523 Ga0070708_100023438
524 Ga0070708_100224871
525 Ga0070708_100370345
526 Ga0070663_100014293
527 Ga0070663_100016105
528 Ga0070678_100015317
529 Ga0070681_10015074
530 Ga0070685_10013701
531 Ga0070706_100039735
532 Ga0070706_101062554
533 Ga0070707_100027964
534 Ga0070698_100041435
535 Ga0070698_100261244
536 Ga0070679_100038843
537 Ga0070684_100065779
538 Ga0070684_100245395
539 Ga0070684_101127220
540 Ga0068853_100971326
541 Ga0068853_101122234
542 Ga0070686_100206459
543 Ga0070695_100425077
544 Ga0070693_100016536
545 Ga0070665_100015934
546 Ga0070665_100402823
547 Ga0070704_100093342
548 Ga0070704_101770944
549 Ga0068855_100557749
550 Ga0068855_102000574
551 Ga0070664_100618317
552 Ga0070664_101415178
553 Ga0068857_100035074
554 Ga0068857_100280856
555 Ga0068854_100008172
556 Ga0068854_101782528
557 Ga0068856_100050865
558 Ga0068856_100099594
559 Ga0068856_100655091
560 Ga0068856_100977380
561 Ga0070702_100001350
562 Ga0068852_100321114
563 Ga0068859_100028540
564 Ga0068864_100291583
565 Ga0068861_100077233
566 Ga0068861_100443819
567 Ga0068861_101014960
568 Ga0068851_10021385
569 Ga0068870_10001960
570 Ga0068863_100002571
571 Ga0068863_100043704
572 Ga0068858_100040808
573 Ga0068858_101033969
574 Ga0068860_100261871
575 Ga0068862_102419600
576 Ga0081455_10113681
577 Ga0081455_10315547
578 Ga0081455_10315856
579 Ga0081455_10397926
580 Ga0081538_10003803
581 Ga0081538_10003809
582 Ga0081538_10009818
583 Ga0081538_10010040
584 Ga0081538_10171707
585 Ga0070717_10320013
586 Ga0070717_10626969
587 Ga0075364_10025491
588 Ga0070716_100223742
589 Ga0070716_100442942
590 Ga0070712_100431390
591 Ga0070712_101960495
592 Ga0097621_100009873
593 Ga0068871_100240641
594 Ga0075428_100000242
595 Ga0075428_100094853
596 Ga0075428_100139279
597 Ga0075428_101249544
598 Ga0075430_100004561
599 Ga0075430_100849447
600 Ga0075431_100006680
601 Ga0075431_100061905
602 Ga0075431_100066267
603 Ga0075431_100333613
604 Ga0075433_10032545
605 Ga0075434_100024162
606 Ga0075434_100714815
607 Ga0075429_100008652
608 Ga0075429_100507109
609 Ga0068865_100675046
610 Ga0075436_100032074
611 Ga0097620_100028540
612 Ga0075435_100003883
613 Ga0099794_10251721
614 Ga0105251_10098230
615 Ga0105244_10594648
616 Ga0105240_10042764
617 Ga0111539_10110216
618 Ga0105245_10021909
619 Ga0105245_12409029
620 Ga0105247_10004455
621 Ga0114129_10018383
622 Ga0114129_10147359
623 Ga0114129_10195357
624 Ga0114129_11529507
625 Ga0105243_11221323
626 Ga0105241_10021836
627 Ga0105241_11104244
628 Ga0105248_10151310
629 Ga0105237_10043058
630 Ga0105238_10057455
631 Ga0105238_10744092
632 Ga0105249_11416164
633 Ga0105249_11702092
634 Ga0105239_10293544
635 Ga0105246_10006941
636 Ga0105246_10918729
637 Ga0157373_10069171
638 Ga0157371_10055504
639 Ga0157370_10027801
640 Ga0157370_10042642
641 Ga0157369_10035062
642 Ga0157369_10323391
643 Ga0157369_11041147
644 Ga0157374_10016135
645 Ga0163162_10507615
646 Ga0157375_10093071
647 Ga0157375_11600433
648 Ga0182008_10017123
649 Ga0157377_10013728
650 Ga0157379_10090351
651 Ga0157376_10049846
652 Ga0157376_10656915
653 Ga0163161_11950790
654 Ga0197907_10883340
655 Ga0206356_11810783
656 Ga0206352_10342854
657 Ga0206350_10427882
658 Ga0206350_10886131
659 Ga0206354_10450324
660 Ga0206354_10650146
661 Ga0206353_10444535
662 Ga0206353_12046711
663 Ga0213875_10539161
664 Ga0224712_10065864
665 Ga0224712_10067098
666 Ga0224712_10117354
667 Ga0224712_10253018
668 Ga0224712_10590109
669 Ga0207656_10002357
670 Ga0207692_10140085
671 Ga0207642_10726686
672 Ga0207710_10011267
673 Ga0207688_10021625
674 Ga0207647_10018499
675 Ga0207699_10086035
676 Ga0207645_10049764
677 Ga0207643_10000153
678 Ga0207705_10016996
679 Ga0207705_10150174
680 Ga0207684_10217054
681 Ga0207684_10403299
682 Ga0207684_10902731
683 Ga0207654_10054983
684 Ga0207707_10044784
685 Ga0207707_10117956
686 Ga0207695_10565209
687 Ga0207671_10172138
688 Ga0207693_10164197
689 Ga0207693_10672286
690 Ga0207663_10053652
691 Ga0207663_10479435
692 Ga0207660_10022830
693 Ga0207660_10054624
694 Ga0207662_10040233
695 Ga0207657_10022266
696 Ga0207657_10170429
697 Ga0207649_10014885
698 Ga0207649_10682006
699 Ga0207652_10003031
700 Ga0207652_10023465
701 Ga0207646_10121049
702 Ga0207681_10305160
703 Ga0207694_10361358
704 Ga0207650_10004138
705 Ga0207659_10323780
706 Ga0207659_10902562
707 Ga0207687_10268837
708 Ga0207687_11812240
709 Ga0207700_10028826
710 Ga0207700_10038346
711 Ga0207700_10156881
712 Ga0207700_10246190
713 Ga0207664_10043326
714 Ga0207664_10100282
715 Ga0207664_11649947
716 Ga0207664_11862741
717 Ga0207644_10021953
718 Ga0207690_10436411
719 Ga0207690_10606446
720 Ga0207690_10668749
721 Ga0207690_10849375
722 Ga0207709_10484725
723 Ga0207670_10146197
724 Ga0207704_10615597
725 Ga0207665_10116354
726 Ga0207665_10151469
727 Ga0207665_10338683
728 Ga0207711_10415151
729 Ga0207689_10000633
730 Ga0207661_10002456
731 Ga0207661_10250925
732 Ga0207679_10005017
733 Ga0207667_10986967
734 Ga0207651_10028828
735 Ga0207712_11527835
736 Ga0207668_11189161
737 Ga0207668_11540821
738 Ga0207640_10418199
739 Ga0207658_10239667
740 Ga0207677_10021306
741 Ga0207703_10028171
742 Ga0207639_10164619
743 Ga0207639_11675627
744 Ga0207678_10000461
745 Ga0207678_10150564
746 Ga0207678_10815524
747 Ga0207708_10012460
748 Ga0207702_10002326
749 Ga0207702_10003979
750 Ga0207702_10057611
751 Ga0207702_10242413
752 Ga0207702_12170288
753 Ga0207641_10010293
754 Ga0207641_10405270
755 Ga0207676_10007323
756 Ga0207674_10130570
757 Ga0207674_10239213
758 Ga0207674_10274343
759 Ga0207675_100035286
760 Ga0207675_100620309
761 Ga0207675_100853850
762 Ga0207683_10000693
763 Ga0207698_10158570
764 Ga0207698_10423869
765 Ga0207428_10012364
766 Ga0268266_10168004
767 Ga0268265_10521021
768 Ga0307509_10608334
769 Ga0307408_100012948
770 Ga0307408_100185057
771 Ga0307408_101243882
772 Ga0307408_101445389
773 Ga0307408_101542165
774 Ga0307405_10010025
775 Ga0307405_10088815
776 Ga0307405_10384916
777 Ga0307405_11322451
778 Ga0307413_10044336
779 Ga0307413_10120478
780 Ga0307413_10470577
781 Ga0307413_11429813
782 Ga0307410_10034735
783 Ga0307410_10060581
784 Ga0307410_10104465
785 Ga0307410_10159540
786 Ga0307410_10241228
787 Ga0307406_10003278
788 Ga0307406_10046619
789 Ga0307406_10135833
790 Ga0307406_10191351
791 Ga0307406_10404025
792 Ga0307406_10472739
793 Ga0307406_12027613
794 Ga0307407_10000681
795 Ga0307407_10447866
796 Ga0307407_10617853
797 Ga0307407_10778447
798 Ga0307407_11207687
799 Ga0307407_11570481
800 Ga0307409_100001633
801 Ga0307409_100055688
802 Ga0307409_100088754
803 Ga0307409_100464458
804 Ga0307409_100917211
805 Ga0307409_101020843
806 Ga0307409_101228538
807 Ga0307416_100006937
808 Ga0307416_100028876
809 Ga0307416_100033074
810 Ga0307416_100080845
811 Ga0307416_100127614
812 Ga0307416_100240790
813 Ga0307416_100328294
814 Ga0307416_100591068
815 Ga0307416_102089575
816 Ga0307416_102180839
817 Ga0307416_103102892
818 Ga0307416_103651977
819 Ga0307414_10324153
820 Ga0307411_10008426
821 Ga0307411_10232322
822 Ga0307411_10787929
823 Ga0307415_100001975
824 Ga0307415_100002279
825 Ga0307415_100004595
826 Ga0307415_100016624
827 Ga0307415_100024319
828 Ga0307415_100025205
829 Ga0307415_100027493
830 Ga0307415_100829480
831 Ga0373936_0137168
832 Ga0373954_0056385
833 Ga0373943_0324786
834 Ga0373937_1169128
835 Ga0395899_0224749
836 Ga0395899_0229278
837 Ga0395899_0237781
838 Ga0395899_0770311
839 Ga0395900_0025968
840 Ga0395900_0041897
841 Ga0395900_0248928
842 Ga0395900_0796605
843 Ga0395898_0023277
844 Ga0395898_0061843
845 Ga0395898_0065215
846 Ga0395898_0343259
847 Ga0395898_1493915
848 Ga0395905_0057066
849 Ga0395905_0124683
850 Ga0395905_0152987
851 Ga0395905_0154064
852 Ga0436364_1059220
853 Ga0436364_1387460
854 Ga0436364_1399775
855 Ga0395901_0011999
856 Ga0395901_0073070
857 Ga0395901_0145820
858 Ga0395901_0277122
859 Ga0395901_0277138
860 Ga0395901_0483451
861 Ga0395901_1976742
862 Ga0451853_3213159
863 Ga0439448_0037525
864 Ga0439448_0153661
865 Ga0439450_217635
866 Ga0439463_004491
867 Ga0439463_050662
868 Ga0450914_000889
869 Ga0450922_029422
870 Ga0450923_026640
871 Ga0450902_083633
872 Ga0439458_0073466
873 Ga0439459_0021873
874 Ga0439464_0040498
875 Ga0439460_0058023
876 Ga0466969_0224488
877 Ga0466961_0439697
878 Ga0466963_0023627
879 Ga0466964_0593019
880 Ga0466957_0148281
881 Ga0466967_0037007
882 Ga0495585_0036505
883 Ga0495594_0286669
884 Ga0495670_0127561
885 Ga0495676_0138576
886 Ga0496100_0088820
887 Ga0496101_0095921
888 Ga0496102_0013608
889 Ga0496103_0082922
890 Ga0496104_0145777
891 Ga0496105_0007277
892 Ga0496106_0052602
893 Ga0496107_0034897
894 Ga0496108_0101256
895 Ga0496108_0153956
896 Ga0496109_0536625
897 Ga0496109_0802509
898 Ga0496110_0021174
899 Ga0496111_0004745
900 Ga0496112_0142007
901 Ga0496115_0243825
902 Ga0496126_0021590
903 Ga0501039_1081005
904 Ga0501047_0002862
905 Ga0501044_0377109
906 Ga0501044_0788347
907 nmdc:mga00v17_111643_c2
908 nmdc:mga0yw44_318665_c1
909 nmdc:mga05p37_116878_c1
910 nmdc:mga05p37_458818_c1
911 nmdc:mga05p37_87070_c1
912 nmdc:mga09592_6460_c1
913 nmdc:mga0qj67_1298731_c1
914 nmdc:mga0qj67_3190_c1
915 nmdc:mga06r32_1074236_c1
916 nmdc:mga06r32_22117_c1
917 nmdc:mga06r32_320333_c1
918 nmdc:mga06r32_3665_c1
919 nmdc:mga08y16_35108_c1
920 nmdc:mga08y16_395340_c1
921 nmdc:mga0n895_1131850_c1
922 nmdc:mga0n895_30845_c1
923 nmdc:mga0rr50_157500_c1
924 nmdc:mga08x19_254237_c1
925 nmdc:mga0a205_29392_c1
926 Ga0590074_069912
927 Ga0590075_034852
928 2837270009
929 2867314682
930 2867322300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

17

131

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8264 2 113
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8071 2 113
4m08-assembly1.cif.gz_C crystal structure of mutant chlorite dismutase from candidatus nitrospira defluvii w145v 0.7367 2 98
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7102 1 114
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6814 1 112
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8264 2 113 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8071 2 113 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7581 1 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7088 1 114 3.30.70.1060
6m7wA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.6968 9 41 1.20.120.160
ID Description Score Start End GO Terms
AF-A0A7J9Y3U4-F1-model_v4 YCII-related domain-containing protein 0.9734 1 112
AF-A0A1C4WRW7-F1-model_v4 Uncharacterized conserved protein 0.9717 1 113
AF-A0A846Z113-F1-model_v4 YCII-related domain-containing protein 0.9612 1 112
AF-A0A1C4WRW7-F1-model_v4 Uncharacterized conserved protein 0.9552 1 113
AF-A0A366LRM2-F1-model_v4 YCII-related domain-containing protein 0.954 7 112

Map