F450286

General Info

Members Datasets Scaffolds Average Seq Length
469 290 438 325

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0143645|Ga0466970_0143645_70_1071
Length 318
Sequence MTDQTPLPGSSDSTGSPQSTRPDPVGPVDASLDPRYSGFATFARLPRLEDLRGADTVIWGVPFDAGVSYRPGARFGPTHVRQSSRLLRPYNPAQDSEPFARAQVADGGDLGVNPFDIEAAIASVTIGGDHTIALPLLRVQAERHGPIAVLHFDAHLDTWDTYFGAPYTHGTPFRRAAEEGLIDFEHSLHVGLRGPLYSRLDLDESEKLGFAAVHCRDFARQPLDDIINRVRERLGDRPVYVSLDIDVLDPAFAPGTGTPEAGGMSSLQLLEVLRGLEGLNVVGADVVEVSPAYDHAEITGIAAAHTIYEMLSILPGRS

Samples

Sample ID Description Type Environment
1 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
2 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
3 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
6 2671180195 Frankia sp. CcI49 Isolate Nodule
7 2739367653 Kocuria sp. OV113 Isolate Unclassified
8 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
9 2773857922 Frankia sp. CcI49 Isolate Nodule
10 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
11 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
12 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
13 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
14 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
15 2857727296 Kocuria sp. R-72562 Isolate Unclassified
16 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
17 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
18 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
19 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
20 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
21 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
22 2920879853 Kocuria salina CV6 Isolate Unclassified
23 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
24 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
25 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
26 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
27 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
28 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
29 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
30 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
148 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
289 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
290 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.54
Metatranscriptomes 0.85
Isolates 6.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0.43
Rhizoplane 9.38
Rhizosphere 78.68
Stem 0
Stem Tuber 0
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1000014 3300003752 Bacteria 381086
2 Ga0055533_1000002 3300003756 Bacteria 1196393
3 Ga0055525_1000094 3300003759 Bacteria 138254
4 Ga0055527_1000003 3300003760 Bacteria 705001
5 Ga0055542_1000005 3300003762 Bacteria 550280
6 Ga0055541_1002687 3300003841 Bacteria 3481
7 Ga0070658_10020908 3300005327 Bacteria 5242
8 Ga0070683_100010881 3300005329 Bacteria 7831
9 Ga0070683_100069410 3300005329 Bacteria 3286
10 Ga0070683_100187516 3300005329 Bacteria 1963
11 Ga0070683_100207140 3300005329 Bacteria 1863
12 Ga0070683_100351424 3300005329 Bacteria 1404
13 Ga0070683_100491042 3300005329 Bacteria 1173
14 Ga0068869_100089687 3300005334 Bacteria 2309
15 Ga0070680_100036961 3300005336 Bacteria 3946
16 Ga0070682_100170523 3300005337 Bacteria 1512
17 Ga0070689_100032316 3300005340 Bacteria 3980
18 Ga0070675_100043831 3300005354 Bacteria 3658
19 Ga0070674_100089125 3300005356 Bacteria 2222
20 Ga0070659_100123151 3300005366 Bacteria 2102
21 Ga0070667_100081497 3300005367 Bacteria 2769
22 Ga0070714_100000010 3300005435 Bacteria 262871
23 Ga0070714_100053606 3300005435 Bacteria 3443
24 Ga0070714_100080207 3300005435 Bacteria 2840
25 Ga0070714_100139625 3300005435 Bacteria 2173
26 Ga0070713_100324019 3300005436 Bacteria 1424
27 Ga0070708_100023466 3300005445 Bacteria 5247
28 Ga0070708_100056934 3300005445 Bacteria 3478
29 Ga0070663_100068563 3300005455 Bacteria 2575
30 Ga0070678_100077995 3300005456 Bacteria 2501
31 Ga0070681_10007783 3300005458 Bacteria 10476
32 Ga0070706_100001281 3300005467 Bacteria 26829
33 Ga0070706_100019041 3300005467 Bacteria 6332
34 Ga0070706_100034807 3300005467 Bacteria 4651
35 Ga0070707_100004915 3300005468 Bacteria 12525
36 Ga0070707_100005475 3300005468 Bacteria 11870
37 Ga0070707_100058457 3300005468 Bacteria 3698
38 Ga0070698_100063427 3300005471 Bacteria 3726
39 Ga0070699_100020301 3300005518 Bacteria 5729
40 Ga0070699_100208806 3300005518 Bacteria 1738
41 Ga0070679_100169588 3300005530 Bacteria 2155
42 Ga0070679_100298255 3300005530 Bacteria 1562
43 Ga0070679_100306392 3300005530 Bacteria 1539
44 Ga0070684_100065400 3300005535 Bacteria 3191
45 Ga0070684_100245001 3300005535 Bacteria 1638
46 Ga0070684_100253539 3300005535 Bacteria 1608
47 Ga0070697_100001798 3300005536 Bacteria 16375
48 Ga0070695_100025934 3300005545 Bacteria 3623
49 Ga0070693_100068459 3300005547 Bacteria 2083
50 Ga0068857_100068079 3300005577 Bacteria 3170
51 Ga0068857_100078004 3300005577 Bacteria 2956
52 Ga0068854_100030480 3300005578 Bacteria 3741
53 Ga0068856_100099094 3300005614 Bacteria 2905
54 Ga0068856_100284874 3300005614 Bacteria 1669
55 Ga0070702_100025004 3300005615 Bacteria 3194
56 Ga0068852_100116462 3300005616 Bacteria 2438
57 Ga0068864_100574304 3300005618 Bacteria 1092
58 Ga0068863_100055108 3300005841 Bacteria 3766
59 Ga0068863_100310069 3300005841 Bacteria 1532
60 Ga0068858_100032076 3300005842 Bacteria 4879
61 Ga0068860_100051910 3300005843 Bacteria 3900
62 Ga0068860_100072149 3300005843 Bacteria 3281
63 Ga0081455_10023422 3300005937 Bacteria 5745
64 Ga0081540_1000811 3300005983 Bacteria 28653
65 Ga0070717_10026624 3300006028 Bacteria 4615
66 Ga0070717_10389090 3300006028 Bacteria 1251
67 Ga0070716_100109737 3300006173 Bacteria 1707
68 Ga0070712_100090517 3300006175 Bacteria 2240
69 Ga0070712_100091390 3300006175 Bacteria 2230
70 Ga0070712_100210288 3300006175 Bacteria 1533
71 Ga0097621_100289311 3300006237 Bacteria 1444
72 Ga0075433_10085780 3300006852 Bacteria 2780
73 Ga0075434_100275664 3300006871 Bacteria 1701
74 Ga0075436_100142000 3300006914 Bacteria 1688
75 Ga0075436_100237938 3300006914 Bacteria 1294
76 Ga0075435_100087265 3300007076 Bacteria 2570
77 Ga0105251_10040512 3300009011 Bacteria 2271
78 Ga0105240_10127825 3300009093 Bacteria 3052
79 Ga0105240_10181446 3300009093 Bacteria 2484
80 Ga0105245_10074201 3300009098 Bacteria 3095
81 Ga0105242_10129698 3300009176 Bacteria 2174
82 Ga0105248_10018224 3300009177 Bacteria 7754
83 Ga0105238_10256920 3300009551 Bacteria 1726
84 Ga0099796_10091265 3300010159 Bacteria 1133
85 Ga0105239_10421032 3300010375 Bacteria 1513
86 Ga0105246_10062748 3300011119 Bacteria 2590
87 Ga0157373_10051130 3300013100 Bacteria 2943
88 Ga0157370_10354613 3300013104 Bacteria 1352
89 Ga0157369_10013074 3300013105 Bacteria 9399
90 Ga0171462_1003 3300013250 Bacteria 853796
91 Ga0157372_10000024 3300013307 Bacteria 197716
92 Ga0157375_10059379 3300013308 Bacteria 3789
93 Ga0157375_10189369 3300013308 Bacteria 2212
94 Ga0206353_10017933 3300020082 Bacteria 2009
95 Ga0206353_10976584 3300020082 Bacteria 1073
96 Ga0206353_11457846 3300020082 Bacteria 4003
97 Ga0213875_10046588 3300021388 Bacteria 2034
98 Ga0213875_10047829 3300021388 Bacteria 2007
99 Ga0213875_10077576 3300021388 Bacteria 1550
100 Ga0213875_10123654 3300021388 Bacteria 1209
101 Ga0224572_1005517 3300024225 Bacteria 2259
102 Ga0209566_100094 3300025225 Bacteria 136227
103 Ga0209674_100001 3300025226 Bacteria 4013750
104 Ga0209672_100003 3300025228 Bacteria 1560476
105 Ga0209147_100863 3300025229 Bacteria 14122
106 Ga0209563_100001 3300025230 Bacteria 4013775
107 Ga0209258_100989 3300025242 Bacteria 13125
108 Ga0209677_100001 3300025253 Bacteria 4013787
109 Ga0209148_1000004 3300025254 Bacteria 1844481
110 Ga0209455_1000091 3300025272 Bacteria 223115
111 Ga0207692_10001913 3300025898 Bacteria 7921
112 Ga0207688_10017076 3300025901 Bacteria 3944
113 Ga0207685_10008790 3300025905 Bacteria 2899
114 Ga0207699_10004178 3300025906 Bacteria 6917
115 Ga0207699_10037571 3300025906 Bacteria 2769
116 Ga0207705_10046568 3300025909 Bacteria 3117
117 Ga0207684_10001352 3300025910 Bacteria 26867
118 Ga0207684_10034667 3300025910 Bacteria 4288
119 Ga0207684_10167421 3300025910 Bacteria 1894
120 Ga0207684_10217022 3300025910 Bacteria 1650
121 Ga0207707_10016808 3300025912 Bacteria 6375
122 Ga0207693_10059820 3300025915 Bacteria 2985
123 Ga0207663_10051739 3300025916 Bacteria 2559
124 Ga0207663_10073110 3300025916 Bacteria 2218
125 Ga0207660_10034352 3300025917 Bacteria 3514
126 Ga0207657_10027507 3300025919 Bacteria 5207
127 Ga0207652_10073490 3300025921 Bacteria 2975
128 Ga0207646_10003507 3300025922 Bacteria 17673
129 Ga0207646_10019025 3300025922 Bacteria 6393
130 Ga0207646_10021654 3300025922 Bacteria 5934
131 Ga0207646_10044116 3300025922 Bacteria 4003
132 Ga0207646_10202492 3300025922 Bacteria 1793
133 Ga0207681_10158420 3300025923 Bacteria 1704
134 Ga0207659_10077033 3300025926 Bacteria 2453
135 Ga0207700_10122806 3300025928 Bacteria 2108
136 Ga0207700_10274557 3300025928 Bacteria 1448
137 Ga0207664_10000009 3300025929 Bacteria 299246
138 Ga0207664_10058197 3300025929 Bacteria 3074
139 Ga0207664_10069239 3300025929 Bacteria 2837
140 Ga0207664_10079131 3300025929 Bacteria 2667
141 Ga0207664_10571693 3300025929 Bacteria 1015
142 Ga0207690_10100670 3300025932 Bacteria 2063
143 Ga0207706_10030200 3300025933 Bacteria 4836
144 Ga0207686_10273850 3300025934 Bacteria 1243
145 Ga0207669_10011165 3300025937 Bacteria 4360
146 Ga0207669_10109131 3300025937 Bacteria 1850
147 Ga0207691_10035018 3300025940 Bacteria 4666
148 Ga0207711_10074580 3300025941 Bacteria 2951
149 Ga0207689_10015701 3300025942 Bacteria 6411
150 Ga0207661_10182581 3300025944 Bacteria 1834
151 Ga0207661_10186458 3300025944 Bacteria 1816
152 Ga0207679_10134132 3300025945 Bacteria 1991
153 Ga0207651_10096432 3300025960 Bacteria 2181
154 Ga0207668_10075934 3300025972 Bacteria 2418
155 Ga0207668_10117705 3300025972 Bacteria 2006
156 Ga0207640_10021267 3300025981 Bacteria 3865
157 Ga0207658_10488652 3300025986 Bacteria 1095
158 Ga0207703_10159339 3300026035 Bacteria 1975
159 Ga0207703_10247165 3300026035 Bacteria 1606
160 Ga0207678_10013185 3300026067 Bacteria 7253
161 Ga0207678_10051102 3300026067 Bacteria 3569
162 Ga0207678_10294845 3300026067 Bacteria 1393
163 Ga0207702_10054526 3300026078 Bacteria 3388
164 Ga0207641_10028278 3300026088 Bacteria 4632
165 Ga0207641_10134176 3300026088 Bacteria 2226
166 Ga0207641_10144614 3300026088 Bacteria 2149
167 Ga0207674_10017027 3300026116 Bacteria 7936
168 Ga0207674_10040250 3300026116 Bacteria 4843
169 Ga0207675_100036033 3300026118 Bacteria 4614
170 Ga0207683_10021818 3300026121 Bacteria 5491
171 Ga0207683_10100484 3300026121 Bacteria 2582
172 Ga0207698_10268884 3300026142 Bacteria 1570
173 Ga0268266_10146590 3300028379 Bacteria 2123
174 Ga0265336_10044594 3300028666 Bacteria 1349
175 Ga0265338_10001991 3300028800 Bacteria 31759
176 Ga0316177_1131317 3300030731 Bacteria 1218
177 Ga0314311_1007878 3300030733 Bacteria 5247
178 Ga0265327_10000004 3300031251 Bacteria 803973
179 Ga0307508_10001845 3300031616 Bacteria 23415
180 Ga0307508_10054928 3300031616 Bacteria 3529
181 Ga0307516_10008417 3300031730 Bacteria 11691
182 Ga0307410_10006480 3300031852 Bacteria 6321
183 Ga0307406_10091021 3300031901 Bacteria 2054
184 Ga0307415_100206913 3300032126 Bacteria 1562
185 Ga0307415_100309777 3300032126 Bacteria 1312
186 Ga0373950_0011247 3300034818 Bacteria 1460
187 Ga0373959_0020525 3300034820 Bacteria 1261
188 Ga0373926_0008082 3300035083 Bacteria 3502
189 Ga0373934_0009272 3300035086 Bacteria 3684
190 Ga0373940_0037717 3300035088 Bacteria 1317
191 Ga0373944_0010754 3300035089 Bacteria 2499
192 Ga0373952_0010051 3300035092 Bacteria 1823
193 Ga0373923_0000697 3300035111 Bacteria 8578
194 Ga0373936_0000748 3300035113 Bacteria 11387
195 Ga0373936_0000816 3300035113 Bacteria 11054
196 Ga0373936_0018788 3300035113 Bacteria 2672
197 Ga0373945_0002765 3300035116 Bacteria 5510
198 Ga0373945_0017763 3300035116 Bacteria 2412
199 Ga0373953_0011299 3300035117 Bacteria 3130
200 Ga0373953_0046531 3300035117 Bacteria 1742
201 Ga0373954_0135553 3300035118 Bacteria 1200
202 Ga0373954_0163933 3300035118 Bacteria 1088
203 Ga0373957_0010071 3300035120 Bacteria 3112
204 Ga0373943_0002447 3300035170 Bacteria 8433
205 Ga0373943_0025259 3300035170 Bacteria 2776
206 Ga0373946_0004987 3300035171 Bacteria 4778
207 Ga0373946_0009936 3300035171 Bacteria 3518
208 Ga0373955_0100224 3300035172 Bacteria 1661
209 Ga0373955_0109286 3300035172 Bacteria 1597
210 Ga0373942_0021968 3300035207 Bacteria 1615
211 Ga0373924_0010655 3300035410 Bacteria 3399
212 Ga0373935_0003934 3300035692 Bacteria 8676
213 Ga0373935_0062189 3300035692 Bacteria 2391
214 Ga0373935_0133331 3300035692 Bacteria 1671
215 Ga0373927_0030750 3300035695 Bacteria 3502
216 Ga0373933_0021017 3300035724 Bacteria 3703
217 Ga0373933_0110607 3300035724 Bacteria 1713
218 Ga0373933_0140723 3300035724 Bacteria 1523
219 Ga0373947_0000507 3300035725 Bacteria 22617
220 Ga0373947_0003862 3300035725 Bacteria 8821
221 Ga0373937_0053362 3300036401 Bacteria 3708
222 Ga0373937_0103162 3300036401 Bacteria 2648
223 Ga0372808_014898 3300036459 Bacteria 1111
224 Ga0373925_0000453 3300037068 Bacteria 41369
225 Ga0373925_0017793 3300037068 Bacteria 5156
226 Ga0373925_0055387 3300037068 Bacteria 2968
227 Ga0373925_0444216 3300037068 Bacteria 1061
228 Ga0395900_0072011 3300037418 Bacteria 3554
229 Ga0395900_0320966 3300037418 Bacteria 1529
230 Ga0395898_0002002 3300037466 Bacteria 25558
231 Ga0395898_0427675 3300037466 Bacteria 1262
232 Ga0436364_0006913 3300037853 Bacteria 1583
233 Ga0436364_0348696 3300037853 Bacteria 2179
234 Ga0436364_0451911 3300037853 Bacteria 3788
235 Ga0436364_0575180 3300037853 Bacteria 2315
236 Ga0395901_0014340 3300038443 Bacteria 8069
237 Ga0395901_0032192 3300038443 Bacteria 5412
238 Ga0395901_0151935 3300038443 Bacteria 2433
239 Ga0436365_0014889 3300039437 Bacteria 1964
240 Ga0436365_0404078 3300039437 Bacteria 1226
241 Ga0439461_0012722 3300041410 Bacteria 1579
242 Ga0439445_0005518 3300042004 Bacteria 2883
243 Ga0439434_0005861 3300042435 Bacteria 3591
244 Ga0466972_0042397 3300044658 Bacteria 2213
245 Ga0466972_0093358 3300044658 Bacteria 1427
246 Ga0466965_0011767 3300044683 Bacteria 4107
247 Ga0466966_0023354 3300044684 Bacteria 4049
248 Ga0466966_0023567 3300044684 Bacteria 4028
249 Ga0466966_0209294 3300044684 Bacteria 1179
250 Ga0466961_0037683 3300044693 Bacteria 3102
251 Ga0466961_0219579 3300044693 Bacteria 1172
252 Ga0466963_0024401 3300044694 Bacteria 3850
253 Ga0466963_0162532 3300044694 Bacteria 1554
254 Ga0466963_0218105 3300044694 Bacteria 1336
255 Ga0466970_0055511 3300044765 Bacteria 2115
256 Ga0466970_0143645 3300044765 Bacteria 1315
257 Ga0466957_0036129 3300044842 Bacteria 2968
258 Ga0466960_0001137 3300044901 Bacteria 9554
259 Ga0466960_0008185 3300044901 Bacteria 4274
260 Ga0466960_0020463 3300044901 Bacteria 2931
261 Ga0466960_0115525 3300044901 Bacteria 1400
262 Ga0466959_0213466 3300045049 Bacteria 1340
263 Ga0466958_0261938 3300045836 Bacteria 1107
264 Ga0466967_0128165 3300045976 Bacteria 2353
265 Ga0466967_0169149 3300045976 Bacteria 2055
266 Ga0466967_0531436 3300045976 Bacteria 1156
267 Ga0495592_0104110 3300046454 Bacteria 2018
268 Ga0495603_0017751 3300046455 Bacteria 4307
269 Ga0495629_0000358 3300046459 Bacteria 38859
270 Ga0495638_0001104 3300046460 Bacteria 26279
271 Ga0495641_0002264 3300046461 Bacteria 15342
272 Ga0495651_0018544 3300046462 Bacteria 5390
273 Ga0495653_0007618 3300046463 Bacteria 8852
274 Ga0495653_0018884 3300046463 Bacteria 5592
275 Ga0495653_0037080 3300046463 Bacteria 3834
276 Ga0495653_0132285 3300046463 Bacteria 1764
277 Ga0495580_0049308 3300046472 Bacteria 2979
278 Ga0495582_0070044 3300046473 Bacteria 1939
279 Ga0495639_0001633 3300046475 Bacteria 10000
280 Ga0495662_0000209 3300046476 Bacteria 24432
281 Ga0495664_0001225 3300046477 Bacteria 13427
282 Ga0495664_0142276 3300046477 Bacteria 1454
283 Ga0495594_0032306 3300046499 Bacteria 2840
284 Ga0495608_0031401 3300046511 Bacteria 3592
285 Ga0495608_0033562 3300046511 Bacteria 3467
286 Ga0495608_0064919 3300046511 Bacteria 2391
287 Ga0495618_0010710 3300046514 Bacteria 5552
288 Ga0495618_0062273 3300046514 Bacteria 2367
289 Ga0495628_0033870 3300046516 Bacteria 4113
290 Ga0495628_0082831 3300046516 Bacteria 2491
291 Ga0495630_0003912 3300046517 Bacteria 10413
292 Ga0495630_0013873 3300046517 Bacteria 5860
293 Ga0495666_0048495 3300046526 Bacteria 2045
294 Ga0495652_0014611 3300046529 Bacteria 7039
295 Ga0495652_0046918 3300046529 Bacteria 3707
296 Ga0495665_0026958 3300046531 Bacteria 3085
297 Ga0495665_0034128 3300046531 Bacteria 2721
298 Ga0495640_0034225 3300046533 Bacteria 3604
299 Ga0495640_0059335 3300046533 Bacteria 2606
300 Ga0495640_0065546 3300046533 Bacteria 2452
301 Ga0495586_0002677 3300046535 Bacteria 9633
302 Ga0495587_0017811 3300046536 Bacteria 4406
303 Ga0495645_0003229 3300046543 Bacteria 11060
304 Ga0495645_0059152 3300046543 Bacteria 2779
305 Ga0495645_0077529 3300046543 Bacteria 2389
306 Ga0495667_0001300 3300046559 Bacteria 16364
307 Ga0495667_0001964 3300046559 Bacteria 13617
308 Ga0495667_0026328 3300046559 Bacteria 3919
309 Ga0495667_0206078 3300046559 Bacteria 1257
310 Ga0495634_0028277 3300046642 Bacteria 3893
311 Ga0495634_0098931 3300046642 Bacteria 1886
312 Ga0495635_0003905 3300046663 Bacteria 10363
313 Ga0495635_0007672 3300046663 Bacteria 7529
314 Ga0495635_0014137 3300046663 Bacteria 5586
315 Ga0495635_0027078 3300046663 Bacteria 3988
316 Ga0495635_0234845 3300046663 Bacteria 1238
317 Ga0495588_0018605 3300046674 Bacteria 3390
318 Ga0495657_0002104 3300046675 Bacteria 16917
319 Ga0495657_0041337 3300046675 Bacteria 3155
320 Ga0495657_0085338 3300046675 Bacteria 2035
321 Ga0495657_0141612 3300046675 Bacteria 1498
322 Ga0495599_0007116 3300046678 Bacteria 6773
323 Ga0495599_0110116 3300046678 Bacteria 1716
324 Ga0495623_0024425 3300046679 Bacteria 3895
325 Ga0495623_0073948 3300046679 Bacteria 2118
326 Ga0495623_0184046 3300046679 Bacteria 1211
327 Ga0495646_0029902 3300046680 Bacteria 3402
328 Ga0495646_0067004 3300046680 Bacteria 2123
329 Ga0495647_0005076 3300046681 Bacteria 4309
330 Ga0495658_0012721 3300046683 Bacteria 4270
331 Ga0495613_0023186 3300046689 Bacteria 4624
332 Ga0495624_0044685 3300046690 Bacteria 2823
333 Ga0495600_0002220 3300046809 Bacteria 11045
334 Ga0495600_0015721 3300046809 Bacteria 4791
335 Ga0495600_0053437 3300046809 Bacteria 2638
336 Ga0495581_0019966 3300047315 Bacteria 3891
337 Ga0495581_0021783 3300047315 Bacteria 3713
338 Ga0495604_0009251 3300047317 Bacteria 7799
339 Ga0495604_0043737 3300047317 Bacteria 3505
340 Ga0495674_0024215 3300047319 Bacteria 5582
341 Ga0495674_0050971 3300047319 Bacteria 3650
342 Ga0495674_0052179 3300047319 Bacteria 3600
343 Ga0495674_0327662 3300047319 Bacteria 1246
344 Ga0495676_0009204 3300047321 Bacteria 8998
345 Ga0495676_0077872 3300047321 Bacteria 2526
346 Ga0495680_0006448 3300047322 Bacteria 10901
347 Ga0495680_0010722 3300047322 Bacteria 8168
348 Ga0495680_0017797 3300047322 Bacteria 6050
349 Ga0495680_0059823 3300047322 Bacteria 2939
350 Ga0495675_0016606 3300047444 Bacteria 4657
351 Ga0495675_0060674 3300047444 Bacteria 2397
352 Ga0495684_0001486 3300047471 Bacteria 18770
353 Ga0495684_0046141 3300047471 Bacteria 3333
354 Ga0495684_0072404 3300047471 Bacteria 2618
355 Ga0495593_0001877 3300047673 Bacteria 12515
356 Ga0495602_0011413 3300048088 Bacteria 9187
357 Ga0496100_0001094 3300048903 Bacteria 13092
358 Ga0496100_0035610 3300048903 Bacteria 3132
359 Ga0496101_0006806 3300048904 Bacteria 7374
360 Ga0496101_0246063 3300048904 Bacteria 1392
361 Ga0496102_0028681 3300048905 Bacteria 4973
362 Ga0496102_0174618 3300048905 Bacteria 2023
363 Ga0496102_0249442 3300048905 Bacteria 1673
364 Ga0496103_0157421 3300048906 Bacteria 1456
365 Ga0496103_0206744 3300048906 Bacteria 1262
366 Ga0496104_0004672 3300048907 Bacteria 11918
367 Ga0496104_0026345 3300048907 Bacteria 5367
368 Ga0496104_0296419 3300048907 Bacteria 1530
369 Ga0496104_0345787 3300048907 Bacteria 1400
370 Ga0496105_0109234 3300048908 Bacteria 2283
371 Ga0496106_0003170 3300048909 Bacteria 12290
372 Ga0496106_0060400 3300048909 Bacteria 2873
373 Ga0496107_0010357 3300048910 Bacteria 6478
374 Ga0496107_0031440 3300048910 Bacteria 3788
375 Ga0496107_0358492 3300048910 Bacteria 1085
376 Ga0496108_0032568 3300048911 Bacteria 4330
377 Ga0496108_0058859 3300048911 Bacteria 3230
378 Ga0496108_0073172 3300048911 Bacteria 2894
379 Ga0496109_0011306 3300048912 Bacteria 7667
380 Ga0496109_0073613 3300048912 Bacteria 3139
381 Ga0496109_0148796 3300048912 Bacteria 2192
382 Ga0496109_0180530 3300048912 Bacteria 1982
383 Ga0496109_0229933 3300048912 Bacteria 1744
384 Ga0496109_0335499 3300048912 Bacteria 1427
385 Ga0496110_0016532 3300048913 Bacteria 6160
386 Ga0496110_0106004 3300048913 Bacteria 2522
387 Ga0496110_0523799 3300048913 Bacteria 1078
388 Ga0496111_0010048 3300048914 Bacteria 6332
389 Ga0496112_0053601 3300048915 Bacteria 3962
390 Ga0496112_0177641 3300048915 Bacteria 2093
391 Ga0496112_0309505 3300048915 Bacteria 1525
392 Ga0496112_0462627 3300048915 Bacteria 1206
393 Ga0496112_0485735 3300048915 Bacteria 1171
394 Ga0496113_0155105 3300048916 Bacteria 1808
395 Ga0496113_0184035 3300048916 Bacteria 1656
396 Ga0496113_0203125 3300048916 Bacteria 1575
397 Ga0496114_0002590 3300048917 Bacteria 13806
398 Ga0496114_0148940 3300048917 Bacteria 2030
399 Ga0496114_0156690 3300048917 Bacteria 1978
400 Ga0496115_0018527 3300048918 Bacteria 5348
401 Ga0496119_0001628 3300048922 Bacteria 26512
402 Ga0496120_0045628 3300048923 Bacteria 2538
403 Ga0496126_0143095 3300048929 Bacteria 2056
404 Ga0501032_0023133 3300049569 Bacteria 4301
405 Ga0501034_0045371 3300049571 Bacteria 4441
406 Ga0501036_0003785 3300049572 Bacteria 12126
407 Ga0501036_0082873 3300049572 Bacteria 2710
408 Ga0501037_0008667 3300049573 Bacteria 7458
409 Ga0501037_0048635 3300049573 Bacteria 3106
410 Ga0501038_0057109 3300049574 Bacteria 3351
411 Ga0501038_0067644 3300049574 Bacteria 3038
412 Ga0501039_0005716 3300049575 Bacteria 9421
413 Ga0501039_0077141 3300049575 Bacteria 2591
414 Ga0501040_0210761 3300049576 Bacteria 1381
415 Ga0501042_0010961 3300049578 Bacteria 6103
416 Ga0501046_0006195 3300049580 Bacteria 10621
417 Ga0501047_0031043 3300049581 Bacteria 5152
418 Ga0501047_0039713 3300049581 Bacteria 4551
419 Ga0501047_0202839 3300049581 Bacteria 1843
420 Ga0501048_0005889 3300049582 Bacteria 9330
421 Ga0501048_0039994 3300049582 Bacteria 3361
422 Ga0501067_0052892 3300049583 Bacteria 2250
423 Ga0501070_0000837 3300049586 Bacteria 27932
424 Ga0501070_0085155 3300049586 Bacteria 2617
425 Ga0501073_0044251 3300049589 Bacteria 3138
426 Ga0501074_0022809 3300049590 Bacteria 4551
427 Ga0501044_0005944 3300049823 Bacteria 13510
428 Ga0501044_0049712 3300049823 Bacteria 4328
429 Ga0501044_0084073 3300049823 Bacteria 3216
430 nmdc:mga0a205_327734_c1 3300050515 Bacteria 1401
431 Ga0495601_0005157 3300053077 Bacteria 7593
432 Ga0495595_0054401 3300053084 Bacteria 1861
433 Ga0495619_0003475 3300053085 Bacteria 10169
434 Ga0500556_0000744 3300053104 Bacteria 19502
435 Ga0500593_000340 3300053117 Bacteria 18767
436 Ga0501082_0192906 3300060353 Bacteria 1772
437 Ga0466962_0031924 3300061719 Bacteria 2522
438 Ga0466962_0034712 3300061719 Bacteria 2414

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0219579 Ga0466961_0219579_132_1073 273
2 3300005842 Ga0068858_100032076 Ga0068858_1000320764 293
3 3300005843 Ga0068860_100072149 Ga0068860_1000721492 293
4 3300025972 Ga0207668_10117705 Ga0207668_101177052 293
5 3300026035 Ga0207703_10247165 Ga0207703_102471652 293
6 3300026088 Ga0207641_10144614 Ga0207641_101446142 293
7 3300045836 Ga0466958_0261938 Ga0466958_0261938_134_1063 294
8 3300044765 Ga0466970_0143645 Ga0466970_0143645_70_1071 296
9 3300021388 Ga0213875_10047829 Ga0213875_100478292 297
10 3300037853 Ga0436364_0451911 Ga0436364_0451911_365_1336 297
11 3300039437 Ga0436365_0404078 Ga0436365_0404078_19_999 298
12 3300053104 Ga0500556_0000744 Ga0500556_0000744_5230_6213 298
13 3300005530 Ga0070679_100298255 Ga0070679_1002982551 305
14 3300031251 Ga0265327_10000004 Ga0265327_10000004404 307
15 iso_pu_bacteria 2811994874 2812332456 308
16 iso_pu_bacteria 2928121344 2928122408 308
17 3300005435 Ga0070714_100000010 Ga0070714_100000010160 309
18 3300020082 Ga0206353_10976584 Ga0206353_109765841 309
19 3300025929 Ga0207664_10000009 Ga0207664_10000009117 309
20 3300031616 Ga0307508_10001845 Ga0307508_1000184515 309
21 3300048912 Ga0496109_0073613 Ga0496109_0073613_244_1182 309
22 iso_pu_bacteria 2671180195 2671836036 309
23 iso_pu_bacteria 2773857922 2774854192 309
24 iso_pu_bacteria 2866552031 2866554297 309
25 iso_pu_bacteria 8056060235 8056061964 309
26 iso_pu_bacteria 8056207758 8056212046 309
27 3300048915 Ga0496112_0053601 Ga0496112_0053601_1231_2175 310
28 3300048916 Ga0496113_0184035 Ga0496113_0184035_237_1181 310
29 iso_pu_bacteria 2939660829 2939663562 310
30 iso_pu_bacteria 2956939328 2956940772 310
31 iso_pu_bacteria 3001119090 3001120458 310
32 3300005471 Ga0070698_100063427 Ga0070698_1000634272 311
33 3300005535 Ga0070684_100253539 Ga0070684_1002535392 311
34 3300005618 Ga0068864_100574304 Ga0068864_1005743042 311
35 3300005937 Ga0081455_10023422 Ga0081455_100234222 311
36 3300005983 Ga0081540_1000811 Ga0081540_100081120 311
37 3300006237 Ga0097621_100289311 Ga0097621_1002893112 311
38 3300010159 Ga0099796_10091265 Ga0099796_100912651 311
39 3300013308 Ga0157375_10189369 Ga0157375_101893691 311
40 3300031616 Ga0307508_10054928 Ga0307508_100549283 311
41 3300032126 Ga0307415_100206913 Ga0307415_1002069132 311
42 3300035083 Ga0373926_0008082 Ga0373926_0008082_1752_2720 311
43 3300035089 Ga0373944_0010754 Ga0373944_0010754_662_1630 311
44 3300035111 Ga0373923_0000697 Ga0373923_0000697_2681_3649 311
45 3300035113 Ga0373936_0000748 Ga0373936_0000748_9478_10446 311
46 3300035116 Ga0373945_0017763 Ga0373945_0017763_504_1472 311
47 3300035117 Ga0373953_0011299 Ga0373953_0011299_1717_2685 311
48 3300035120 Ga0373957_0010071 Ga0373957_0010071_608_1576 311
49 3300035170 Ga0373943_0002447 Ga0373943_0002447_5374_6342 311
50 3300035171 Ga0373946_0004987 Ga0373946_0004987_1886_2854 311
51 3300035172 Ga0373955_0100224 Ga0373955_0100224_210_1178 311
52 3300035410 Ga0373924_0010655 Ga0373924_0010655_1517_2485 311
53 3300035725 Ga0373947_0003862 Ga0373947_0003862_827_1795 311
54 3300036401 Ga0373937_0103162 Ga0373937_0103162_1322_2290 311
55 3300037068 Ga0373925_0055387 Ga0373925_0055387_679_1647 311
56 3300044658 Ga0466972_0042397 Ga0466972_0042397_862_1827 311
57 3300044901 Ga0466960_0115525 Ga0466960_0115525_139_1098 311
58 3300046455 Ga0495603_0017751 Ga0495603_0017751_2894_3862 311
59 3300046459 Ga0495629_0000358 Ga0495629_0000358_26304_27272 311
60 3300046461 Ga0495641_0002264 Ga0495641_0002264_6700_7668 311
61 3300046463 Ga0495653_0018884 Ga0495653_0018884_942_1910 311
62 3300046472 Ga0495580_0049308 Ga0495580_0049308_1072_2040 311
63 3300046473 Ga0495582_0070044 Ga0495582_0070044_557_1525 311
64 3300046475 Ga0495639_0001633 Ga0495639_0001633_7341_8309 311
65 3300046476 Ga0495662_0000209 Ga0495662_0000209_21373_22341 311
66 3300046499 Ga0495594_0032306 Ga0495594_0032306_323_1291 311
67 3300046511 Ga0495608_0064919 Ga0495608_0064919_679_1647 311
68 3300046514 Ga0495618_0010710 Ga0495618_0010710_679_1647 311
69 3300046516 Ga0495628_0082831 Ga0495628_0082831_1078_2046 311
70 3300046517 Ga0495630_0003912 Ga0495630_0003912_1966_2934 311
71 3300046526 Ga0495666_0048495 Ga0495666_0048495_929_1897 311
72 3300046531 Ga0495665_0034128 Ga0495665_0034128_762_1730 311
73 3300046533 Ga0495640_0034225 Ga0495640_0034225_992_1960 311
74 3300046535 Ga0495586_0002677 Ga0495586_0002677_6899_7867 311
75 3300046543 Ga0495645_0003229 Ga0495645_0003229_1645_2613 311
76 3300046642 Ga0495634_0098931 Ga0495634_0098931_446_1414 311
77 3300046663 Ga0495635_0027078 Ga0495635_0027078_2080_3048 311
78 3300046663 Ga0495635_0234845 Ga0495635_0234845_146_1090 311
79 3300046674 Ga0495588_0018605 Ga0495588_0018605_1630_2598 311
80 3300046675 Ga0495657_0041337 Ga0495657_0041337_1207_2175 311
81 3300046678 Ga0495599_0110116 Ga0495599_0110116_655_1599 311
82 3300046679 Ga0495623_0184046 Ga0495623_0184046_23_991 311
83 3300046680 Ga0495646_0029902 Ga0495646_0029902_574_1542 311
84 3300046681 Ga0495647_0005076 Ga0495647_0005076_2485_3453 311
85 3300046683 Ga0495658_0012721 Ga0495658_0012721_2682_3650 311
86 3300046689 Ga0495613_0023186 Ga0495613_0023186_1577_2545 311
87 3300046809 Ga0495600_0053437 Ga0495600_0053437_715_1683 311
88 3300047315 Ga0495581_0021783 Ga0495581_0021783_1754_2722 311
89 3300047319 Ga0495674_0050971 Ga0495674_0050971_1361_2329 311
90 3300047319 Ga0495674_0327662 Ga0495674_0327662_42_986 311
91 3300047321 Ga0495676_0009204 Ga0495676_0009204_792_1760 311
92 3300047322 Ga0495680_0010722 Ga0495680_0010722_1861_2829 311
93 3300047444 Ga0495675_0060674 Ga0495675_0060674_13_981 311
94 3300047471 Ga0495684_0072404 Ga0495684_0072404_884_1852 311
95 3300047673 Ga0495593_0001877 Ga0495593_0001877_1898_2866 311
96 3300048910 Ga0496107_0358492 Ga0496107_0358492_64_1008 311
97 3300048913 Ga0496110_0523799 Ga0496110_0523799_37_1005 311
98 3300048917 Ga0496114_0156690 Ga0496114_0156690_18_986 311
99 3300049573 Ga0501037_0048635 Ga0501037_0048635_1448_2413 311
100 3300049581 Ga0501047_0031043 Ga0501047_0031043_4060_5025 311
101 3300049823 Ga0501044_0005944 Ga0501044_0005944_6090_7055 311
102 3300053077 Ga0495601_0005157 Ga0495601_0005157_5947_6915 311
103 3300053085 Ga0495619_0003475 Ga0495619_0003475_1984_2952 311
104 3300053117 Ga0500593_000340 Ga0500593_000340_1229_2167 311
105 iso_pu_bacteria 2643221715 2644638516 311
106 iso_pu_bacteria 2773857762 2774391951 311
107 iso_pu_bacteria 2891968417 2891970175 311
108 iso_pu_bacteria 2902810491 2902812507 311
109 iso_pu_bacteria 2906799679 2906800710 311
110 3300005329 Ga0070683_100491042 Ga0070683_1004910421 312
111 3300006175 Ga0070712_100090517 Ga0070712_1000905171 312
112 3300009093 Ga0105240_10127825 Ga0105240_101278254 312
113 3300021388 Ga0213875_10077576 Ga0213875_100775762 312
114 3300021388 Ga0213875_10123654 Ga0213875_101236542 312
115 3300025898 Ga0207692_10001913 Ga0207692_100019135 312
116 3300025916 Ga0207663_10073110 Ga0207663_100731102 312
117 3300025928 Ga0207700_10274557 Ga0207700_102745571 312
118 3300025929 Ga0207664_10079131 Ga0207664_100791312 312
119 3300025929 Ga0207664_10571693 Ga0207664_105716931 312
120 3300026067 Ga0207678_10051102 Ga0207678_100511024 312
121 3300026142 Ga0207698_10268884 Ga0207698_102688842 312
122 3300030731 Ga0316177_1131317 Ga0316177_11313172 312
123 3300030733 Ga0314311_1007878 Ga0314311_10078786 312
124 3300035692 Ga0373935_0133331 Ga0373935_0133331_128_1099 312
125 3300036459 Ga0372808_014898 Ga0372808_014898_88_1065 312
126 3300037068 Ga0373925_0000453 Ga0373925_0000453_7937_8932 312
127 3300037418 Ga0395900_0072011 Ga0395900_0072011_1077_2015 312
128 3300037418 Ga0395900_0320966 Ga0395900_0320966_271_1209 312
129 3300037466 Ga0395898_0427675 Ga0395898_0427675_43_981 312
130 3300037853 Ga0436364_0575180 Ga0436364_0575180_240_1196 312
131 3300038443 Ga0395901_0151935 Ga0395901_0151935_1288_2226 312
132 3300039437 Ga0436365_0014889 Ga0436365_0014889_911_1885 312
133 3300044683 Ga0466965_0011767 Ga0466965_0011767_134_1072 312
134 3300045976 Ga0466967_0169149 Ga0466967_0169149_833_1807 312
135 3300048929 Ga0496126_0143095 Ga0496126_0143095_824_1795 312
136 3300005327 Ga0070658_10020908 Ga0070658_100209084 313
137 3300005329 Ga0070683_100010881 Ga0070683_1000108813 313
138 3300005329 Ga0070683_100069410 Ga0070683_1000694102 313
139 3300005329 Ga0070683_100207140 Ga0070683_1002071402 313
140 3300005334 Ga0068869_100089687 Ga0068869_1000896872 313
141 3300005336 Ga0070680_100036961 Ga0070680_1000369612 313
142 3300005340 Ga0070689_100032316 Ga0070689_1000323162 313
143 3300005354 Ga0070675_100043831 Ga0070675_1000438312 313
144 3300005356 Ga0070674_100089125 Ga0070674_1000891252 313
145 3300005366 Ga0070659_100123151 Ga0070659_1001231513 313
146 3300005367 Ga0070667_100081497 Ga0070667_1000814972 313
147 3300005435 Ga0070714_100053606 Ga0070714_1000536065 313
148 3300005435 Ga0070714_100080207 Ga0070714_1000802072 313
149 3300005435 Ga0070714_100139625 Ga0070714_1001396252 313
150 3300005436 Ga0070713_100324019 Ga0070713_1003240192 313
151 3300005445 Ga0070708_100023466 Ga0070708_1000234663 313
152 3300005445 Ga0070708_100056934 Ga0070708_1000569345 313
153 3300005455 Ga0070663_100068563 Ga0070663_1000685632 313
154 3300005458 Ga0070681_10007783 Ga0070681_100077839 313
155 3300005467 Ga0070706_100001281 Ga0070706_10000128122 313
156 3300005467 Ga0070706_100019041 Ga0070706_1000190416 313
157 3300005467 Ga0070706_100034807 Ga0070706_1000348073 313
158 3300005468 Ga0070707_100004915 Ga0070707_1000049155 313
159 3300005468 Ga0070707_100005475 Ga0070707_1000054758 313
160 3300005468 Ga0070707_100058457 Ga0070707_1000584572 313
161 3300005518 Ga0070699_100020301 Ga0070699_1000203014 313
162 3300005518 Ga0070699_100208806 Ga0070699_1002088062 313
163 3300005530 Ga0070679_100169588 Ga0070679_1001695882 313
164 3300005530 Ga0070679_100306392 Ga0070679_1003063922 313
165 3300005535 Ga0070684_100065400 Ga0070684_1000654002 313
166 3300005536 Ga0070697_100001798 Ga0070697_10000179812 313
167 3300005545 Ga0070695_100025934 Ga0070695_1000259343 313
168 3300005547 Ga0070693_100068459 Ga0070693_1000684592 313
169 3300005577 Ga0068857_100068079 Ga0068857_1000680794 313
170 3300005577 Ga0068857_100078004 Ga0068857_1000780043 313
171 3300005578 Ga0068854_100030480 Ga0068854_1000304802 313
172 3300005614 Ga0068856_100099094 Ga0068856_1000990943 313
173 3300005614 Ga0068856_100284874 Ga0068856_1002848743 313
174 3300005615 Ga0070702_100025004 Ga0070702_1000250042 313
175 3300005616 Ga0068852_100116462 Ga0068852_1001164622 313
176 3300005841 Ga0068863_100055108 Ga0068863_1000551084 313
177 3300005841 Ga0068863_100310069 Ga0068863_1003100692 313
178 3300005843 Ga0068860_100051910 Ga0068860_1000519103 313
179 3300006028 Ga0070717_10026624 Ga0070717_100266244 313
180 3300006028 Ga0070717_10389090 Ga0070717_103890901 313
181 3300006173 Ga0070716_100109737 Ga0070716_1001097372 313
182 3300006175 Ga0070712_100091390 Ga0070712_1000913902 313
183 3300006175 Ga0070712_100210288 Ga0070712_1002102882 313
184 3300006852 Ga0075433_10085780 Ga0075433_100857802 313
185 3300006914 Ga0075436_100142000 Ga0075436_1001420002 313
186 3300006914 Ga0075436_100237938 Ga0075436_1002379381 313
187 3300007076 Ga0075435_100087265 Ga0075435_1000872652 313
188 3300009011 Ga0105251_10040512 Ga0105251_100405122 313
189 3300009093 Ga0105240_10181446 Ga0105240_101814462 313
190 3300009176 Ga0105242_10129698 Ga0105242_101296982 313
191 3300009551 Ga0105238_10256920 Ga0105238_102569202 313
192 3300010375 Ga0105239_10421032 Ga0105239_104210322 313
193 3300013100 Ga0157373_10051130 Ga0157373_100511302 313
194 3300013104 Ga0157370_10354613 Ga0157370_103546132 313
195 3300013105 Ga0157369_10013074 Ga0157369_100130747 313
196 3300013250 Ga0171462_1003 Ga0171462_1003776 313
197 3300013308 Ga0157375_10059379 Ga0157375_100593791 313
198 3300020082 Ga0206353_11457846 Ga0206353_114578462 313
199 3300021388 Ga0213875_10046588 Ga0213875_100465884 313
200 3300024225 Ga0224572_1005517 Ga0224572_10055172 313
201 3300025901 Ga0207688_10017076 Ga0207688_100170762 313
202 3300025905 Ga0207685_10008790 Ga0207685_100087902 313
203 3300025906 Ga0207699_10004178 Ga0207699_100041788 313
204 3300025906 Ga0207699_10037571 Ga0207699_100375712 313
205 3300025909 Ga0207705_10046568 Ga0207705_100465684 313
206 3300025910 Ga0207684_10001352 Ga0207684_100013525 313
207 3300025910 Ga0207684_10034667 Ga0207684_100346673 313
208 3300025910 Ga0207684_10167421 Ga0207684_101674212 313
209 3300025910 Ga0207684_10217022 Ga0207684_102170222 313
210 3300025912 Ga0207707_10016808 Ga0207707_100168082 313
211 3300025915 Ga0207693_10059820 Ga0207693_100598202 313
212 3300025916 Ga0207663_10051739 Ga0207663_100517391 313
213 3300025917 Ga0207660_10034352 Ga0207660_100343522 313
214 3300025919 Ga0207657_10027507 Ga0207657_100275074 313
215 3300025921 Ga0207652_10073490 Ga0207652_100734903 313
216 3300025922 Ga0207646_10003507 Ga0207646_100035075 313
217 3300025922 Ga0207646_10019025 Ga0207646_100190259 313
218 3300025922 Ga0207646_10021654 Ga0207646_100216545 313
219 3300025922 Ga0207646_10044116 Ga0207646_100441163 313
220 3300025922 Ga0207646_10202492 Ga0207646_102024922 313
221 3300025923 Ga0207681_10158420 Ga0207681_101584202 313
222 3300025926 Ga0207659_10077033 Ga0207659_100770332 313
223 3300025928 Ga0207700_10122806 Ga0207700_101228062 313
224 3300025929 Ga0207664_10058197 Ga0207664_100581972 313
225 3300025929 Ga0207664_10069239 Ga0207664_100692393 313
226 3300025932 Ga0207690_10100670 Ga0207690_101006702 313
227 3300025933 Ga0207706_10030200 Ga0207706_100302004 313
228 3300025937 Ga0207669_10109131 Ga0207669_101091312 313
229 3300025940 Ga0207691_10035018 Ga0207691_100350184 313
230 3300025942 Ga0207689_10015701 Ga0207689_100157014 313
231 3300025944 Ga0207661_10186458 Ga0207661_101864582 313
232 3300025945 Ga0207679_10134132 Ga0207679_101341322 313
233 3300025960 Ga0207651_10096432 Ga0207651_100964322 313
234 3300025972 Ga0207668_10075934 Ga0207668_100759342 313
235 3300025981 Ga0207640_10021267 Ga0207640_100212672 313
236 3300025986 Ga0207658_10488652 Ga0207658_104886522 313
237 3300026035 Ga0207703_10159339 Ga0207703_101593392 313
238 3300026067 Ga0207678_10013185 Ga0207678_100131857 313
239 3300026078 Ga0207702_10054526 Ga0207702_100545261 313
240 3300026088 Ga0207641_10134176 Ga0207641_101341762 313
241 3300026116 Ga0207674_10017027 Ga0207674_100170275 313
242 3300026116 Ga0207674_10040250 Ga0207674_100402504 313
243 3300026118 Ga0207675_100036033 Ga0207675_1000360333 313
244 3300026121 Ga0207683_10021818 Ga0207683_100218183 313
245 3300028379 Ga0268266_10146590 Ga0268266_101465903 313
246 3300028666 Ga0265336_10044594 Ga0265336_100445942 313
247 3300028800 Ga0265338_10001991 Ga0265338_1000199126 313
248 3300031730 Ga0307516_10008417 Ga0307516_100084179 313
249 3300031852 Ga0307410_10006480 Ga0307410_100064804 313
250 3300032126 Ga0307415_100309777 Ga0307415_1003097772 313
251 3300034818 Ga0373950_0011247 Ga0373950_0011247_187_1164 313
252 3300034820 Ga0373959_0020525 Ga0373959_0020525_159_1142 313
253 3300035086 Ga0373934_0009272 Ga0373934_0009272_1653_2636 313
254 3300035088 Ga0373940_0037717 Ga0373940_0037717_319_1296 313
255 3300035092 Ga0373952_0010051 Ga0373952_0010051_321_1298 313
256 3300035113 Ga0373936_0000816 Ga0373936_0000816_3314_4291 313
257 3300035113 Ga0373936_0018788 Ga0373936_0018788_97_1080 313
258 3300035116 Ga0373945_0002765 Ga0373945_0002765_1012_1989 313
259 3300035117 Ga0373953_0046531 Ga0373953_0046531_25_1008 313
260 3300035118 Ga0373954_0163933 Ga0373954_0163933_38_1060 313
261 3300035170 Ga0373943_0025259 Ga0373943_0025259_760_1737 313
262 3300035171 Ga0373946_0009936 Ga0373946_0009936_1289_2266 313
263 3300035172 Ga0373955_0109286 Ga0373955_0109286_554_1528 313
264 3300035207 Ga0373942_0021968 Ga0373942_0021968_234_1211 313
265 3300035692 Ga0373935_0003934 Ga0373935_0003934_1022_1999 313
266 3300035692 Ga0373935_0062189 Ga0373935_0062189_695_1678 313
267 3300035695 Ga0373927_0030750 Ga0373927_0030750_474_1451 313
268 3300035724 Ga0373933_0021017 Ga0373933_0021017_2418_3392 313
269 3300035724 Ga0373933_0110607 Ga0373933_0110607_382_1365 313
270 3300035724 Ga0373933_0140723 Ga0373933_0140723_357_1334 313
271 3300035725 Ga0373947_0000507 Ga0373947_0000507_19298_20275 313
272 3300036401 Ga0373937_0053362 Ga0373937_0053362_2275_3249 313
273 3300037068 Ga0373925_0017793 Ga0373925_0017793_2852_3826 313
274 3300037068 Ga0373925_0444216 Ga0373925_0444216_20_994 313
275 3300037466 Ga0395898_0002002 Ga0395898_0002002_6092_7081 313
276 3300037853 Ga0436364_0348696 Ga0436364_0348696_883_1878 313
277 3300038443 Ga0395901_0014340 Ga0395901_0014340_2310_3299 313
278 3300041410 Ga0439461_0012722 Ga0439461_0012722_220_1167 313
279 3300042004 Ga0439445_0005518 Ga0439445_0005518_1618_2565 313
280 3300042435 Ga0439434_0005861 Ga0439434_0005861_1860_2807 313
281 3300044658 Ga0466972_0093358 Ga0466972_0093358_180_1130 313
282 3300044684 Ga0466966_0023567 Ga0466966_0023567_1208_2185 313
283 3300044684 Ga0466966_0209294 Ga0466966_0209294_137_1114 313
284 3300044693 Ga0466961_0037683 Ga0466961_0037683_1006_1983 313
285 3300044694 Ga0466963_0024401 Ga0466963_0024401_1690_2685 313
286 3300044694 Ga0466963_0218105 Ga0466963_0218105_139_1116 313
287 3300044765 Ga0466970_0055511 Ga0466970_0055511_1033_2010 313
288 3300044842 Ga0466957_0036129 Ga0466957_0036129_1917_2894 313
289 3300044901 Ga0466960_0020463 Ga0466960_0020463_213_1190 313
290 3300045049 Ga0466959_0213466 Ga0466959_0213466_18_995 313
291 3300045976 Ga0466967_0128165 Ga0466967_0128165_820_1797 313
292 3300045976 Ga0466967_0531436 Ga0466967_0531436_128_1111 313
293 3300046454 Ga0495592_0104110 Ga0495592_0104110_916_1899 313
294 3300046462 Ga0495651_0018544 Ga0495651_0018544_2273_3247 313
295 3300046463 Ga0495653_0007618 Ga0495653_0007618_2018_2992 313
296 3300046463 Ga0495653_0037080 Ga0495653_0037080_2413_3390 313
297 3300046463 Ga0495653_0132285 Ga0495653_0132285_200_1177 313
298 3300046477 Ga0495664_0001225 Ga0495664_0001225_481_1458 313
299 3300046477 Ga0495664_0142276 Ga0495664_0142276_280_1257 313
300 3300046511 Ga0495608_0031401 Ga0495608_0031401_2339_3313 313
301 3300046511 Ga0495608_0033562 Ga0495608_0033562_1362_2345 313
302 3300046514 Ga0495618_0062273 Ga0495618_0062273_1378_2352 313
303 3300046516 Ga0495628_0033870 Ga0495628_0033870_1408_2382 313
304 3300046517 Ga0495630_0013873 Ga0495630_0013873_2843_3820 313
305 3300046529 Ga0495652_0014611 Ga0495652_0014611_965_1942 313
306 3300046529 Ga0495652_0046918 Ga0495652_0046918_1300_2274 313
307 3300046531 Ga0495665_0026958 Ga0495665_0026958_1178_2155 313
308 3300046533 Ga0495640_0059335 Ga0495640_0059335_409_1383 313
309 3300046533 Ga0495640_0065546 Ga0495640_0065546_797_1774 313
310 3300046536 Ga0495587_0017811 Ga0495587_0017811_1292_2266 313
311 3300046543 Ga0495645_0059152 Ga0495645_0059152_1500_2474 313
312 3300046543 Ga0495645_0077529 Ga0495645_0077529_765_1742 313
313 3300046559 Ga0495667_0001300 Ga0495667_0001300_14119_15093 313
314 3300046559 Ga0495667_0001964 Ga0495667_0001964_11957_12934 313
315 3300046559 Ga0495667_0026328 Ga0495667_0026328_785_1768 313
316 3300046559 Ga0495667_0206078 Ga0495667_0206078_25_1002 313
317 3300046642 Ga0495634_0028277 Ga0495634_0028277_782_1759 313
318 3300046663 Ga0495635_0003905 Ga0495635_0003905_3671_4648 313
319 3300046663 Ga0495635_0007672 Ga0495635_0007672_3986_4960 313
320 3300046663 Ga0495635_0014137 Ga0495635_0014137_3489_4472 313
321 3300046675 Ga0495657_0002104 Ga0495657_0002104_10725_11699 313
322 3300046675 Ga0495657_0085338 Ga0495657_0085338_110_1093 313
323 3300046675 Ga0495657_0141612 Ga0495657_0141612_71_1048 313
324 3300046678 Ga0495599_0007116 Ga0495599_0007116_3537_4511 313
325 3300046679 Ga0495623_0024425 Ga0495623_0024425_2422_3405 313
326 3300046679 Ga0495623_0073948 Ga0495623_0073948_353_1327 313
327 3300046680 Ga0495646_0067004 Ga0495646_0067004_657_1643 313
328 3300046690 Ga0495624_0044685 Ga0495624_0044685_632_1609 313
329 3300046809 Ga0495600_0002220 Ga0495600_0002220_2494_3468 313
330 3300046809 Ga0495600_0015721 Ga0495600_0015721_670_1653 313
331 3300047315 Ga0495581_0019966 Ga0495581_0019966_2246_3223 313
332 3300047317 Ga0495604_0009251 Ga0495604_0009251_4157_5131 313
333 3300047317 Ga0495604_0043737 Ga0495604_0043737_2387_3370 313
334 3300047319 Ga0495674_0024215 Ga0495674_0024215_573_1550 313
335 3300047319 Ga0495674_0052179 Ga0495674_0052179_2011_2985 313
336 3300047321 Ga0495676_0077872 Ga0495676_0077872_771_1748 313
337 3300047322 Ga0495680_0006448 Ga0495680_0006448_9570_10553 313
338 3300047322 Ga0495680_0017797 Ga0495680_0017797_645_1622 313
339 3300047322 Ga0495680_0059823 Ga0495680_0059823_67_1044 313
340 3300047444 Ga0495675_0016606 Ga0495675_0016606_2254_3228 313
341 3300047471 Ga0495684_0001486 Ga0495684_0001486_11850_12827 313
342 3300047471 Ga0495684_0046141 Ga0495684_0046141_1367_2341 313
343 3300048088 Ga0495602_0011413 Ga0495602_0011413_4558_5532 313
344 3300048905 Ga0496102_0249442 Ga0496102_0249442_440_1417 313
345 3300048906 Ga0496103_0206744 Ga0496103_0206744_97_1074 313
346 3300048907 Ga0496104_0026345 Ga0496104_0026345_1758_2735 313
347 3300048911 Ga0496108_0073172 Ga0496108_0073172_1133_2128 313
348 3300048912 Ga0496109_0011306 Ga0496109_0011306_1248_2219 313
349 3300048912 Ga0496109_0148796 Ga0496109_0148796_410_1405 313
350 3300048915 Ga0496112_0177641 Ga0496112_0177641_367_1344 313
351 3300048916 Ga0496113_0155105 Ga0496113_0155105_289_1284 313
352 3300048922 Ga0496119_0001628 Ga0496119_0001628_24009_24971 313
353 3300049569 Ga0501032_0023133 Ga0501032_0023133_3025_3981 313
354 3300049571 Ga0501034_0045371 Ga0501034_0045371_2172_3128 313
355 3300049572 Ga0501036_0003785 Ga0501036_0003785_9968_10993 313
356 3300049572 Ga0501036_0082873 Ga0501036_0082873_428_1384 313
357 3300049573 Ga0501037_0008667 Ga0501037_0008667_1565_2521 313
358 3300049574 Ga0501038_0057109 Ga0501038_0057109_73_1098 313
359 3300049574 Ga0501038_0067644 Ga0501038_0067644_1367_2323 313
360 3300049575 Ga0501039_0005716 Ga0501039_0005716_6820_7776 313
361 3300049575 Ga0501039_0077141 Ga0501039_0077141_13_993 313
362 3300049576 Ga0501040_0210761 Ga0501040_0210761_301_1272 313
363 3300049578 Ga0501042_0010961 Ga0501042_0010961_2839_3864 313
364 3300049580 Ga0501046_0006195 Ga0501046_0006195_9022_9978 313
365 3300049581 Ga0501047_0039713 Ga0501047_0039713_3486_4442 313
366 3300049581 Ga0501047_0202839 Ga0501047_0202839_308_1333 313
367 3300049582 Ga0501048_0005889 Ga0501048_0005889_697_1653 313
368 3300049582 Ga0501048_0039994 Ga0501048_0039994_2132_3157 313
369 3300049586 Ga0501070_0000837 Ga0501070_0000837_14644_15606 313
370 3300049586 Ga0501070_0085155 Ga0501070_0085155_481_1437 313
371 3300049589 Ga0501073_0044251 Ga0501073_0044251_1344_2369 313
372 3300049590 Ga0501074_0022809 Ga0501074_0022809_2357_3382 313
373 3300049823 Ga0501044_0049712 Ga0501044_0049712_1605_2630 313
374 3300049823 Ga0501044_0084073 Ga0501044_0084073_321_1277 313
375 3300050515 nmdc:mga0a205_327734_c1 nmdc:mga0a205_327734_c1_284_1261 313
376 3300053084 Ga0495595_0054401 Ga0495595_0054401_659_1633 313
377 3300060353 Ga0501082_0192906 Ga0501082_0192906_257_1213 313
378 3300061719 Ga0466962_0031924 Ga0466962_0031924_25_1005 313
379 3300061719 Ga0466962_0034712 Ga0466962_0034712_1339_2316 313
380 iso_pu_bacteria 2643221635 2644198867 313
381 iso_pu_bacteria 2784132109 2784473302 313
382 iso_pu_bacteria 2808606447 2809228134 313
383 iso_pu_bacteria 2852632344 2852634842 313
384 iso_pu_bacteria 2857737099 2857738871 313
385 iso_pu_bacteria 2902792274 2902796912 313
386 iso_pu_bacteria 2935409751 2935411864 313
387 iso_pu_bacteria 2939582691 2939588222 313
388 3300044901 Ga0466960_0008185 Ga0466960_0008185_2357_3322 314
389 3300003752 Ga0055539_1000014 Ga0055539_1000014305 315
390 3300003756 Ga0055533_1000002 Ga0055533_10000021092 315
391 3300003759 Ga0055525_1000094 Ga0055525_100009451 315
392 3300003760 Ga0055527_1000003 Ga0055527_1000003398 315
393 3300003762 Ga0055542_1000005 Ga0055542_1000005262 315
394 3300003841 Ga0055541_1002687 Ga0055541_10026872 315
395 3300005329 Ga0070683_100187516 Ga0070683_1001875162 315
396 3300005329 Ga0070683_100351424 Ga0070683_1003514242 315
397 3300005337 Ga0070682_100170523 Ga0070682_1001705231 315
398 3300005456 Ga0070678_100077995 Ga0070678_1000779952 315
399 3300005535 Ga0070684_100245001 Ga0070684_1002450012 315
400 3300006871 Ga0075434_100275664 Ga0075434_1002756642 315
401 3300009098 Ga0105245_10074201 Ga0105245_100742013 315
402 3300009177 Ga0105248_10018224 Ga0105248_100182246 315
403 3300011119 Ga0105246_10062748 Ga0105246_100627482 315
404 3300013307 Ga0157372_10000024 Ga0157372_10000024148 315
405 3300020082 Ga0206353_10017933 Ga0206353_100179332 315
406 3300025225 Ga0209566_100094 Ga0209566_10009480 315
407 3300025226 Ga0209674_100001 Ga0209674_1000012476 315
408 3300025228 Ga0209672_100003 Ga0209672_1000031236 315
409 3300025229 Ga0209147_100863 Ga0209147_10086310 315
410 3300025230 Ga0209563_100001 Ga0209563_1000012476 315
411 3300025242 Ga0209258_100989 Ga0209258_10098914 315
412 3300025253 Ga0209677_100001 Ga0209677_1000012476 315
413 3300025254 Ga0209148_1000004 Ga0209148_10000041531 315
414 3300025272 Ga0209455_1000091 Ga0209455_1000091202 315
415 3300025934 Ga0207686_10273850 Ga0207686_102738502 315
416 3300025937 Ga0207669_10011165 Ga0207669_100111652 315
417 3300025941 Ga0207711_10074580 Ga0207711_100745803 315
418 3300025944 Ga0207661_10182581 Ga0207661_101825811 315
419 3300026067 Ga0207678_10294845 Ga0207678_102948452 315
420 3300026088 Ga0207641_10028278 Ga0207641_100282784 315
421 3300026121 Ga0207683_10100484 Ga0207683_101004842 315
422 3300031901 Ga0307406_10091021 Ga0307406_100910212 315
423 3300035118 Ga0373954_0135553 Ga0373954_0135553_76_1050 315
424 3300037853 Ga0436364_0006913 Ga0436364_0006913_348_1454 315
425 3300038443 Ga0395901_0032192 Ga0395901_0032192_1967_3001 315
426 3300044684 Ga0466966_0023354 Ga0466966_0023354_1854_2858 315
427 3300044694 Ga0466963_0162532 Ga0466963_0162532_501_1523 315
428 3300044901 Ga0466960_0001137 Ga0466960_0001137_2367_3353 315
429 3300046460 Ga0495638_0001104 Ga0495638_0001104_22420_23379 315
430 3300048903 Ga0496100_0001094 Ga0496100_0001094_8541_9533 315
431 3300048903 Ga0496100_0035610 Ga0496100_0035610_498_1460 315
432 3300048904 Ga0496101_0006806 Ga0496101_0006806_3989_4981 315
433 3300048904 Ga0496101_0246063 Ga0496101_0246063_74_1090 315
434 3300048905 Ga0496102_0028681 Ga0496102_0028681_492_1508 315
435 3300048905 Ga0496102_0174618 Ga0496102_0174618_655_1632 315
436 3300048906 Ga0496103_0157421 Ga0496103_0157421_92_1108 315
437 3300048907 Ga0496104_0004672 Ga0496104_0004672_6096_7088 315
438 3300048907 Ga0496104_0296419 Ga0496104_0296419_334_1293 315
439 3300048907 Ga0496104_0345787 Ga0496104_0345787_312_1328 315
440 3300048908 Ga0496105_0109234 Ga0496105_0109234_1191_2153 315
441 3300048909 Ga0496106_0003170 Ga0496106_0003170_9391_10383 315
442 3300048909 Ga0496106_0060400 Ga0496106_0060400_359_1375 315
443 3300048910 Ga0496107_0010357 Ga0496107_0010357_3195_4157 315
444 3300048910 Ga0496107_0031440 Ga0496107_0031440_687_1679 315
445 3300048911 Ga0496108_0032568 Ga0496108_0032568_1688_2665 315
446 3300048911 Ga0496108_0058859 Ga0496108_0058859_1019_2035 315
447 3300048912 Ga0496109_0180530 Ga0496109_0180530_578_1555 315
448 3300048912 Ga0496109_0229933 Ga0496109_0229933_282_1298 315
449 3300048912 Ga0496109_0335499 Ga0496109_0335499_13_975 315
450 3300048913 Ga0496110_0016532 Ga0496110_0016532_2506_3522 315
451 3300048913 Ga0496110_0106004 Ga0496110_0106004_1521_2483 315
452 3300048914 Ga0496111_0010048 Ga0496111_0010048_3296_4312 315
453 3300048915 Ga0496112_0309505 Ga0496112_0309505_253_1266 315
454 3300048915 Ga0496112_0462627 Ga0496112_0462627_93_1109 315
455 3300048915 Ga0496112_0485735 Ga0496112_0485735_181_1143 315
456 3300048916 Ga0496113_0203125 Ga0496113_0203125_431_1447 315
457 3300048917 Ga0496114_0002590 Ga0496114_0002590_3658_4650 315
458 3300048917 Ga0496114_0148940 Ga0496114_0148940_285_1262 315
459 3300048918 Ga0496115_0018527 Ga0496115_0018527_1525_2517 315
460 3300048923 Ga0496120_0045628 Ga0496120_0045628_243_1205 315
461 3300049583 Ga0501067_0052892 Ga0501067_0052892_740_1756 315
462 iso_pu_bacteria 2643221567 2643852025 315
463 iso_pu_bacteria 2643221624 2644136542 315
464 iso_pu_bacteria 2643221687 2644490098 315
465 iso_pu_bacteria 2739367653 2739603817 315
466 iso_pu_bacteria 2816332305 2817510063 315
467 iso_pu_bacteria 2857727296 2857727875 315
468 iso_pu_bacteria 2920879853 2920879917 315
469 iso_pu_bacteria 8045830549 8045830805 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

54

312

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nip-assembly1.cif.gz_D crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane 0.9249 5 308
1gq6-assembly1.cif.gz_C-2 proclavaminate amidino hydrolase from streptomyces clavuligerus 0.9196 11 308
1gq6-assembly1.cif.gz_A-2 proclavaminate amidino hydrolase from streptomyces clavuligerus 0.9182 11 308
1gq6-assembly1.cif.gz_B proclavaminate amidino hydrolase from streptomyces clavuligerus 0.913 11 308
3nio-assembly1.cif.gz_D crystal structure of pseudomonas aeruginosa guanidinobutyrase 0.9097 5 306
ID Description Score Start End Superfamily
3niqB00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9259 1 308 3.40.800.10
1gq7A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9156 11 308 3.40.800.10
af_A0A1D8PPP3_13_348_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.915 13 313 3.40.800.10
af_Q10088_33_382_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9107 12 310 3.40.800.10
3niqB00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9091 1 308 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A7I9VV76-F1-model_v4 Agmatinase 0.9559 2 169 GO:0008783
GO:0033389
GO:0046872
AF-A0A401QBJ2-F1-model_v4 Agmatinase 0.9551 53 200 GO:0008783
GO:0033389
GO:0046872
AF-T1B9P0-F1-model_v4 Agmatinase 0.9538 49 203 GO:0008783
GO:0033389
GO:0046872
AF-A0A543NI98-F1-model_v4 Agmatinase 0.9502 2 311 GO:0008783
GO:0033389
GO:0046872
AF-A0A553ZNV9-F1-model_v4 Agmatinase (EC 3.5.3.11) 0.9501 2 308 GO:0008783
GO:0033389
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.3 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map