F450286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 290 | 438 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0143645|Ga0466970_0143645_70_1071 |
| Length | 318 |
| Sequence | MTDQTPLPGSSDSTGSPQSTRPDPVGPVDASLDPRYSGFATFARLPRLEDLRGADTVIWGVPFDAGVSYRPGARFGPTHVRQSSRLLRPYNPAQDSEPFARAQVADGGDLGVNPFDIEAAIASVTIGGDHTIALPLLRVQAERHGPIAVLHFDAHLDTWDTYFGAPYTHGTPFRRAAEEGLIDFEHSLHVGLRGPLYSRLDLDESEKLGFAAVHCRDFARQPLDDIINRVRERLGDRPVYVSLDIDVLDPAFAPGTGTPEAGGMSSLQLLEVLRGLEGLNVVGADVVEVSPAYDHAEITGIAAAHTIYEMLSILPGRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 2 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 3 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 6 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 7 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 8 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 9 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 10 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 11 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 12 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 13 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 14 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 15 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 16 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 17 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 18 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 19 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 20 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 21 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 22 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 23 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 24 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 25 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 26 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 27 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 28 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 29 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 97 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 148 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 149 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 156 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 158 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 162 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 186 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 187 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 261 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 262 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 285 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 288 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 289 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 290 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.54 |
| Metatranscriptomes | 0.85 |
| Isolates | 6.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.62 |
| Nodule | 0.43 |
| Rhizoplane | 9.38 |
| Rhizosphere | 78.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055539_1000014 | 3300003752 | Bacteria | 381086 |
| 2 | Ga0055533_1000002 | 3300003756 | Bacteria | 1196393 |
| 3 | Ga0055525_1000094 | 3300003759 | Bacteria | 138254 |
| 4 | Ga0055527_1000003 | 3300003760 | Bacteria | 705001 |
| 5 | Ga0055542_1000005 | 3300003762 | Bacteria | 550280 |
| 6 | Ga0055541_1002687 | 3300003841 | Bacteria | 3481 |
| 7 | Ga0070658_10020908 | 3300005327 | Bacteria | 5242 |
| 8 | Ga0070683_100010881 | 3300005329 | Bacteria | 7831 |
| 9 | Ga0070683_100069410 | 3300005329 | Bacteria | 3286 |
| 10 | Ga0070683_100187516 | 3300005329 | Bacteria | 1963 |
| 11 | Ga0070683_100207140 | 3300005329 | Bacteria | 1863 |
| 12 | Ga0070683_100351424 | 3300005329 | Bacteria | 1404 |
| 13 | Ga0070683_100491042 | 3300005329 | Bacteria | 1173 |
| 14 | Ga0068869_100089687 | 3300005334 | Bacteria | 2309 |
| 15 | Ga0070680_100036961 | 3300005336 | Bacteria | 3946 |
| 16 | Ga0070682_100170523 | 3300005337 | Bacteria | 1512 |
| 17 | Ga0070689_100032316 | 3300005340 | Bacteria | 3980 |
| 18 | Ga0070675_100043831 | 3300005354 | Bacteria | 3658 |
| 19 | Ga0070674_100089125 | 3300005356 | Bacteria | 2222 |
| 20 | Ga0070659_100123151 | 3300005366 | Bacteria | 2102 |
| 21 | Ga0070667_100081497 | 3300005367 | Bacteria | 2769 |
| 22 | Ga0070714_100000010 | 3300005435 | Bacteria | 262871 |
| 23 | Ga0070714_100053606 | 3300005435 | Bacteria | 3443 |
| 24 | Ga0070714_100080207 | 3300005435 | Bacteria | 2840 |
| 25 | Ga0070714_100139625 | 3300005435 | Bacteria | 2173 |
| 26 | Ga0070713_100324019 | 3300005436 | Bacteria | 1424 |
| 27 | Ga0070708_100023466 | 3300005445 | Bacteria | 5247 |
| 28 | Ga0070708_100056934 | 3300005445 | Bacteria | 3478 |
| 29 | Ga0070663_100068563 | 3300005455 | Bacteria | 2575 |
| 30 | Ga0070678_100077995 | 3300005456 | Bacteria | 2501 |
| 31 | Ga0070681_10007783 | 3300005458 | Bacteria | 10476 |
| 32 | Ga0070706_100001281 | 3300005467 | Bacteria | 26829 |
| 33 | Ga0070706_100019041 | 3300005467 | Bacteria | 6332 |
| 34 | Ga0070706_100034807 | 3300005467 | Bacteria | 4651 |
| 35 | Ga0070707_100004915 | 3300005468 | Bacteria | 12525 |
| 36 | Ga0070707_100005475 | 3300005468 | Bacteria | 11870 |
| 37 | Ga0070707_100058457 | 3300005468 | Bacteria | 3698 |
| 38 | Ga0070698_100063427 | 3300005471 | Bacteria | 3726 |
| 39 | Ga0070699_100020301 | 3300005518 | Bacteria | 5729 |
| 40 | Ga0070699_100208806 | 3300005518 | Bacteria | 1738 |
| 41 | Ga0070679_100169588 | 3300005530 | Bacteria | 2155 |
| 42 | Ga0070679_100298255 | 3300005530 | Bacteria | 1562 |
| 43 | Ga0070679_100306392 | 3300005530 | Bacteria | 1539 |
| 44 | Ga0070684_100065400 | 3300005535 | Bacteria | 3191 |
| 45 | Ga0070684_100245001 | 3300005535 | Bacteria | 1638 |
| 46 | Ga0070684_100253539 | 3300005535 | Bacteria | 1608 |
| 47 | Ga0070697_100001798 | 3300005536 | Bacteria | 16375 |
| 48 | Ga0070695_100025934 | 3300005545 | Bacteria | 3623 |
| 49 | Ga0070693_100068459 | 3300005547 | Bacteria | 2083 |
| 50 | Ga0068857_100068079 | 3300005577 | Bacteria | 3170 |
| 51 | Ga0068857_100078004 | 3300005577 | Bacteria | 2956 |
| 52 | Ga0068854_100030480 | 3300005578 | Bacteria | 3741 |
| 53 | Ga0068856_100099094 | 3300005614 | Bacteria | 2905 |
| 54 | Ga0068856_100284874 | 3300005614 | Bacteria | 1669 |
| 55 | Ga0070702_100025004 | 3300005615 | Bacteria | 3194 |
| 56 | Ga0068852_100116462 | 3300005616 | Bacteria | 2438 |
| 57 | Ga0068864_100574304 | 3300005618 | Bacteria | 1092 |
| 58 | Ga0068863_100055108 | 3300005841 | Bacteria | 3766 |
| 59 | Ga0068863_100310069 | 3300005841 | Bacteria | 1532 |
| 60 | Ga0068858_100032076 | 3300005842 | Bacteria | 4879 |
| 61 | Ga0068860_100051910 | 3300005843 | Bacteria | 3900 |
| 62 | Ga0068860_100072149 | 3300005843 | Bacteria | 3281 |
| 63 | Ga0081455_10023422 | 3300005937 | Bacteria | 5745 |
| 64 | Ga0081540_1000811 | 3300005983 | Bacteria | 28653 |
| 65 | Ga0070717_10026624 | 3300006028 | Bacteria | 4615 |
| 66 | Ga0070717_10389090 | 3300006028 | Bacteria | 1251 |
| 67 | Ga0070716_100109737 | 3300006173 | Bacteria | 1707 |
| 68 | Ga0070712_100090517 | 3300006175 | Bacteria | 2240 |
| 69 | Ga0070712_100091390 | 3300006175 | Bacteria | 2230 |
| 70 | Ga0070712_100210288 | 3300006175 | Bacteria | 1533 |
| 71 | Ga0097621_100289311 | 3300006237 | Bacteria | 1444 |
| 72 | Ga0075433_10085780 | 3300006852 | Bacteria | 2780 |
| 73 | Ga0075434_100275664 | 3300006871 | Bacteria | 1701 |
| 74 | Ga0075436_100142000 | 3300006914 | Bacteria | 1688 |
| 75 | Ga0075436_100237938 | 3300006914 | Bacteria | 1294 |
| 76 | Ga0075435_100087265 | 3300007076 | Bacteria | 2570 |
| 77 | Ga0105251_10040512 | 3300009011 | Bacteria | 2271 |
| 78 | Ga0105240_10127825 | 3300009093 | Bacteria | 3052 |
| 79 | Ga0105240_10181446 | 3300009093 | Bacteria | 2484 |
| 80 | Ga0105245_10074201 | 3300009098 | Bacteria | 3095 |
| 81 | Ga0105242_10129698 | 3300009176 | Bacteria | 2174 |
| 82 | Ga0105248_10018224 | 3300009177 | Bacteria | 7754 |
| 83 | Ga0105238_10256920 | 3300009551 | Bacteria | 1726 |
| 84 | Ga0099796_10091265 | 3300010159 | Bacteria | 1133 |
| 85 | Ga0105239_10421032 | 3300010375 | Bacteria | 1513 |
| 86 | Ga0105246_10062748 | 3300011119 | Bacteria | 2590 |
| 87 | Ga0157373_10051130 | 3300013100 | Bacteria | 2943 |
| 88 | Ga0157370_10354613 | 3300013104 | Bacteria | 1352 |
| 89 | Ga0157369_10013074 | 3300013105 | Bacteria | 9399 |
| 90 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 91 | Ga0157372_10000024 | 3300013307 | Bacteria | 197716 |
| 92 | Ga0157375_10059379 | 3300013308 | Bacteria | 3789 |
| 93 | Ga0157375_10189369 | 3300013308 | Bacteria | 2212 |
| 94 | Ga0206353_10017933 | 3300020082 | Bacteria | 2009 |
| 95 | Ga0206353_10976584 | 3300020082 | Bacteria | 1073 |
| 96 | Ga0206353_11457846 | 3300020082 | Bacteria | 4003 |
| 97 | Ga0213875_10046588 | 3300021388 | Bacteria | 2034 |
| 98 | Ga0213875_10047829 | 3300021388 | Bacteria | 2007 |
| 99 | Ga0213875_10077576 | 3300021388 | Bacteria | 1550 |
| 100 | Ga0213875_10123654 | 3300021388 | Bacteria | 1209 |
| 101 | Ga0224572_1005517 | 3300024225 | Bacteria | 2259 |
| 102 | Ga0209566_100094 | 3300025225 | Bacteria | 136227 |
| 103 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 104 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 105 | Ga0209147_100863 | 3300025229 | Bacteria | 14122 |
| 106 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 107 | Ga0209258_100989 | 3300025242 | Bacteria | 13125 |
| 108 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 109 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 110 | Ga0209455_1000091 | 3300025272 | Bacteria | 223115 |
| 111 | Ga0207692_10001913 | 3300025898 | Bacteria | 7921 |
| 112 | Ga0207688_10017076 | 3300025901 | Bacteria | 3944 |
| 113 | Ga0207685_10008790 | 3300025905 | Bacteria | 2899 |
| 114 | Ga0207699_10004178 | 3300025906 | Bacteria | 6917 |
| 115 | Ga0207699_10037571 | 3300025906 | Bacteria | 2769 |
| 116 | Ga0207705_10046568 | 3300025909 | Bacteria | 3117 |
| 117 | Ga0207684_10001352 | 3300025910 | Bacteria | 26867 |
| 118 | Ga0207684_10034667 | 3300025910 | Bacteria | 4288 |
| 119 | Ga0207684_10167421 | 3300025910 | Bacteria | 1894 |
| 120 | Ga0207684_10217022 | 3300025910 | Bacteria | 1650 |
| 121 | Ga0207707_10016808 | 3300025912 | Bacteria | 6375 |
| 122 | Ga0207693_10059820 | 3300025915 | Bacteria | 2985 |
| 123 | Ga0207663_10051739 | 3300025916 | Bacteria | 2559 |
| 124 | Ga0207663_10073110 | 3300025916 | Bacteria | 2218 |
| 125 | Ga0207660_10034352 | 3300025917 | Bacteria | 3514 |
| 126 | Ga0207657_10027507 | 3300025919 | Bacteria | 5207 |
| 127 | Ga0207652_10073490 | 3300025921 | Bacteria | 2975 |
| 128 | Ga0207646_10003507 | 3300025922 | Bacteria | 17673 |
| 129 | Ga0207646_10019025 | 3300025922 | Bacteria | 6393 |
| 130 | Ga0207646_10021654 | 3300025922 | Bacteria | 5934 |
| 131 | Ga0207646_10044116 | 3300025922 | Bacteria | 4003 |
| 132 | Ga0207646_10202492 | 3300025922 | Bacteria | 1793 |
| 133 | Ga0207681_10158420 | 3300025923 | Bacteria | 1704 |
| 134 | Ga0207659_10077033 | 3300025926 | Bacteria | 2453 |
| 135 | Ga0207700_10122806 | 3300025928 | Bacteria | 2108 |
| 136 | Ga0207700_10274557 | 3300025928 | Bacteria | 1448 |
| 137 | Ga0207664_10000009 | 3300025929 | Bacteria | 299246 |
| 138 | Ga0207664_10058197 | 3300025929 | Bacteria | 3074 |
| 139 | Ga0207664_10069239 | 3300025929 | Bacteria | 2837 |
| 140 | Ga0207664_10079131 | 3300025929 | Bacteria | 2667 |
| 141 | Ga0207664_10571693 | 3300025929 | Bacteria | 1015 |
| 142 | Ga0207690_10100670 | 3300025932 | Bacteria | 2063 |
| 143 | Ga0207706_10030200 | 3300025933 | Bacteria | 4836 |
| 144 | Ga0207686_10273850 | 3300025934 | Bacteria | 1243 |
| 145 | Ga0207669_10011165 | 3300025937 | Bacteria | 4360 |
| 146 | Ga0207669_10109131 | 3300025937 | Bacteria | 1850 |
| 147 | Ga0207691_10035018 | 3300025940 | Bacteria | 4666 |
| 148 | Ga0207711_10074580 | 3300025941 | Bacteria | 2951 |
| 149 | Ga0207689_10015701 | 3300025942 | Bacteria | 6411 |
| 150 | Ga0207661_10182581 | 3300025944 | Bacteria | 1834 |
| 151 | Ga0207661_10186458 | 3300025944 | Bacteria | 1816 |
| 152 | Ga0207679_10134132 | 3300025945 | Bacteria | 1991 |
| 153 | Ga0207651_10096432 | 3300025960 | Bacteria | 2181 |
| 154 | Ga0207668_10075934 | 3300025972 | Bacteria | 2418 |
| 155 | Ga0207668_10117705 | 3300025972 | Bacteria | 2006 |
| 156 | Ga0207640_10021267 | 3300025981 | Bacteria | 3865 |
| 157 | Ga0207658_10488652 | 3300025986 | Bacteria | 1095 |
| 158 | Ga0207703_10159339 | 3300026035 | Bacteria | 1975 |
| 159 | Ga0207703_10247165 | 3300026035 | Bacteria | 1606 |
| 160 | Ga0207678_10013185 | 3300026067 | Bacteria | 7253 |
| 161 | Ga0207678_10051102 | 3300026067 | Bacteria | 3569 |
| 162 | Ga0207678_10294845 | 3300026067 | Bacteria | 1393 |
| 163 | Ga0207702_10054526 | 3300026078 | Bacteria | 3388 |
| 164 | Ga0207641_10028278 | 3300026088 | Bacteria | 4632 |
| 165 | Ga0207641_10134176 | 3300026088 | Bacteria | 2226 |
| 166 | Ga0207641_10144614 | 3300026088 | Bacteria | 2149 |
| 167 | Ga0207674_10017027 | 3300026116 | Bacteria | 7936 |
| 168 | Ga0207674_10040250 | 3300026116 | Bacteria | 4843 |
| 169 | Ga0207675_100036033 | 3300026118 | Bacteria | 4614 |
| 170 | Ga0207683_10021818 | 3300026121 | Bacteria | 5491 |
| 171 | Ga0207683_10100484 | 3300026121 | Bacteria | 2582 |
| 172 | Ga0207698_10268884 | 3300026142 | Bacteria | 1570 |
| 173 | Ga0268266_10146590 | 3300028379 | Bacteria | 2123 |
| 174 | Ga0265336_10044594 | 3300028666 | Bacteria | 1349 |
| 175 | Ga0265338_10001991 | 3300028800 | Bacteria | 31759 |
| 176 | Ga0316177_1131317 | 3300030731 | Bacteria | 1218 |
| 177 | Ga0314311_1007878 | 3300030733 | Bacteria | 5247 |
| 178 | Ga0265327_10000004 | 3300031251 | Bacteria | 803973 |
| 179 | Ga0307508_10001845 | 3300031616 | Bacteria | 23415 |
| 180 | Ga0307508_10054928 | 3300031616 | Bacteria | 3529 |
| 181 | Ga0307516_10008417 | 3300031730 | Bacteria | 11691 |
| 182 | Ga0307410_10006480 | 3300031852 | Bacteria | 6321 |
| 183 | Ga0307406_10091021 | 3300031901 | Bacteria | 2054 |
| 184 | Ga0307415_100206913 | 3300032126 | Bacteria | 1562 |
| 185 | Ga0307415_100309777 | 3300032126 | Bacteria | 1312 |
| 186 | Ga0373950_0011247 | 3300034818 | Bacteria | 1460 |
| 187 | Ga0373959_0020525 | 3300034820 | Bacteria | 1261 |
| 188 | Ga0373926_0008082 | 3300035083 | Bacteria | 3502 |
| 189 | Ga0373934_0009272 | 3300035086 | Bacteria | 3684 |
| 190 | Ga0373940_0037717 | 3300035088 | Bacteria | 1317 |
| 191 | Ga0373944_0010754 | 3300035089 | Bacteria | 2499 |
| 192 | Ga0373952_0010051 | 3300035092 | Bacteria | 1823 |
| 193 | Ga0373923_0000697 | 3300035111 | Bacteria | 8578 |
| 194 | Ga0373936_0000748 | 3300035113 | Bacteria | 11387 |
| 195 | Ga0373936_0000816 | 3300035113 | Bacteria | 11054 |
| 196 | Ga0373936_0018788 | 3300035113 | Bacteria | 2672 |
| 197 | Ga0373945_0002765 | 3300035116 | Bacteria | 5510 |
| 198 | Ga0373945_0017763 | 3300035116 | Bacteria | 2412 |
| 199 | Ga0373953_0011299 | 3300035117 | Bacteria | 3130 |
| 200 | Ga0373953_0046531 | 3300035117 | Bacteria | 1742 |
| 201 | Ga0373954_0135553 | 3300035118 | Bacteria | 1200 |
| 202 | Ga0373954_0163933 | 3300035118 | Bacteria | 1088 |
| 203 | Ga0373957_0010071 | 3300035120 | Bacteria | 3112 |
| 204 | Ga0373943_0002447 | 3300035170 | Bacteria | 8433 |
| 205 | Ga0373943_0025259 | 3300035170 | Bacteria | 2776 |
| 206 | Ga0373946_0004987 | 3300035171 | Bacteria | 4778 |
| 207 | Ga0373946_0009936 | 3300035171 | Bacteria | 3518 |
| 208 | Ga0373955_0100224 | 3300035172 | Bacteria | 1661 |
| 209 | Ga0373955_0109286 | 3300035172 | Bacteria | 1597 |
| 210 | Ga0373942_0021968 | 3300035207 | Bacteria | 1615 |
| 211 | Ga0373924_0010655 | 3300035410 | Bacteria | 3399 |
| 212 | Ga0373935_0003934 | 3300035692 | Bacteria | 8676 |
| 213 | Ga0373935_0062189 | 3300035692 | Bacteria | 2391 |
| 214 | Ga0373935_0133331 | 3300035692 | Bacteria | 1671 |
| 215 | Ga0373927_0030750 | 3300035695 | Bacteria | 3502 |
| 216 | Ga0373933_0021017 | 3300035724 | Bacteria | 3703 |
| 217 | Ga0373933_0110607 | 3300035724 | Bacteria | 1713 |
| 218 | Ga0373933_0140723 | 3300035724 | Bacteria | 1523 |
| 219 | Ga0373947_0000507 | 3300035725 | Bacteria | 22617 |
| 220 | Ga0373947_0003862 | 3300035725 | Bacteria | 8821 |
| 221 | Ga0373937_0053362 | 3300036401 | Bacteria | 3708 |
| 222 | Ga0373937_0103162 | 3300036401 | Bacteria | 2648 |
| 223 | Ga0372808_014898 | 3300036459 | Bacteria | 1111 |
| 224 | Ga0373925_0000453 | 3300037068 | Bacteria | 41369 |
| 225 | Ga0373925_0017793 | 3300037068 | Bacteria | 5156 |
| 226 | Ga0373925_0055387 | 3300037068 | Bacteria | 2968 |
| 227 | Ga0373925_0444216 | 3300037068 | Bacteria | 1061 |
| 228 | Ga0395900_0072011 | 3300037418 | Bacteria | 3554 |
| 229 | Ga0395900_0320966 | 3300037418 | Bacteria | 1529 |
| 230 | Ga0395898_0002002 | 3300037466 | Bacteria | 25558 |
| 231 | Ga0395898_0427675 | 3300037466 | Bacteria | 1262 |
| 232 | Ga0436364_0006913 | 3300037853 | Bacteria | 1583 |
| 233 | Ga0436364_0348696 | 3300037853 | Bacteria | 2179 |
| 234 | Ga0436364_0451911 | 3300037853 | Bacteria | 3788 |
| 235 | Ga0436364_0575180 | 3300037853 | Bacteria | 2315 |
| 236 | Ga0395901_0014340 | 3300038443 | Bacteria | 8069 |
| 237 | Ga0395901_0032192 | 3300038443 | Bacteria | 5412 |
| 238 | Ga0395901_0151935 | 3300038443 | Bacteria | 2433 |
| 239 | Ga0436365_0014889 | 3300039437 | Bacteria | 1964 |
| 240 | Ga0436365_0404078 | 3300039437 | Bacteria | 1226 |
| 241 | Ga0439461_0012722 | 3300041410 | Bacteria | 1579 |
| 242 | Ga0439445_0005518 | 3300042004 | Bacteria | 2883 |
| 243 | Ga0439434_0005861 | 3300042435 | Bacteria | 3591 |
| 244 | Ga0466972_0042397 | 3300044658 | Bacteria | 2213 |
| 245 | Ga0466972_0093358 | 3300044658 | Bacteria | 1427 |
| 246 | Ga0466965_0011767 | 3300044683 | Bacteria | 4107 |
| 247 | Ga0466966_0023354 | 3300044684 | Bacteria | 4049 |
| 248 | Ga0466966_0023567 | 3300044684 | Bacteria | 4028 |
| 249 | Ga0466966_0209294 | 3300044684 | Bacteria | 1179 |
| 250 | Ga0466961_0037683 | 3300044693 | Bacteria | 3102 |
| 251 | Ga0466961_0219579 | 3300044693 | Bacteria | 1172 |
| 252 | Ga0466963_0024401 | 3300044694 | Bacteria | 3850 |
| 253 | Ga0466963_0162532 | 3300044694 | Bacteria | 1554 |
| 254 | Ga0466963_0218105 | 3300044694 | Bacteria | 1336 |
| 255 | Ga0466970_0055511 | 3300044765 | Bacteria | 2115 |
| 256 | Ga0466970_0143645 | 3300044765 | Bacteria | 1315 |
| 257 | Ga0466957_0036129 | 3300044842 | Bacteria | 2968 |
| 258 | Ga0466960_0001137 | 3300044901 | Bacteria | 9554 |
| 259 | Ga0466960_0008185 | 3300044901 | Bacteria | 4274 |
| 260 | Ga0466960_0020463 | 3300044901 | Bacteria | 2931 |
| 261 | Ga0466960_0115525 | 3300044901 | Bacteria | 1400 |
| 262 | Ga0466959_0213466 | 3300045049 | Bacteria | 1340 |
| 263 | Ga0466958_0261938 | 3300045836 | Bacteria | 1107 |
| 264 | Ga0466967_0128165 | 3300045976 | Bacteria | 2353 |
| 265 | Ga0466967_0169149 | 3300045976 | Bacteria | 2055 |
| 266 | Ga0466967_0531436 | 3300045976 | Bacteria | 1156 |
| 267 | Ga0495592_0104110 | 3300046454 | Bacteria | 2018 |
| 268 | Ga0495603_0017751 | 3300046455 | Bacteria | 4307 |
| 269 | Ga0495629_0000358 | 3300046459 | Bacteria | 38859 |
| 270 | Ga0495638_0001104 | 3300046460 | Bacteria | 26279 |
| 271 | Ga0495641_0002264 | 3300046461 | Bacteria | 15342 |
| 272 | Ga0495651_0018544 | 3300046462 | Bacteria | 5390 |
| 273 | Ga0495653_0007618 | 3300046463 | Bacteria | 8852 |
| 274 | Ga0495653_0018884 | 3300046463 | Bacteria | 5592 |
| 275 | Ga0495653_0037080 | 3300046463 | Bacteria | 3834 |
| 276 | Ga0495653_0132285 | 3300046463 | Bacteria | 1764 |
| 277 | Ga0495580_0049308 | 3300046472 | Bacteria | 2979 |
| 278 | Ga0495582_0070044 | 3300046473 | Bacteria | 1939 |
| 279 | Ga0495639_0001633 | 3300046475 | Bacteria | 10000 |
| 280 | Ga0495662_0000209 | 3300046476 | Bacteria | 24432 |
| 281 | Ga0495664_0001225 | 3300046477 | Bacteria | 13427 |
| 282 | Ga0495664_0142276 | 3300046477 | Bacteria | 1454 |
| 283 | Ga0495594_0032306 | 3300046499 | Bacteria | 2840 |
| 284 | Ga0495608_0031401 | 3300046511 | Bacteria | 3592 |
| 285 | Ga0495608_0033562 | 3300046511 | Bacteria | 3467 |
| 286 | Ga0495608_0064919 | 3300046511 | Bacteria | 2391 |
| 287 | Ga0495618_0010710 | 3300046514 | Bacteria | 5552 |
| 288 | Ga0495618_0062273 | 3300046514 | Bacteria | 2367 |
| 289 | Ga0495628_0033870 | 3300046516 | Bacteria | 4113 |
| 290 | Ga0495628_0082831 | 3300046516 | Bacteria | 2491 |
| 291 | Ga0495630_0003912 | 3300046517 | Bacteria | 10413 |
| 292 | Ga0495630_0013873 | 3300046517 | Bacteria | 5860 |
| 293 | Ga0495666_0048495 | 3300046526 | Bacteria | 2045 |
| 294 | Ga0495652_0014611 | 3300046529 | Bacteria | 7039 |
| 295 | Ga0495652_0046918 | 3300046529 | Bacteria | 3707 |
| 296 | Ga0495665_0026958 | 3300046531 | Bacteria | 3085 |
| 297 | Ga0495665_0034128 | 3300046531 | Bacteria | 2721 |
| 298 | Ga0495640_0034225 | 3300046533 | Bacteria | 3604 |
| 299 | Ga0495640_0059335 | 3300046533 | Bacteria | 2606 |
| 300 | Ga0495640_0065546 | 3300046533 | Bacteria | 2452 |
| 301 | Ga0495586_0002677 | 3300046535 | Bacteria | 9633 |
| 302 | Ga0495587_0017811 | 3300046536 | Bacteria | 4406 |
| 303 | Ga0495645_0003229 | 3300046543 | Bacteria | 11060 |
| 304 | Ga0495645_0059152 | 3300046543 | Bacteria | 2779 |
| 305 | Ga0495645_0077529 | 3300046543 | Bacteria | 2389 |
| 306 | Ga0495667_0001300 | 3300046559 | Bacteria | 16364 |
| 307 | Ga0495667_0001964 | 3300046559 | Bacteria | 13617 |
| 308 | Ga0495667_0026328 | 3300046559 | Bacteria | 3919 |
| 309 | Ga0495667_0206078 | 3300046559 | Bacteria | 1257 |
| 310 | Ga0495634_0028277 | 3300046642 | Bacteria | 3893 |
| 311 | Ga0495634_0098931 | 3300046642 | Bacteria | 1886 |
| 312 | Ga0495635_0003905 | 3300046663 | Bacteria | 10363 |
| 313 | Ga0495635_0007672 | 3300046663 | Bacteria | 7529 |
| 314 | Ga0495635_0014137 | 3300046663 | Bacteria | 5586 |
| 315 | Ga0495635_0027078 | 3300046663 | Bacteria | 3988 |
| 316 | Ga0495635_0234845 | 3300046663 | Bacteria | 1238 |
| 317 | Ga0495588_0018605 | 3300046674 | Bacteria | 3390 |
| 318 | Ga0495657_0002104 | 3300046675 | Bacteria | 16917 |
| 319 | Ga0495657_0041337 | 3300046675 | Bacteria | 3155 |
| 320 | Ga0495657_0085338 | 3300046675 | Bacteria | 2035 |
| 321 | Ga0495657_0141612 | 3300046675 | Bacteria | 1498 |
| 322 | Ga0495599_0007116 | 3300046678 | Bacteria | 6773 |
| 323 | Ga0495599_0110116 | 3300046678 | Bacteria | 1716 |
| 324 | Ga0495623_0024425 | 3300046679 | Bacteria | 3895 |
| 325 | Ga0495623_0073948 | 3300046679 | Bacteria | 2118 |
| 326 | Ga0495623_0184046 | 3300046679 | Bacteria | 1211 |
| 327 | Ga0495646_0029902 | 3300046680 | Bacteria | 3402 |
| 328 | Ga0495646_0067004 | 3300046680 | Bacteria | 2123 |
| 329 | Ga0495647_0005076 | 3300046681 | Bacteria | 4309 |
| 330 | Ga0495658_0012721 | 3300046683 | Bacteria | 4270 |
| 331 | Ga0495613_0023186 | 3300046689 | Bacteria | 4624 |
| 332 | Ga0495624_0044685 | 3300046690 | Bacteria | 2823 |
| 333 | Ga0495600_0002220 | 3300046809 | Bacteria | 11045 |
| 334 | Ga0495600_0015721 | 3300046809 | Bacteria | 4791 |
| 335 | Ga0495600_0053437 | 3300046809 | Bacteria | 2638 |
| 336 | Ga0495581_0019966 | 3300047315 | Bacteria | 3891 |
| 337 | Ga0495581_0021783 | 3300047315 | Bacteria | 3713 |
| 338 | Ga0495604_0009251 | 3300047317 | Bacteria | 7799 |
| 339 | Ga0495604_0043737 | 3300047317 | Bacteria | 3505 |
| 340 | Ga0495674_0024215 | 3300047319 | Bacteria | 5582 |
| 341 | Ga0495674_0050971 | 3300047319 | Bacteria | 3650 |
| 342 | Ga0495674_0052179 | 3300047319 | Bacteria | 3600 |
| 343 | Ga0495674_0327662 | 3300047319 | Bacteria | 1246 |
| 344 | Ga0495676_0009204 | 3300047321 | Bacteria | 8998 |
| 345 | Ga0495676_0077872 | 3300047321 | Bacteria | 2526 |
| 346 | Ga0495680_0006448 | 3300047322 | Bacteria | 10901 |
| 347 | Ga0495680_0010722 | 3300047322 | Bacteria | 8168 |
| 348 | Ga0495680_0017797 | 3300047322 | Bacteria | 6050 |
| 349 | Ga0495680_0059823 | 3300047322 | Bacteria | 2939 |
| 350 | Ga0495675_0016606 | 3300047444 | Bacteria | 4657 |
| 351 | Ga0495675_0060674 | 3300047444 | Bacteria | 2397 |
| 352 | Ga0495684_0001486 | 3300047471 | Bacteria | 18770 |
| 353 | Ga0495684_0046141 | 3300047471 | Bacteria | 3333 |
| 354 | Ga0495684_0072404 | 3300047471 | Bacteria | 2618 |
| 355 | Ga0495593_0001877 | 3300047673 | Bacteria | 12515 |
| 356 | Ga0495602_0011413 | 3300048088 | Bacteria | 9187 |
| 357 | Ga0496100_0001094 | 3300048903 | Bacteria | 13092 |
| 358 | Ga0496100_0035610 | 3300048903 | Bacteria | 3132 |
| 359 | Ga0496101_0006806 | 3300048904 | Bacteria | 7374 |
| 360 | Ga0496101_0246063 | 3300048904 | Bacteria | 1392 |
| 361 | Ga0496102_0028681 | 3300048905 | Bacteria | 4973 |
| 362 | Ga0496102_0174618 | 3300048905 | Bacteria | 2023 |
| 363 | Ga0496102_0249442 | 3300048905 | Bacteria | 1673 |
| 364 | Ga0496103_0157421 | 3300048906 | Bacteria | 1456 |
| 365 | Ga0496103_0206744 | 3300048906 | Bacteria | 1262 |
| 366 | Ga0496104_0004672 | 3300048907 | Bacteria | 11918 |
| 367 | Ga0496104_0026345 | 3300048907 | Bacteria | 5367 |
| 368 | Ga0496104_0296419 | 3300048907 | Bacteria | 1530 |
| 369 | Ga0496104_0345787 | 3300048907 | Bacteria | 1400 |
| 370 | Ga0496105_0109234 | 3300048908 | Bacteria | 2283 |
| 371 | Ga0496106_0003170 | 3300048909 | Bacteria | 12290 |
| 372 | Ga0496106_0060400 | 3300048909 | Bacteria | 2873 |
| 373 | Ga0496107_0010357 | 3300048910 | Bacteria | 6478 |
| 374 | Ga0496107_0031440 | 3300048910 | Bacteria | 3788 |
| 375 | Ga0496107_0358492 | 3300048910 | Bacteria | 1085 |
| 376 | Ga0496108_0032568 | 3300048911 | Bacteria | 4330 |
| 377 | Ga0496108_0058859 | 3300048911 | Bacteria | 3230 |
| 378 | Ga0496108_0073172 | 3300048911 | Bacteria | 2894 |
| 379 | Ga0496109_0011306 | 3300048912 | Bacteria | 7667 |
| 380 | Ga0496109_0073613 | 3300048912 | Bacteria | 3139 |
| 381 | Ga0496109_0148796 | 3300048912 | Bacteria | 2192 |
| 382 | Ga0496109_0180530 | 3300048912 | Bacteria | 1982 |
| 383 | Ga0496109_0229933 | 3300048912 | Bacteria | 1744 |
| 384 | Ga0496109_0335499 | 3300048912 | Bacteria | 1427 |
| 385 | Ga0496110_0016532 | 3300048913 | Bacteria | 6160 |
| 386 | Ga0496110_0106004 | 3300048913 | Bacteria | 2522 |
| 387 | Ga0496110_0523799 | 3300048913 | Bacteria | 1078 |
| 388 | Ga0496111_0010048 | 3300048914 | Bacteria | 6332 |
| 389 | Ga0496112_0053601 | 3300048915 | Bacteria | 3962 |
| 390 | Ga0496112_0177641 | 3300048915 | Bacteria | 2093 |
| 391 | Ga0496112_0309505 | 3300048915 | Bacteria | 1525 |
| 392 | Ga0496112_0462627 | 3300048915 | Bacteria | 1206 |
| 393 | Ga0496112_0485735 | 3300048915 | Bacteria | 1171 |
| 394 | Ga0496113_0155105 | 3300048916 | Bacteria | 1808 |
| 395 | Ga0496113_0184035 | 3300048916 | Bacteria | 1656 |
| 396 | Ga0496113_0203125 | 3300048916 | Bacteria | 1575 |
| 397 | Ga0496114_0002590 | 3300048917 | Bacteria | 13806 |
| 398 | Ga0496114_0148940 | 3300048917 | Bacteria | 2030 |
| 399 | Ga0496114_0156690 | 3300048917 | Bacteria | 1978 |
| 400 | Ga0496115_0018527 | 3300048918 | Bacteria | 5348 |
| 401 | Ga0496119_0001628 | 3300048922 | Bacteria | 26512 |
| 402 | Ga0496120_0045628 | 3300048923 | Bacteria | 2538 |
| 403 | Ga0496126_0143095 | 3300048929 | Bacteria | 2056 |
| 404 | Ga0501032_0023133 | 3300049569 | Bacteria | 4301 |
| 405 | Ga0501034_0045371 | 3300049571 | Bacteria | 4441 |
| 406 | Ga0501036_0003785 | 3300049572 | Bacteria | 12126 |
| 407 | Ga0501036_0082873 | 3300049572 | Bacteria | 2710 |
| 408 | Ga0501037_0008667 | 3300049573 | Bacteria | 7458 |
| 409 | Ga0501037_0048635 | 3300049573 | Bacteria | 3106 |
| 410 | Ga0501038_0057109 | 3300049574 | Bacteria | 3351 |
| 411 | Ga0501038_0067644 | 3300049574 | Bacteria | 3038 |
| 412 | Ga0501039_0005716 | 3300049575 | Bacteria | 9421 |
| 413 | Ga0501039_0077141 | 3300049575 | Bacteria | 2591 |
| 414 | Ga0501040_0210761 | 3300049576 | Bacteria | 1381 |
| 415 | Ga0501042_0010961 | 3300049578 | Bacteria | 6103 |
| 416 | Ga0501046_0006195 | 3300049580 | Bacteria | 10621 |
| 417 | Ga0501047_0031043 | 3300049581 | Bacteria | 5152 |
| 418 | Ga0501047_0039713 | 3300049581 | Bacteria | 4551 |
| 419 | Ga0501047_0202839 | 3300049581 | Bacteria | 1843 |
| 420 | Ga0501048_0005889 | 3300049582 | Bacteria | 9330 |
| 421 | Ga0501048_0039994 | 3300049582 | Bacteria | 3361 |
| 422 | Ga0501067_0052892 | 3300049583 | Bacteria | 2250 |
| 423 | Ga0501070_0000837 | 3300049586 | Bacteria | 27932 |
| 424 | Ga0501070_0085155 | 3300049586 | Bacteria | 2617 |
| 425 | Ga0501073_0044251 | 3300049589 | Bacteria | 3138 |
| 426 | Ga0501074_0022809 | 3300049590 | Bacteria | 4551 |
| 427 | Ga0501044_0005944 | 3300049823 | Bacteria | 13510 |
| 428 | Ga0501044_0049712 | 3300049823 | Bacteria | 4328 |
| 429 | Ga0501044_0084073 | 3300049823 | Bacteria | 3216 |
| 430 | nmdc:mga0a205_327734_c1 | 3300050515 | Bacteria | 1401 |
| 431 | Ga0495601_0005157 | 3300053077 | Bacteria | 7593 |
| 432 | Ga0495595_0054401 | 3300053084 | Bacteria | 1861 |
| 433 | Ga0495619_0003475 | 3300053085 | Bacteria | 10169 |
| 434 | Ga0500556_0000744 | 3300053104 | Bacteria | 19502 |
| 435 | Ga0500593_000340 | 3300053117 | Bacteria | 18767 |
| 436 | Ga0501082_0192906 | 3300060353 | Bacteria | 1772 |
| 437 | Ga0466962_0031924 | 3300061719 | Bacteria | 2522 |
| 438 | Ga0466962_0034712 | 3300061719 | Bacteria | 2414 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044693 | Ga0466961_0219579 | Ga0466961_0219579_132_1073 | 273 |
| 2 | 3300005842 | Ga0068858_100032076 | Ga0068858_1000320764 | 293 |
| 3 | 3300005843 | Ga0068860_100072149 | Ga0068860_1000721492 | 293 |
| 4 | 3300025972 | Ga0207668_10117705 | Ga0207668_101177052 | 293 |
| 5 | 3300026035 | Ga0207703_10247165 | Ga0207703_102471652 | 293 |
| 6 | 3300026088 | Ga0207641_10144614 | Ga0207641_101446142 | 293 |
| 7 | 3300045836 | Ga0466958_0261938 | Ga0466958_0261938_134_1063 | 294 |
| 8 | 3300044765 | Ga0466970_0143645 | Ga0466970_0143645_70_1071 | 296 |
| 9 | 3300021388 | Ga0213875_10047829 | Ga0213875_100478292 | 297 |
| 10 | 3300037853 | Ga0436364_0451911 | Ga0436364_0451911_365_1336 | 297 |
| 11 | 3300039437 | Ga0436365_0404078 | Ga0436365_0404078_19_999 | 298 |
| 12 | 3300053104 | Ga0500556_0000744 | Ga0500556_0000744_5230_6213 | 298 |
| 13 | 3300005530 | Ga0070679_100298255 | Ga0070679_1002982551 | 305 |
| 14 | 3300031251 | Ga0265327_10000004 | Ga0265327_10000004404 | 307 |
| 15 | iso_pu_bacteria | 2811994874 | 2812332456 | 308 |
| 16 | iso_pu_bacteria | 2928121344 | 2928122408 | 308 |
| 17 | 3300005435 | Ga0070714_100000010 | Ga0070714_100000010160 | 309 |
| 18 | 3300020082 | Ga0206353_10976584 | Ga0206353_109765841 | 309 |
| 19 | 3300025929 | Ga0207664_10000009 | Ga0207664_10000009117 | 309 |
| 20 | 3300031616 | Ga0307508_10001845 | Ga0307508_1000184515 | 309 |
| 21 | 3300048912 | Ga0496109_0073613 | Ga0496109_0073613_244_1182 | 309 |
| 22 | iso_pu_bacteria | 2671180195 | 2671836036 | 309 |
| 23 | iso_pu_bacteria | 2773857922 | 2774854192 | 309 |
| 24 | iso_pu_bacteria | 2866552031 | 2866554297 | 309 |
| 25 | iso_pu_bacteria | 8056060235 | 8056061964 | 309 |
| 26 | iso_pu_bacteria | 8056207758 | 8056212046 | 309 |
| 27 | 3300048915 | Ga0496112_0053601 | Ga0496112_0053601_1231_2175 | 310 |
| 28 | 3300048916 | Ga0496113_0184035 | Ga0496113_0184035_237_1181 | 310 |
| 29 | iso_pu_bacteria | 2939660829 | 2939663562 | 310 |
| 30 | iso_pu_bacteria | 2956939328 | 2956940772 | 310 |
| 31 | iso_pu_bacteria | 3001119090 | 3001120458 | 310 |
| 32 | 3300005471 | Ga0070698_100063427 | Ga0070698_1000634272 | 311 |
| 33 | 3300005535 | Ga0070684_100253539 | Ga0070684_1002535392 | 311 |
| 34 | 3300005618 | Ga0068864_100574304 | Ga0068864_1005743042 | 311 |
| 35 | 3300005937 | Ga0081455_10023422 | Ga0081455_100234222 | 311 |
| 36 | 3300005983 | Ga0081540_1000811 | Ga0081540_100081120 | 311 |
| 37 | 3300006237 | Ga0097621_100289311 | Ga0097621_1002893112 | 311 |
| 38 | 3300010159 | Ga0099796_10091265 | Ga0099796_100912651 | 311 |
| 39 | 3300013308 | Ga0157375_10189369 | Ga0157375_101893691 | 311 |
| 40 | 3300031616 | Ga0307508_10054928 | Ga0307508_100549283 | 311 |
| 41 | 3300032126 | Ga0307415_100206913 | Ga0307415_1002069132 | 311 |
| 42 | 3300035083 | Ga0373926_0008082 | Ga0373926_0008082_1752_2720 | 311 |
| 43 | 3300035089 | Ga0373944_0010754 | Ga0373944_0010754_662_1630 | 311 |
| 44 | 3300035111 | Ga0373923_0000697 | Ga0373923_0000697_2681_3649 | 311 |
| 45 | 3300035113 | Ga0373936_0000748 | Ga0373936_0000748_9478_10446 | 311 |
| 46 | 3300035116 | Ga0373945_0017763 | Ga0373945_0017763_504_1472 | 311 |
| 47 | 3300035117 | Ga0373953_0011299 | Ga0373953_0011299_1717_2685 | 311 |
| 48 | 3300035120 | Ga0373957_0010071 | Ga0373957_0010071_608_1576 | 311 |
| 49 | 3300035170 | Ga0373943_0002447 | Ga0373943_0002447_5374_6342 | 311 |
| 50 | 3300035171 | Ga0373946_0004987 | Ga0373946_0004987_1886_2854 | 311 |
| 51 | 3300035172 | Ga0373955_0100224 | Ga0373955_0100224_210_1178 | 311 |
| 52 | 3300035410 | Ga0373924_0010655 | Ga0373924_0010655_1517_2485 | 311 |
| 53 | 3300035725 | Ga0373947_0003862 | Ga0373947_0003862_827_1795 | 311 |
| 54 | 3300036401 | Ga0373937_0103162 | Ga0373937_0103162_1322_2290 | 311 |
| 55 | 3300037068 | Ga0373925_0055387 | Ga0373925_0055387_679_1647 | 311 |
| 56 | 3300044658 | Ga0466972_0042397 | Ga0466972_0042397_862_1827 | 311 |
| 57 | 3300044901 | Ga0466960_0115525 | Ga0466960_0115525_139_1098 | 311 |
| 58 | 3300046455 | Ga0495603_0017751 | Ga0495603_0017751_2894_3862 | 311 |
| 59 | 3300046459 | Ga0495629_0000358 | Ga0495629_0000358_26304_27272 | 311 |
| 60 | 3300046461 | Ga0495641_0002264 | Ga0495641_0002264_6700_7668 | 311 |
| 61 | 3300046463 | Ga0495653_0018884 | Ga0495653_0018884_942_1910 | 311 |
| 62 | 3300046472 | Ga0495580_0049308 | Ga0495580_0049308_1072_2040 | 311 |
| 63 | 3300046473 | Ga0495582_0070044 | Ga0495582_0070044_557_1525 | 311 |
| 64 | 3300046475 | Ga0495639_0001633 | Ga0495639_0001633_7341_8309 | 311 |
| 65 | 3300046476 | Ga0495662_0000209 | Ga0495662_0000209_21373_22341 | 311 |
| 66 | 3300046499 | Ga0495594_0032306 | Ga0495594_0032306_323_1291 | 311 |
| 67 | 3300046511 | Ga0495608_0064919 | Ga0495608_0064919_679_1647 | 311 |
| 68 | 3300046514 | Ga0495618_0010710 | Ga0495618_0010710_679_1647 | 311 |
| 69 | 3300046516 | Ga0495628_0082831 | Ga0495628_0082831_1078_2046 | 311 |
| 70 | 3300046517 | Ga0495630_0003912 | Ga0495630_0003912_1966_2934 | 311 |
| 71 | 3300046526 | Ga0495666_0048495 | Ga0495666_0048495_929_1897 | 311 |
| 72 | 3300046531 | Ga0495665_0034128 | Ga0495665_0034128_762_1730 | 311 |
| 73 | 3300046533 | Ga0495640_0034225 | Ga0495640_0034225_992_1960 | 311 |
| 74 | 3300046535 | Ga0495586_0002677 | Ga0495586_0002677_6899_7867 | 311 |
| 75 | 3300046543 | Ga0495645_0003229 | Ga0495645_0003229_1645_2613 | 311 |
| 76 | 3300046642 | Ga0495634_0098931 | Ga0495634_0098931_446_1414 | 311 |
| 77 | 3300046663 | Ga0495635_0027078 | Ga0495635_0027078_2080_3048 | 311 |
| 78 | 3300046663 | Ga0495635_0234845 | Ga0495635_0234845_146_1090 | 311 |
| 79 | 3300046674 | Ga0495588_0018605 | Ga0495588_0018605_1630_2598 | 311 |
| 80 | 3300046675 | Ga0495657_0041337 | Ga0495657_0041337_1207_2175 | 311 |
| 81 | 3300046678 | Ga0495599_0110116 | Ga0495599_0110116_655_1599 | 311 |
| 82 | 3300046679 | Ga0495623_0184046 | Ga0495623_0184046_23_991 | 311 |
| 83 | 3300046680 | Ga0495646_0029902 | Ga0495646_0029902_574_1542 | 311 |
| 84 | 3300046681 | Ga0495647_0005076 | Ga0495647_0005076_2485_3453 | 311 |
| 85 | 3300046683 | Ga0495658_0012721 | Ga0495658_0012721_2682_3650 | 311 |
| 86 | 3300046689 | Ga0495613_0023186 | Ga0495613_0023186_1577_2545 | 311 |
| 87 | 3300046809 | Ga0495600_0053437 | Ga0495600_0053437_715_1683 | 311 |
| 88 | 3300047315 | Ga0495581_0021783 | Ga0495581_0021783_1754_2722 | 311 |
| 89 | 3300047319 | Ga0495674_0050971 | Ga0495674_0050971_1361_2329 | 311 |
| 90 | 3300047319 | Ga0495674_0327662 | Ga0495674_0327662_42_986 | 311 |
| 91 | 3300047321 | Ga0495676_0009204 | Ga0495676_0009204_792_1760 | 311 |
| 92 | 3300047322 | Ga0495680_0010722 | Ga0495680_0010722_1861_2829 | 311 |
| 93 | 3300047444 | Ga0495675_0060674 | Ga0495675_0060674_13_981 | 311 |
| 94 | 3300047471 | Ga0495684_0072404 | Ga0495684_0072404_884_1852 | 311 |
| 95 | 3300047673 | Ga0495593_0001877 | Ga0495593_0001877_1898_2866 | 311 |
| 96 | 3300048910 | Ga0496107_0358492 | Ga0496107_0358492_64_1008 | 311 |
| 97 | 3300048913 | Ga0496110_0523799 | Ga0496110_0523799_37_1005 | 311 |
| 98 | 3300048917 | Ga0496114_0156690 | Ga0496114_0156690_18_986 | 311 |
| 99 | 3300049573 | Ga0501037_0048635 | Ga0501037_0048635_1448_2413 | 311 |
| 100 | 3300049581 | Ga0501047_0031043 | Ga0501047_0031043_4060_5025 | 311 |
| 101 | 3300049823 | Ga0501044_0005944 | Ga0501044_0005944_6090_7055 | 311 |
| 102 | 3300053077 | Ga0495601_0005157 | Ga0495601_0005157_5947_6915 | 311 |
| 103 | 3300053085 | Ga0495619_0003475 | Ga0495619_0003475_1984_2952 | 311 |
| 104 | 3300053117 | Ga0500593_000340 | Ga0500593_000340_1229_2167 | 311 |
| 105 | iso_pu_bacteria | 2643221715 | 2644638516 | 311 |
| 106 | iso_pu_bacteria | 2773857762 | 2774391951 | 311 |
| 107 | iso_pu_bacteria | 2891968417 | 2891970175 | 311 |
| 108 | iso_pu_bacteria | 2902810491 | 2902812507 | 311 |
| 109 | iso_pu_bacteria | 2906799679 | 2906800710 | 311 |
| 110 | 3300005329 | Ga0070683_100491042 | Ga0070683_1004910421 | 312 |
| 111 | 3300006175 | Ga0070712_100090517 | Ga0070712_1000905171 | 312 |
| 112 | 3300009093 | Ga0105240_10127825 | Ga0105240_101278254 | 312 |
| 113 | 3300021388 | Ga0213875_10077576 | Ga0213875_100775762 | 312 |
| 114 | 3300021388 | Ga0213875_10123654 | Ga0213875_101236542 | 312 |
| 115 | 3300025898 | Ga0207692_10001913 | Ga0207692_100019135 | 312 |
| 116 | 3300025916 | Ga0207663_10073110 | Ga0207663_100731102 | 312 |
| 117 | 3300025928 | Ga0207700_10274557 | Ga0207700_102745571 | 312 |
| 118 | 3300025929 | Ga0207664_10079131 | Ga0207664_100791312 | 312 |
| 119 | 3300025929 | Ga0207664_10571693 | Ga0207664_105716931 | 312 |
| 120 | 3300026067 | Ga0207678_10051102 | Ga0207678_100511024 | 312 |
| 121 | 3300026142 | Ga0207698_10268884 | Ga0207698_102688842 | 312 |
| 122 | 3300030731 | Ga0316177_1131317 | Ga0316177_11313172 | 312 |
| 123 | 3300030733 | Ga0314311_1007878 | Ga0314311_10078786 | 312 |
| 124 | 3300035692 | Ga0373935_0133331 | Ga0373935_0133331_128_1099 | 312 |
| 125 | 3300036459 | Ga0372808_014898 | Ga0372808_014898_88_1065 | 312 |
| 126 | 3300037068 | Ga0373925_0000453 | Ga0373925_0000453_7937_8932 | 312 |
| 127 | 3300037418 | Ga0395900_0072011 | Ga0395900_0072011_1077_2015 | 312 |
| 128 | 3300037418 | Ga0395900_0320966 | Ga0395900_0320966_271_1209 | 312 |
| 129 | 3300037466 | Ga0395898_0427675 | Ga0395898_0427675_43_981 | 312 |
| 130 | 3300037853 | Ga0436364_0575180 | Ga0436364_0575180_240_1196 | 312 |
| 131 | 3300038443 | Ga0395901_0151935 | Ga0395901_0151935_1288_2226 | 312 |
| 132 | 3300039437 | Ga0436365_0014889 | Ga0436365_0014889_911_1885 | 312 |
| 133 | 3300044683 | Ga0466965_0011767 | Ga0466965_0011767_134_1072 | 312 |
| 134 | 3300045976 | Ga0466967_0169149 | Ga0466967_0169149_833_1807 | 312 |
| 135 | 3300048929 | Ga0496126_0143095 | Ga0496126_0143095_824_1795 | 312 |
| 136 | 3300005327 | Ga0070658_10020908 | Ga0070658_100209084 | 313 |
| 137 | 3300005329 | Ga0070683_100010881 | Ga0070683_1000108813 | 313 |
| 138 | 3300005329 | Ga0070683_100069410 | Ga0070683_1000694102 | 313 |
| 139 | 3300005329 | Ga0070683_100207140 | Ga0070683_1002071402 | 313 |
| 140 | 3300005334 | Ga0068869_100089687 | Ga0068869_1000896872 | 313 |
| 141 | 3300005336 | Ga0070680_100036961 | Ga0070680_1000369612 | 313 |
| 142 | 3300005340 | Ga0070689_100032316 | Ga0070689_1000323162 | 313 |
| 143 | 3300005354 | Ga0070675_100043831 | Ga0070675_1000438312 | 313 |
| 144 | 3300005356 | Ga0070674_100089125 | Ga0070674_1000891252 | 313 |
| 145 | 3300005366 | Ga0070659_100123151 | Ga0070659_1001231513 | 313 |
| 146 | 3300005367 | Ga0070667_100081497 | Ga0070667_1000814972 | 313 |
| 147 | 3300005435 | Ga0070714_100053606 | Ga0070714_1000536065 | 313 |
| 148 | 3300005435 | Ga0070714_100080207 | Ga0070714_1000802072 | 313 |
| 149 | 3300005435 | Ga0070714_100139625 | Ga0070714_1001396252 | 313 |
| 150 | 3300005436 | Ga0070713_100324019 | Ga0070713_1003240192 | 313 |
| 151 | 3300005445 | Ga0070708_100023466 | Ga0070708_1000234663 | 313 |
| 152 | 3300005445 | Ga0070708_100056934 | Ga0070708_1000569345 | 313 |
| 153 | 3300005455 | Ga0070663_100068563 | Ga0070663_1000685632 | 313 |
| 154 | 3300005458 | Ga0070681_10007783 | Ga0070681_100077839 | 313 |
| 155 | 3300005467 | Ga0070706_100001281 | Ga0070706_10000128122 | 313 |
| 156 | 3300005467 | Ga0070706_100019041 | Ga0070706_1000190416 | 313 |
| 157 | 3300005467 | Ga0070706_100034807 | Ga0070706_1000348073 | 313 |
| 158 | 3300005468 | Ga0070707_100004915 | Ga0070707_1000049155 | 313 |
| 159 | 3300005468 | Ga0070707_100005475 | Ga0070707_1000054758 | 313 |
| 160 | 3300005468 | Ga0070707_100058457 | Ga0070707_1000584572 | 313 |
| 161 | 3300005518 | Ga0070699_100020301 | Ga0070699_1000203014 | 313 |
| 162 | 3300005518 | Ga0070699_100208806 | Ga0070699_1002088062 | 313 |
| 163 | 3300005530 | Ga0070679_100169588 | Ga0070679_1001695882 | 313 |
| 164 | 3300005530 | Ga0070679_100306392 | Ga0070679_1003063922 | 313 |
| 165 | 3300005535 | Ga0070684_100065400 | Ga0070684_1000654002 | 313 |
| 166 | 3300005536 | Ga0070697_100001798 | Ga0070697_10000179812 | 313 |
| 167 | 3300005545 | Ga0070695_100025934 | Ga0070695_1000259343 | 313 |
| 168 | 3300005547 | Ga0070693_100068459 | Ga0070693_1000684592 | 313 |
| 169 | 3300005577 | Ga0068857_100068079 | Ga0068857_1000680794 | 313 |
| 170 | 3300005577 | Ga0068857_100078004 | Ga0068857_1000780043 | 313 |
| 171 | 3300005578 | Ga0068854_100030480 | Ga0068854_1000304802 | 313 |
| 172 | 3300005614 | Ga0068856_100099094 | Ga0068856_1000990943 | 313 |
| 173 | 3300005614 | Ga0068856_100284874 | Ga0068856_1002848743 | 313 |
| 174 | 3300005615 | Ga0070702_100025004 | Ga0070702_1000250042 | 313 |
| 175 | 3300005616 | Ga0068852_100116462 | Ga0068852_1001164622 | 313 |
| 176 | 3300005841 | Ga0068863_100055108 | Ga0068863_1000551084 | 313 |
| 177 | 3300005841 | Ga0068863_100310069 | Ga0068863_1003100692 | 313 |
| 178 | 3300005843 | Ga0068860_100051910 | Ga0068860_1000519103 | 313 |
| 179 | 3300006028 | Ga0070717_10026624 | Ga0070717_100266244 | 313 |
| 180 | 3300006028 | Ga0070717_10389090 | Ga0070717_103890901 | 313 |
| 181 | 3300006173 | Ga0070716_100109737 | Ga0070716_1001097372 | 313 |
| 182 | 3300006175 | Ga0070712_100091390 | Ga0070712_1000913902 | 313 |
| 183 | 3300006175 | Ga0070712_100210288 | Ga0070712_1002102882 | 313 |
| 184 | 3300006852 | Ga0075433_10085780 | Ga0075433_100857802 | 313 |
| 185 | 3300006914 | Ga0075436_100142000 | Ga0075436_1001420002 | 313 |
| 186 | 3300006914 | Ga0075436_100237938 | Ga0075436_1002379381 | 313 |
| 187 | 3300007076 | Ga0075435_100087265 | Ga0075435_1000872652 | 313 |
| 188 | 3300009011 | Ga0105251_10040512 | Ga0105251_100405122 | 313 |
| 189 | 3300009093 | Ga0105240_10181446 | Ga0105240_101814462 | 313 |
| 190 | 3300009176 | Ga0105242_10129698 | Ga0105242_101296982 | 313 |
| 191 | 3300009551 | Ga0105238_10256920 | Ga0105238_102569202 | 313 |
| 192 | 3300010375 | Ga0105239_10421032 | Ga0105239_104210322 | 313 |
| 193 | 3300013100 | Ga0157373_10051130 | Ga0157373_100511302 | 313 |
| 194 | 3300013104 | Ga0157370_10354613 | Ga0157370_103546132 | 313 |
| 195 | 3300013105 | Ga0157369_10013074 | Ga0157369_100130747 | 313 |
| 196 | 3300013250 | Ga0171462_1003 | Ga0171462_1003776 | 313 |
| 197 | 3300013308 | Ga0157375_10059379 | Ga0157375_100593791 | 313 |
| 198 | 3300020082 | Ga0206353_11457846 | Ga0206353_114578462 | 313 |
| 199 | 3300021388 | Ga0213875_10046588 | Ga0213875_100465884 | 313 |
| 200 | 3300024225 | Ga0224572_1005517 | Ga0224572_10055172 | 313 |
| 201 | 3300025901 | Ga0207688_10017076 | Ga0207688_100170762 | 313 |
| 202 | 3300025905 | Ga0207685_10008790 | Ga0207685_100087902 | 313 |
| 203 | 3300025906 | Ga0207699_10004178 | Ga0207699_100041788 | 313 |
| 204 | 3300025906 | Ga0207699_10037571 | Ga0207699_100375712 | 313 |
| 205 | 3300025909 | Ga0207705_10046568 | Ga0207705_100465684 | 313 |
| 206 | 3300025910 | Ga0207684_10001352 | Ga0207684_100013525 | 313 |
| 207 | 3300025910 | Ga0207684_10034667 | Ga0207684_100346673 | 313 |
| 208 | 3300025910 | Ga0207684_10167421 | Ga0207684_101674212 | 313 |
| 209 | 3300025910 | Ga0207684_10217022 | Ga0207684_102170222 | 313 |
| 210 | 3300025912 | Ga0207707_10016808 | Ga0207707_100168082 | 313 |
| 211 | 3300025915 | Ga0207693_10059820 | Ga0207693_100598202 | 313 |
| 212 | 3300025916 | Ga0207663_10051739 | Ga0207663_100517391 | 313 |
| 213 | 3300025917 | Ga0207660_10034352 | Ga0207660_100343522 | 313 |
| 214 | 3300025919 | Ga0207657_10027507 | Ga0207657_100275074 | 313 |
| 215 | 3300025921 | Ga0207652_10073490 | Ga0207652_100734903 | 313 |
| 216 | 3300025922 | Ga0207646_10003507 | Ga0207646_100035075 | 313 |
| 217 | 3300025922 | Ga0207646_10019025 | Ga0207646_100190259 | 313 |
| 218 | 3300025922 | Ga0207646_10021654 | Ga0207646_100216545 | 313 |
| 219 | 3300025922 | Ga0207646_10044116 | Ga0207646_100441163 | 313 |
| 220 | 3300025922 | Ga0207646_10202492 | Ga0207646_102024922 | 313 |
| 221 | 3300025923 | Ga0207681_10158420 | Ga0207681_101584202 | 313 |
| 222 | 3300025926 | Ga0207659_10077033 | Ga0207659_100770332 | 313 |
| 223 | 3300025928 | Ga0207700_10122806 | Ga0207700_101228062 | 313 |
| 224 | 3300025929 | Ga0207664_10058197 | Ga0207664_100581972 | 313 |
| 225 | 3300025929 | Ga0207664_10069239 | Ga0207664_100692393 | 313 |
| 226 | 3300025932 | Ga0207690_10100670 | Ga0207690_101006702 | 313 |
| 227 | 3300025933 | Ga0207706_10030200 | Ga0207706_100302004 | 313 |
| 228 | 3300025937 | Ga0207669_10109131 | Ga0207669_101091312 | 313 |
| 229 | 3300025940 | Ga0207691_10035018 | Ga0207691_100350184 | 313 |
| 230 | 3300025942 | Ga0207689_10015701 | Ga0207689_100157014 | 313 |
| 231 | 3300025944 | Ga0207661_10186458 | Ga0207661_101864582 | 313 |
| 232 | 3300025945 | Ga0207679_10134132 | Ga0207679_101341322 | 313 |
| 233 | 3300025960 | Ga0207651_10096432 | Ga0207651_100964322 | 313 |
| 234 | 3300025972 | Ga0207668_10075934 | Ga0207668_100759342 | 313 |
| 235 | 3300025981 | Ga0207640_10021267 | Ga0207640_100212672 | 313 |
| 236 | 3300025986 | Ga0207658_10488652 | Ga0207658_104886522 | 313 |
| 237 | 3300026035 | Ga0207703_10159339 | Ga0207703_101593392 | 313 |
| 238 | 3300026067 | Ga0207678_10013185 | Ga0207678_100131857 | 313 |
| 239 | 3300026078 | Ga0207702_10054526 | Ga0207702_100545261 | 313 |
| 240 | 3300026088 | Ga0207641_10134176 | Ga0207641_101341762 | 313 |
| 241 | 3300026116 | Ga0207674_10017027 | Ga0207674_100170275 | 313 |
| 242 | 3300026116 | Ga0207674_10040250 | Ga0207674_100402504 | 313 |
| 243 | 3300026118 | Ga0207675_100036033 | Ga0207675_1000360333 | 313 |
| 244 | 3300026121 | Ga0207683_10021818 | Ga0207683_100218183 | 313 |
| 245 | 3300028379 | Ga0268266_10146590 | Ga0268266_101465903 | 313 |
| 246 | 3300028666 | Ga0265336_10044594 | Ga0265336_100445942 | 313 |
| 247 | 3300028800 | Ga0265338_10001991 | Ga0265338_1000199126 | 313 |
| 248 | 3300031730 | Ga0307516_10008417 | Ga0307516_100084179 | 313 |
| 249 | 3300031852 | Ga0307410_10006480 | Ga0307410_100064804 | 313 |
| 250 | 3300032126 | Ga0307415_100309777 | Ga0307415_1003097772 | 313 |
| 251 | 3300034818 | Ga0373950_0011247 | Ga0373950_0011247_187_1164 | 313 |
| 252 | 3300034820 | Ga0373959_0020525 | Ga0373959_0020525_159_1142 | 313 |
| 253 | 3300035086 | Ga0373934_0009272 | Ga0373934_0009272_1653_2636 | 313 |
| 254 | 3300035088 | Ga0373940_0037717 | Ga0373940_0037717_319_1296 | 313 |
| 255 | 3300035092 | Ga0373952_0010051 | Ga0373952_0010051_321_1298 | 313 |
| 256 | 3300035113 | Ga0373936_0000816 | Ga0373936_0000816_3314_4291 | 313 |
| 257 | 3300035113 | Ga0373936_0018788 | Ga0373936_0018788_97_1080 | 313 |
| 258 | 3300035116 | Ga0373945_0002765 | Ga0373945_0002765_1012_1989 | 313 |
| 259 | 3300035117 | Ga0373953_0046531 | Ga0373953_0046531_25_1008 | 313 |
| 260 | 3300035118 | Ga0373954_0163933 | Ga0373954_0163933_38_1060 | 313 |
| 261 | 3300035170 | Ga0373943_0025259 | Ga0373943_0025259_760_1737 | 313 |
| 262 | 3300035171 | Ga0373946_0009936 | Ga0373946_0009936_1289_2266 | 313 |
| 263 | 3300035172 | Ga0373955_0109286 | Ga0373955_0109286_554_1528 | 313 |
| 264 | 3300035207 | Ga0373942_0021968 | Ga0373942_0021968_234_1211 | 313 |
| 265 | 3300035692 | Ga0373935_0003934 | Ga0373935_0003934_1022_1999 | 313 |
| 266 | 3300035692 | Ga0373935_0062189 | Ga0373935_0062189_695_1678 | 313 |
| 267 | 3300035695 | Ga0373927_0030750 | Ga0373927_0030750_474_1451 | 313 |
| 268 | 3300035724 | Ga0373933_0021017 | Ga0373933_0021017_2418_3392 | 313 |
| 269 | 3300035724 | Ga0373933_0110607 | Ga0373933_0110607_382_1365 | 313 |
| 270 | 3300035724 | Ga0373933_0140723 | Ga0373933_0140723_357_1334 | 313 |
| 271 | 3300035725 | Ga0373947_0000507 | Ga0373947_0000507_19298_20275 | 313 |
| 272 | 3300036401 | Ga0373937_0053362 | Ga0373937_0053362_2275_3249 | 313 |
| 273 | 3300037068 | Ga0373925_0017793 | Ga0373925_0017793_2852_3826 | 313 |
| 274 | 3300037068 | Ga0373925_0444216 | Ga0373925_0444216_20_994 | 313 |
| 275 | 3300037466 | Ga0395898_0002002 | Ga0395898_0002002_6092_7081 | 313 |
| 276 | 3300037853 | Ga0436364_0348696 | Ga0436364_0348696_883_1878 | 313 |
| 277 | 3300038443 | Ga0395901_0014340 | Ga0395901_0014340_2310_3299 | 313 |
| 278 | 3300041410 | Ga0439461_0012722 | Ga0439461_0012722_220_1167 | 313 |
| 279 | 3300042004 | Ga0439445_0005518 | Ga0439445_0005518_1618_2565 | 313 |
| 280 | 3300042435 | Ga0439434_0005861 | Ga0439434_0005861_1860_2807 | 313 |
| 281 | 3300044658 | Ga0466972_0093358 | Ga0466972_0093358_180_1130 | 313 |
| 282 | 3300044684 | Ga0466966_0023567 | Ga0466966_0023567_1208_2185 | 313 |
| 283 | 3300044684 | Ga0466966_0209294 | Ga0466966_0209294_137_1114 | 313 |
| 284 | 3300044693 | Ga0466961_0037683 | Ga0466961_0037683_1006_1983 | 313 |
| 285 | 3300044694 | Ga0466963_0024401 | Ga0466963_0024401_1690_2685 | 313 |
| 286 | 3300044694 | Ga0466963_0218105 | Ga0466963_0218105_139_1116 | 313 |
| 287 | 3300044765 | Ga0466970_0055511 | Ga0466970_0055511_1033_2010 | 313 |
| 288 | 3300044842 | Ga0466957_0036129 | Ga0466957_0036129_1917_2894 | 313 |
| 289 | 3300044901 | Ga0466960_0020463 | Ga0466960_0020463_213_1190 | 313 |
| 290 | 3300045049 | Ga0466959_0213466 | Ga0466959_0213466_18_995 | 313 |
| 291 | 3300045976 | Ga0466967_0128165 | Ga0466967_0128165_820_1797 | 313 |
| 292 | 3300045976 | Ga0466967_0531436 | Ga0466967_0531436_128_1111 | 313 |
| 293 | 3300046454 | Ga0495592_0104110 | Ga0495592_0104110_916_1899 | 313 |
| 294 | 3300046462 | Ga0495651_0018544 | Ga0495651_0018544_2273_3247 | 313 |
| 295 | 3300046463 | Ga0495653_0007618 | Ga0495653_0007618_2018_2992 | 313 |
| 296 | 3300046463 | Ga0495653_0037080 | Ga0495653_0037080_2413_3390 | 313 |
| 297 | 3300046463 | Ga0495653_0132285 | Ga0495653_0132285_200_1177 | 313 |
| 298 | 3300046477 | Ga0495664_0001225 | Ga0495664_0001225_481_1458 | 313 |
| 299 | 3300046477 | Ga0495664_0142276 | Ga0495664_0142276_280_1257 | 313 |
| 300 | 3300046511 | Ga0495608_0031401 | Ga0495608_0031401_2339_3313 | 313 |
| 301 | 3300046511 | Ga0495608_0033562 | Ga0495608_0033562_1362_2345 | 313 |
| 302 | 3300046514 | Ga0495618_0062273 | Ga0495618_0062273_1378_2352 | 313 |
| 303 | 3300046516 | Ga0495628_0033870 | Ga0495628_0033870_1408_2382 | 313 |
| 304 | 3300046517 | Ga0495630_0013873 | Ga0495630_0013873_2843_3820 | 313 |
| 305 | 3300046529 | Ga0495652_0014611 | Ga0495652_0014611_965_1942 | 313 |
| 306 | 3300046529 | Ga0495652_0046918 | Ga0495652_0046918_1300_2274 | 313 |
| 307 | 3300046531 | Ga0495665_0026958 | Ga0495665_0026958_1178_2155 | 313 |
| 308 | 3300046533 | Ga0495640_0059335 | Ga0495640_0059335_409_1383 | 313 |
| 309 | 3300046533 | Ga0495640_0065546 | Ga0495640_0065546_797_1774 | 313 |
| 310 | 3300046536 | Ga0495587_0017811 | Ga0495587_0017811_1292_2266 | 313 |
| 311 | 3300046543 | Ga0495645_0059152 | Ga0495645_0059152_1500_2474 | 313 |
| 312 | 3300046543 | Ga0495645_0077529 | Ga0495645_0077529_765_1742 | 313 |
| 313 | 3300046559 | Ga0495667_0001300 | Ga0495667_0001300_14119_15093 | 313 |
| 314 | 3300046559 | Ga0495667_0001964 | Ga0495667_0001964_11957_12934 | 313 |
| 315 | 3300046559 | Ga0495667_0026328 | Ga0495667_0026328_785_1768 | 313 |
| 316 | 3300046559 | Ga0495667_0206078 | Ga0495667_0206078_25_1002 | 313 |
| 317 | 3300046642 | Ga0495634_0028277 | Ga0495634_0028277_782_1759 | 313 |
| 318 | 3300046663 | Ga0495635_0003905 | Ga0495635_0003905_3671_4648 | 313 |
| 319 | 3300046663 | Ga0495635_0007672 | Ga0495635_0007672_3986_4960 | 313 |
| 320 | 3300046663 | Ga0495635_0014137 | Ga0495635_0014137_3489_4472 | 313 |
| 321 | 3300046675 | Ga0495657_0002104 | Ga0495657_0002104_10725_11699 | 313 |
| 322 | 3300046675 | Ga0495657_0085338 | Ga0495657_0085338_110_1093 | 313 |
| 323 | 3300046675 | Ga0495657_0141612 | Ga0495657_0141612_71_1048 | 313 |
| 324 | 3300046678 | Ga0495599_0007116 | Ga0495599_0007116_3537_4511 | 313 |
| 325 | 3300046679 | Ga0495623_0024425 | Ga0495623_0024425_2422_3405 | 313 |
| 326 | 3300046679 | Ga0495623_0073948 | Ga0495623_0073948_353_1327 | 313 |
| 327 | 3300046680 | Ga0495646_0067004 | Ga0495646_0067004_657_1643 | 313 |
| 328 | 3300046690 | Ga0495624_0044685 | Ga0495624_0044685_632_1609 | 313 |
| 329 | 3300046809 | Ga0495600_0002220 | Ga0495600_0002220_2494_3468 | 313 |
| 330 | 3300046809 | Ga0495600_0015721 | Ga0495600_0015721_670_1653 | 313 |
| 331 | 3300047315 | Ga0495581_0019966 | Ga0495581_0019966_2246_3223 | 313 |
| 332 | 3300047317 | Ga0495604_0009251 | Ga0495604_0009251_4157_5131 | 313 |
| 333 | 3300047317 | Ga0495604_0043737 | Ga0495604_0043737_2387_3370 | 313 |
| 334 | 3300047319 | Ga0495674_0024215 | Ga0495674_0024215_573_1550 | 313 |
| 335 | 3300047319 | Ga0495674_0052179 | Ga0495674_0052179_2011_2985 | 313 |
| 336 | 3300047321 | Ga0495676_0077872 | Ga0495676_0077872_771_1748 | 313 |
| 337 | 3300047322 | Ga0495680_0006448 | Ga0495680_0006448_9570_10553 | 313 |
| 338 | 3300047322 | Ga0495680_0017797 | Ga0495680_0017797_645_1622 | 313 |
| 339 | 3300047322 | Ga0495680_0059823 | Ga0495680_0059823_67_1044 | 313 |
| 340 | 3300047444 | Ga0495675_0016606 | Ga0495675_0016606_2254_3228 | 313 |
| 341 | 3300047471 | Ga0495684_0001486 | Ga0495684_0001486_11850_12827 | 313 |
| 342 | 3300047471 | Ga0495684_0046141 | Ga0495684_0046141_1367_2341 | 313 |
| 343 | 3300048088 | Ga0495602_0011413 | Ga0495602_0011413_4558_5532 | 313 |
| 344 | 3300048905 | Ga0496102_0249442 | Ga0496102_0249442_440_1417 | 313 |
| 345 | 3300048906 | Ga0496103_0206744 | Ga0496103_0206744_97_1074 | 313 |
| 346 | 3300048907 | Ga0496104_0026345 | Ga0496104_0026345_1758_2735 | 313 |
| 347 | 3300048911 | Ga0496108_0073172 | Ga0496108_0073172_1133_2128 | 313 |
| 348 | 3300048912 | Ga0496109_0011306 | Ga0496109_0011306_1248_2219 | 313 |
| 349 | 3300048912 | Ga0496109_0148796 | Ga0496109_0148796_410_1405 | 313 |
| 350 | 3300048915 | Ga0496112_0177641 | Ga0496112_0177641_367_1344 | 313 |
| 351 | 3300048916 | Ga0496113_0155105 | Ga0496113_0155105_289_1284 | 313 |
| 352 | 3300048922 | Ga0496119_0001628 | Ga0496119_0001628_24009_24971 | 313 |
| 353 | 3300049569 | Ga0501032_0023133 | Ga0501032_0023133_3025_3981 | 313 |
| 354 | 3300049571 | Ga0501034_0045371 | Ga0501034_0045371_2172_3128 | 313 |
| 355 | 3300049572 | Ga0501036_0003785 | Ga0501036_0003785_9968_10993 | 313 |
| 356 | 3300049572 | Ga0501036_0082873 | Ga0501036_0082873_428_1384 | 313 |
| 357 | 3300049573 | Ga0501037_0008667 | Ga0501037_0008667_1565_2521 | 313 |
| 358 | 3300049574 | Ga0501038_0057109 | Ga0501038_0057109_73_1098 | 313 |
| 359 | 3300049574 | Ga0501038_0067644 | Ga0501038_0067644_1367_2323 | 313 |
| 360 | 3300049575 | Ga0501039_0005716 | Ga0501039_0005716_6820_7776 | 313 |
| 361 | 3300049575 | Ga0501039_0077141 | Ga0501039_0077141_13_993 | 313 |
| 362 | 3300049576 | Ga0501040_0210761 | Ga0501040_0210761_301_1272 | 313 |
| 363 | 3300049578 | Ga0501042_0010961 | Ga0501042_0010961_2839_3864 | 313 |
| 364 | 3300049580 | Ga0501046_0006195 | Ga0501046_0006195_9022_9978 | 313 |
| 365 | 3300049581 | Ga0501047_0039713 | Ga0501047_0039713_3486_4442 | 313 |
| 366 | 3300049581 | Ga0501047_0202839 | Ga0501047_0202839_308_1333 | 313 |
| 367 | 3300049582 | Ga0501048_0005889 | Ga0501048_0005889_697_1653 | 313 |
| 368 | 3300049582 | Ga0501048_0039994 | Ga0501048_0039994_2132_3157 | 313 |
| 369 | 3300049586 | Ga0501070_0000837 | Ga0501070_0000837_14644_15606 | 313 |
| 370 | 3300049586 | Ga0501070_0085155 | Ga0501070_0085155_481_1437 | 313 |
| 371 | 3300049589 | Ga0501073_0044251 | Ga0501073_0044251_1344_2369 | 313 |
| 372 | 3300049590 | Ga0501074_0022809 | Ga0501074_0022809_2357_3382 | 313 |
| 373 | 3300049823 | Ga0501044_0049712 | Ga0501044_0049712_1605_2630 | 313 |
| 374 | 3300049823 | Ga0501044_0084073 | Ga0501044_0084073_321_1277 | 313 |
| 375 | 3300050515 | nmdc:mga0a205_327734_c1 | nmdc:mga0a205_327734_c1_284_1261 | 313 |
| 376 | 3300053084 | Ga0495595_0054401 | Ga0495595_0054401_659_1633 | 313 |
| 377 | 3300060353 | Ga0501082_0192906 | Ga0501082_0192906_257_1213 | 313 |
| 378 | 3300061719 | Ga0466962_0031924 | Ga0466962_0031924_25_1005 | 313 |
| 379 | 3300061719 | Ga0466962_0034712 | Ga0466962_0034712_1339_2316 | 313 |
| 380 | iso_pu_bacteria | 2643221635 | 2644198867 | 313 |
| 381 | iso_pu_bacteria | 2784132109 | 2784473302 | 313 |
| 382 | iso_pu_bacteria | 2808606447 | 2809228134 | 313 |
| 383 | iso_pu_bacteria | 2852632344 | 2852634842 | 313 |
| 384 | iso_pu_bacteria | 2857737099 | 2857738871 | 313 |
| 385 | iso_pu_bacteria | 2902792274 | 2902796912 | 313 |
| 386 | iso_pu_bacteria | 2935409751 | 2935411864 | 313 |
| 387 | iso_pu_bacteria | 2939582691 | 2939588222 | 313 |
| 388 | 3300044901 | Ga0466960_0008185 | Ga0466960_0008185_2357_3322 | 314 |
| 389 | 3300003752 | Ga0055539_1000014 | Ga0055539_1000014305 | 315 |
| 390 | 3300003756 | Ga0055533_1000002 | Ga0055533_10000021092 | 315 |
| 391 | 3300003759 | Ga0055525_1000094 | Ga0055525_100009451 | 315 |
| 392 | 3300003760 | Ga0055527_1000003 | Ga0055527_1000003398 | 315 |
| 393 | 3300003762 | Ga0055542_1000005 | Ga0055542_1000005262 | 315 |
| 394 | 3300003841 | Ga0055541_1002687 | Ga0055541_10026872 | 315 |
| 395 | 3300005329 | Ga0070683_100187516 | Ga0070683_1001875162 | 315 |
| 396 | 3300005329 | Ga0070683_100351424 | Ga0070683_1003514242 | 315 |
| 397 | 3300005337 | Ga0070682_100170523 | Ga0070682_1001705231 | 315 |
| 398 | 3300005456 | Ga0070678_100077995 | Ga0070678_1000779952 | 315 |
| 399 | 3300005535 | Ga0070684_100245001 | Ga0070684_1002450012 | 315 |
| 400 | 3300006871 | Ga0075434_100275664 | Ga0075434_1002756642 | 315 |
| 401 | 3300009098 | Ga0105245_10074201 | Ga0105245_100742013 | 315 |
| 402 | 3300009177 | Ga0105248_10018224 | Ga0105248_100182246 | 315 |
| 403 | 3300011119 | Ga0105246_10062748 | Ga0105246_100627482 | 315 |
| 404 | 3300013307 | Ga0157372_10000024 | Ga0157372_10000024148 | 315 |
| 405 | 3300020082 | Ga0206353_10017933 | Ga0206353_100179332 | 315 |
| 406 | 3300025225 | Ga0209566_100094 | Ga0209566_10009480 | 315 |
| 407 | 3300025226 | Ga0209674_100001 | Ga0209674_1000012476 | 315 |
| 408 | 3300025228 | Ga0209672_100003 | Ga0209672_1000031236 | 315 |
| 409 | 3300025229 | Ga0209147_100863 | Ga0209147_10086310 | 315 |
| 410 | 3300025230 | Ga0209563_100001 | Ga0209563_1000012476 | 315 |
| 411 | 3300025242 | Ga0209258_100989 | Ga0209258_10098914 | 315 |
| 412 | 3300025253 | Ga0209677_100001 | Ga0209677_1000012476 | 315 |
| 413 | 3300025254 | Ga0209148_1000004 | Ga0209148_10000041531 | 315 |
| 414 | 3300025272 | Ga0209455_1000091 | Ga0209455_1000091202 | 315 |
| 415 | 3300025934 | Ga0207686_10273850 | Ga0207686_102738502 | 315 |
| 416 | 3300025937 | Ga0207669_10011165 | Ga0207669_100111652 | 315 |
| 417 | 3300025941 | Ga0207711_10074580 | Ga0207711_100745803 | 315 |
| 418 | 3300025944 | Ga0207661_10182581 | Ga0207661_101825811 | 315 |
| 419 | 3300026067 | Ga0207678_10294845 | Ga0207678_102948452 | 315 |
| 420 | 3300026088 | Ga0207641_10028278 | Ga0207641_100282784 | 315 |
| 421 | 3300026121 | Ga0207683_10100484 | Ga0207683_101004842 | 315 |
| 422 | 3300031901 | Ga0307406_10091021 | Ga0307406_100910212 | 315 |
| 423 | 3300035118 | Ga0373954_0135553 | Ga0373954_0135553_76_1050 | 315 |
| 424 | 3300037853 | Ga0436364_0006913 | Ga0436364_0006913_348_1454 | 315 |
| 425 | 3300038443 | Ga0395901_0032192 | Ga0395901_0032192_1967_3001 | 315 |
| 426 | 3300044684 | Ga0466966_0023354 | Ga0466966_0023354_1854_2858 | 315 |
| 427 | 3300044694 | Ga0466963_0162532 | Ga0466963_0162532_501_1523 | 315 |
| 428 | 3300044901 | Ga0466960_0001137 | Ga0466960_0001137_2367_3353 | 315 |
| 429 | 3300046460 | Ga0495638_0001104 | Ga0495638_0001104_22420_23379 | 315 |
| 430 | 3300048903 | Ga0496100_0001094 | Ga0496100_0001094_8541_9533 | 315 |
| 431 | 3300048903 | Ga0496100_0035610 | Ga0496100_0035610_498_1460 | 315 |
| 432 | 3300048904 | Ga0496101_0006806 | Ga0496101_0006806_3989_4981 | 315 |
| 433 | 3300048904 | Ga0496101_0246063 | Ga0496101_0246063_74_1090 | 315 |
| 434 | 3300048905 | Ga0496102_0028681 | Ga0496102_0028681_492_1508 | 315 |
| 435 | 3300048905 | Ga0496102_0174618 | Ga0496102_0174618_655_1632 | 315 |
| 436 | 3300048906 | Ga0496103_0157421 | Ga0496103_0157421_92_1108 | 315 |
| 437 | 3300048907 | Ga0496104_0004672 | Ga0496104_0004672_6096_7088 | 315 |
| 438 | 3300048907 | Ga0496104_0296419 | Ga0496104_0296419_334_1293 | 315 |
| 439 | 3300048907 | Ga0496104_0345787 | Ga0496104_0345787_312_1328 | 315 |
| 440 | 3300048908 | Ga0496105_0109234 | Ga0496105_0109234_1191_2153 | 315 |
| 441 | 3300048909 | Ga0496106_0003170 | Ga0496106_0003170_9391_10383 | 315 |
| 442 | 3300048909 | Ga0496106_0060400 | Ga0496106_0060400_359_1375 | 315 |
| 443 | 3300048910 | Ga0496107_0010357 | Ga0496107_0010357_3195_4157 | 315 |
| 444 | 3300048910 | Ga0496107_0031440 | Ga0496107_0031440_687_1679 | 315 |
| 445 | 3300048911 | Ga0496108_0032568 | Ga0496108_0032568_1688_2665 | 315 |
| 446 | 3300048911 | Ga0496108_0058859 | Ga0496108_0058859_1019_2035 | 315 |
| 447 | 3300048912 | Ga0496109_0180530 | Ga0496109_0180530_578_1555 | 315 |
| 448 | 3300048912 | Ga0496109_0229933 | Ga0496109_0229933_282_1298 | 315 |
| 449 | 3300048912 | Ga0496109_0335499 | Ga0496109_0335499_13_975 | 315 |
| 450 | 3300048913 | Ga0496110_0016532 | Ga0496110_0016532_2506_3522 | 315 |
| 451 | 3300048913 | Ga0496110_0106004 | Ga0496110_0106004_1521_2483 | 315 |
| 452 | 3300048914 | Ga0496111_0010048 | Ga0496111_0010048_3296_4312 | 315 |
| 453 | 3300048915 | Ga0496112_0309505 | Ga0496112_0309505_253_1266 | 315 |
| 454 | 3300048915 | Ga0496112_0462627 | Ga0496112_0462627_93_1109 | 315 |
| 455 | 3300048915 | Ga0496112_0485735 | Ga0496112_0485735_181_1143 | 315 |
| 456 | 3300048916 | Ga0496113_0203125 | Ga0496113_0203125_431_1447 | 315 |
| 457 | 3300048917 | Ga0496114_0002590 | Ga0496114_0002590_3658_4650 | 315 |
| 458 | 3300048917 | Ga0496114_0148940 | Ga0496114_0148940_285_1262 | 315 |
| 459 | 3300048918 | Ga0496115_0018527 | Ga0496115_0018527_1525_2517 | 315 |
| 460 | 3300048923 | Ga0496120_0045628 | Ga0496120_0045628_243_1205 | 315 |
| 461 | 3300049583 | Ga0501067_0052892 | Ga0501067_0052892_740_1756 | 315 |
| 462 | iso_pu_bacteria | 2643221567 | 2643852025 | 315 |
| 463 | iso_pu_bacteria | 2643221624 | 2644136542 | 315 |
| 464 | iso_pu_bacteria | 2643221687 | 2644490098 | 315 |
| 465 | iso_pu_bacteria | 2739367653 | 2739603817 | 315 |
| 466 | iso_pu_bacteria | 2816332305 | 2817510063 | 315 |
| 467 | iso_pu_bacteria | 2857727296 | 2857727875 | 315 |
| 468 | iso_pu_bacteria | 2920879853 | 2920879917 | 315 |
| 469 | iso_pu_bacteria | 8045830549 | 8045830805 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nip-assembly1.cif.gz_D | crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane | 0.9249 | 5 | 308 |
| 1gq6-assembly1.cif.gz_C-2 | proclavaminate amidino hydrolase from streptomyces clavuligerus | 0.9196 | 11 | 308 |
| 1gq6-assembly1.cif.gz_A-2 | proclavaminate amidino hydrolase from streptomyces clavuligerus | 0.9182 | 11 | 308 |
| 1gq6-assembly1.cif.gz_B | proclavaminate amidino hydrolase from streptomyces clavuligerus | 0.913 | 11 | 308 |
| 3nio-assembly1.cif.gz_D | crystal structure of pseudomonas aeruginosa guanidinobutyrase | 0.9097 | 5 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3niqB00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.9259 | 1 | 308 | 3.40.800.10 |
| 1gq7A00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.9156 | 11 | 308 | 3.40.800.10 |
| af_A0A1D8PPP3_13_348_3.40.800.10 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.915 | 13 | 313 | 3.40.800.10 |
| af_Q10088_33_382_3.40.800.10 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.9107 | 12 | 310 | 3.40.800.10 |
| 3niqB00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.9091 | 1 | 308 | 3.40.800.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I9VV76-F1-model_v4 | Agmatinase | 0.9559 | 2 | 169 |
GO:0008783
GO:0033389 GO:0046872 |
| AF-A0A401QBJ2-F1-model_v4 | Agmatinase | 0.9551 | 53 | 200 |
GO:0008783
GO:0033389 GO:0046872 |
| AF-T1B9P0-F1-model_v4 | Agmatinase | 0.9538 | 49 | 203 |
GO:0008783
GO:0033389 GO:0046872 |
| AF-A0A543NI98-F1-model_v4 | Agmatinase | 0.9502 | 2 | 311 |
GO:0008783
GO:0033389 GO:0046872 |
| AF-A0A553ZNV9-F1-model_v4 | Agmatinase (EC 3.5.3.11) | 0.9501 | 2 | 308 |
GO:0008783
GO:0033389 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar