F450261

General Info

Members Datasets Scaffolds Average Seq Length
469 281 469 218

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10073810|Ga0265340_100738102
Length 241
Sequence MAAARAPVHGVRPHSARIALQSKHMAARSEGELERRVPRLYVVTPPVAETAAIARDLAAMVEVVDIAAVLVRLAADAENTLTKRIKALAPVVQKNGAALLLDGHADLVGRSGADGAHLTGIEAFQAALPSLKPGHIAGAGGLHTRHDAMSLAEAGADYVMFGEPDENGRRPPFEAVVDRVAWWAEVFEIPCIGFAGDLDEVAALAAAGADFVAVGDFLFADPAGPVAATLAAGRQLLREPA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 9.38
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10067541 3300003373 Bacteria 894
2 Ga0070683_100043346 3300005329 Bacteria 4147
3 Ga0070677_10032918 3300005333 Bacteria 1992
4 Ga0070666_10012708 3300005335 Bacteria 5320
5 Ga0070682_100031909 3300005337 Bacteria 3190
6 Ga0068868_100384921 3300005338 Bacteria 1207
7 Ga0070689_100104694 3300005340 Bacteria 2244
8 Ga0070689_100138683 3300005340 Bacteria 1954
9 Ga0070687_100050425 3300005343 Bacteria 2149
10 Ga0070687_100154695 3300005343 Bacteria 1350
11 Ga0070692_10083249 3300005345 Bacteria 1727
12 Ga0070668_100204843 3300005347 Bacteria 1621
13 Ga0070669_100128349 3300005353 Bacteria 1942
14 Ga0070669_100168587 3300005353 Bacteria 1706
15 Ga0070675_100049613 3300005354 Bacteria 3445
16 Ga0070675_100117140 3300005354 Unclassified 2260
17 Ga0070671_100002377 3300005355 Bacteria 14535
18 Ga0070671_100045440 3300005355 Bacteria 3651
19 Ga0070674_100030021 3300005356 Bacteria 3589
20 Ga0070674_100097664 3300005356 Bacteria 2133
21 Ga0070674_100728606 3300005356 Bacteria 850
22 Ga0070673_100037560 3300005364 Bacteria 3691
23 Ga0070659_100224432 3300005366 Bacteria 1552
24 Ga0070659_100250290 3300005366 Bacteria 1468
25 Ga0070667_100386638 3300005367 Bacteria 1272
26 Ga0070709_10086152 3300005434 Bacteria 2061
27 Ga0070714_100002527 3300005435 Bacteria 13488
28 Ga0070714_100083584 3300005435 Bacteria 2784
29 Ga0070713_100104553 3300005436 Bacteria 2458
30 Ga0070713_100326874 3300005436 Bacteria 1417
31 Ga0070713_100888393 3300005436 Bacteria 857
32 Ga0070710_10215718 3300005437 Bacteria 1218
33 Ga0070701_10036803 3300005438 Bacteria 2468
34 Ga0070711_100032546 3300005439 Bacteria 3467
35 Ga0070711_100046325 3300005439 Bacteria 2962
36 Ga0070705_100108027 3300005440 Bacteria 1771
37 Ga0070700_100006656 3300005441 Bacteria 6189
38 Ga0070662_100177540 3300005457 Bacteria 1677
39 Ga0070685_10040876 3300005466 Bacteria 2640
40 Ga0070685_10081114 3300005466 Bacteria 1945
41 Ga0070706_100301741 3300005467 Bacteria 1494
42 Ga0070699_100007777 3300005518 Bacteria 9318
43 Ga0070679_100018641 3300005530 Bacteria 6737
44 Ga0070679_100068290 3300005530 Bacteria 3546
45 Ga0070684_100057364 3300005535 Bacteria 3400
46 Ga0068853_100084489 3300005539 Bacteria 2781
47 Ga0070672_100093553 3300005543 Bacteria 2428
48 Ga0070686_100032754 3300005544 Bacteria 3189
49 Ga0070665_100079291 3300005548 Bacteria 3290
50 Ga0070665_100410781 3300005548 Bacteria 1362
51 Ga0070704_100131566 3300005549 Bacteria 1940
52 Ga0070664_100126117 3300005564 Bacteria 2246
53 Ga0070664_100506810 3300005564 Bacteria 1113
54 Ga0068854_100012183 3300005578 Bacteria 5627
55 Ga0070702_100021434 3300005615 Bacteria 3399
56 Ga0068852_100049572 3300005616 Bacteria 3593
57 Ga0068864_100013016 3300005618 Bacteria 6887
58 Ga0068866_10094112 3300005718 Bacteria 1638
59 Ga0068861_100062527 3300005719 Bacteria 2860
60 Ga0068863_100605889 3300005841 Bacteria 1084
61 Ga0068858_100042796 3300005842 Bacteria 4199
62 Ga0068860_100025673 3300005843 Bacteria 5682
63 Ga0068862_100004735 3300005844 Bacteria 11453
64 Ga0068862_100730410 3300005844 Unclassified 962
65 Ga0081455_10000969 3300005937 Bacteria 36631
66 Ga0081455_10014752 3300005937 Bacteria 7626
67 Ga0081455_10115540 3300005937 Bacteria 2124
68 Ga0081538_10005460 3300005981 Bacteria 11418
69 Ga0081540_1007455 3300005983 Bacteria 7790
70 Ga0081540_1027658 3300005983 Bacteria 3207
71 Ga0081539_10000798 3300005985 Bacteria 61226
72 Ga0070717_10004121 3300006028 Bacteria 10478
73 Ga0070717_10047982 3300006028 Bacteria 3501
74 Ga0070717_10121303 3300006028 Bacteria 2240
75 Ga0075365_10171351 3300006038 Bacteria 1515
76 Ga0075363_100001280 3300006048 Bacteria 9353
77 Ga0075364_10026981 3300006051 Bacteria 3666
78 Ga0070715_10116337 3300006163 Bacteria 1268
79 Ga0070715_10124009 3300006163 Bacteria 1235
80 Ga0070716_100016684 3300006173 Bacteria 3795
81 Ga0075362_10003194 3300006177 Bacteria 5675
82 Ga0075366_10000720 3300006195 Bacteria 15704
83 Ga0097621_100063026 3300006237 Bacteria 3045
84 Ga0075370_10188191 3300006353 Bacteria 1216
85 Ga0068871_100068389 3300006358 Bacteria 2916
86 Ga0068871_100343764 3300006358 Bacteria 1318
87 Ga0075428_100007488 3300006844 Bacteria 12097
88 Ga0075428_100138340 3300006844 Bacteria 2647
89 Ga0075428_100467980 3300006844 Bacteria 1349
90 Ga0075430_100000194 3300006846 Bacteria 41024
91 Ga0075430_100010104 3300006846 Bacteria 7987
92 Ga0075430_100026706 3300006846 Bacteria 4911
93 Ga0075431_100001907 3300006847 Bacteria 19804
94 Ga0075431_100110331 3300006847 Bacteria 2839
95 Ga0075431_100256244 3300006847 Bacteria 1777
96 Ga0075434_100123780 3300006871 Bacteria 2602
97 Ga0075434_100429277 3300006871 Bacteria 1343
98 Ga0075434_100445350 3300006871 Bacteria 1316
99 Ga0075434_100551023 3300006871 Bacteria 1173
100 Ga0075429_100030650 3300006880 Bacteria 4672
101 Ga0075429_100163345 3300006880 Bacteria 1950
102 Ga0068865_100011559 3300006881 Bacteria 5530
103 Ga0068865_100280726 3300006881 Bacteria 1326
104 Ga0075436_100152634 3300006914 Bacteria 1626
105 Ga0075435_100111051 3300007076 Bacteria 2280
106 Ga0075435_100124600 3300007076 Bacteria 2153
107 Ga0099794_10014324 3300007265 Bacteria 3472
108 Ga0099795_10001280 3300007788 Bacteria 5346
109 Ga0111539_10000178 3300009094 Bacteria 73928
110 Ga0111539_10133722 3300009094 Bacteria 2904
111 Ga0111539_10434225 3300009094 Bacteria 1529
112 Ga0105247_10081702 3300009101 Bacteria 2038
113 Ga0105247_10092268 3300009101 Bacteria 1924
114 Ga0114129_10001129 3300009147 Bacteria 35251
115 Ga0114129_10001774 3300009147 Bacteria 29378
116 Ga0114129_10068331 3300009147 Bacteria 4955
117 Ga0114129_10492896 3300009147 Bacteria 1601
118 Ga0114129_10758078 3300009147 Bacteria 1242
119 Ga0105243_10042009 3300009148 Bacteria 3577
120 Ga0105243_10567492 3300009148 Bacteria 1087
121 Ga0105241_10177274 3300009174 Bacteria 1765
122 Ga0105248_10144056 3300009177 Bacteria 2688
123 Ga0105248_10563038 3300009177 Bacteria 1286
124 Ga0105238_10204664 3300009551 Bacteria 1950
125 Ga0099796_10097177 3300010159 Unclassified 1103
126 Ga0105239_10501408 3300010375 Bacteria 1380
127 Ga0105246_10562080 3300011119 Bacteria 979
128 Ga0163162_10257558 3300013306 Bacteria 1876
129 Ga0157375_11526740 3300013308 Bacteria 789
130 Ga0163163_10195606 3300014325 Bacteria 2070
131 Ga0163163_10415731 3300014325 Bacteria 1403
132 Ga0157380_10117060 3300014326 Bacteria 2250
133 Ga0157376_10058867 3300014969 Bacteria 3220
134 Ga0163161_10107964 3300017792 Bacteria 2078
135 Ga0213871_10020418 3300021441 Bacteria 1641
136 Ga0228598_1059009 3300024227 Bacteria 763
137 Ga0207682_10000232 3300025893 Bacteria 25140
138 Ga0207692_10021667 3300025898 Bacteria 2943
139 Ga0207692_10067602 3300025898 Bacteria 1872
140 Ga0207710_10035428 3300025900 Bacteria 2196
141 Ga0207688_10000077 3300025901 Bacteria 37350
142 Ga0207688_10035349 3300025901 Bacteria 2768
143 Ga0207680_10010682 3300025903 Bacteria 4605
144 Ga0207647_10009116 3300025904 Bacteria 7064
145 Ga0207685_10020977 3300025905 Bacteria 2181
146 Ga0207685_10162635 3300025905 Bacteria 1020
147 Ga0207645_10057803 3300025907 Bacteria 2476
148 Ga0207645_10280133 3300025907 Bacteria 1107
149 Ga0207643_10069603 3300025908 Bacteria 2023
150 Ga0207684_10350263 3300025910 Bacteria 1271
151 Ga0207654_10118722 3300025911 Bacteria 1657
152 Ga0207693_10019590 3300025915 Bacteria 5381
153 Ga0207693_10062716 3300025915 Bacteria 2912
154 Ga0207693_10104071 3300025915 Bacteria 2226
155 Ga0207693_10143308 3300025915 Bacteria 1879
156 Ga0207693_10233274 3300025915 Bacteria 1445
157 Ga0207663_10074404 3300025916 Bacteria 2201
158 Ga0207662_10001253 3300025918 Bacteria 12190
159 Ga0207662_10050133 3300025918 Bacteria 2479
160 Ga0207657_10068728 3300025919 Bacteria 3008
161 Ga0207652_10049636 3300025921 Bacteria 3593
162 Ga0207652_10150529 3300025921 Bacteria 2083
163 Ga0207681_10086288 3300025923 Bacteria 2230
164 Ga0207694_10059214 3300025924 Bacteria 2979
165 Ga0207650_10003204 3300025925 Bacteria 11284
166 Ga0207650_10061118 3300025925 Bacteria 2812
167 Ga0207659_10035572 3300025926 Bacteria 3444
168 Ga0207659_10073966 3300025926 Bacteria 2497
169 Ga0207687_10054499 3300025927 Bacteria 2798
170 Ga0207700_10069410 3300025928 Bacteria 2705
171 Ga0207700_10157441 3300025928 Bacteria 1883
172 Ga0207664_10011218 3300025929 Bacteria 6354
173 Ga0207664_10079346 3300025929 Bacteria 2665
174 Ga0207664_10330970 3300025929 Bacteria 1345
175 Ga0207644_10028994 3300025931 Bacteria 3837
176 Ga0207644_10043355 3300025931 Bacteria 3192
177 Ga0207644_10399167 3300025931 Bacteria 1124
178 Ga0207706_10007789 3300025933 Bacteria 9883
179 Ga0207706_10026231 3300025933 Bacteria 5215
180 Ga0207706_10206061 3300025933 Bacteria 1724
181 Ga0207686_10011607 3300025934 Bacteria 4828
182 Ga0207709_10009546 3300025935 Bacteria 5340
183 Ga0207709_10023462 3300025935 Bacteria 3511
184 Ga0207670_10007704 3300025936 Bacteria 6035
185 Ga0207670_10032115 3300025936 Bacteria 3373
186 Ga0207669_10248736 3300025937 Bacteria 1322
187 Ga0207704_10334410 3300025938 Bacteria 1173
188 Ga0207665_10060100 3300025939 Bacteria 2573
189 Ga0207665_10130727 3300025939 Bacteria 1782
190 Ga0207691_10012684 3300025940 Bacteria 8073
191 Ga0207691_10027132 3300025940 Bacteria 5373
192 Ga0207691_10091159 3300025940 Bacteria 2731
193 Ga0207711_10051453 3300025941 Bacteria 3527
194 Ga0207711_10418636 3300025941 Unclassified 1246
195 Ga0207711_10653994 3300025941 Bacteria 980
196 Ga0207689_10003006 3300025942 Bacteria 15554
197 Ga0207689_10531483 3300025942 Bacteria 987
198 Ga0207661_10551021 3300025944 Bacteria 1056
199 Ga0207679_10202204 3300025945 Bacteria 1660
200 Ga0207651_10012150 3300025960 Bacteria 4858
201 Ga0207651_10121947 3300025960 Bacteria 1978
202 Ga0207712_10017017 3300025961 Bacteria 4717
203 Ga0207668_10182262 3300025972 Bacteria 1658
204 Ga0207658_10042999 3300025986 Bacteria 3282
205 Ga0207677_10302870 3300026023 Bacteria 1321
206 Ga0207703_10109318 3300026035 Bacteria 2356
207 Ga0207639_10357914 3300026041 Bacteria 1305
208 Ga0207639_10504870 3300026041 Bacteria 1105
209 Ga0207708_10000155 3300026075 Bacteria 54651
210 Ga0207702_10509501 3300026078 Bacteria 1174
211 Ga0207641_10802993 3300026088 Bacteria 931
212 Ga0207648_10020939 3300026089 Bacteria 5887
213 Ga0207676_10595196 3300026095 Unclassified 1061
214 Ga0207674_10010489 3300026116 Bacteria 10488
215 Ga0207675_100017335 3300026118 Bacteria 6724
216 Ga0207675_100509258 3300026118 Bacteria 1199
217 Ga0207683_10013200 3300026121 Bacteria 7047
218 Ga0207683_10015447 3300026121 Bacteria 6503
219 Ga0207683_10170049 3300026121 Bacteria 1973
220 Ga0207698_10045433 3300026142 Bacteria 3309
221 Ga0207428_10008153 3300027907 Bacteria 9488
222 Ga0268266_10561585 3300028379 Bacteria 1094
223 Ga0268265_10221955 3300028380 Bacteria 1654
224 Ga0268264_10038020 3300028381 Bacteria 3970
225 Ga0265320_10076522 3300031240 Bacteria 1568
226 Ga0265340_10058886 3300031247 Bacteria 1843
227 Ga0265340_10064156 3300031247 Bacteria 1752
228 Ga0265340_10073810 3300031247 Bacteria 1614
229 Ga0265339_10231936 3300031249 Bacteria 899
230 Ga0265331_10010104 3300031250 Bacteria 5243
231 Ga0265331_10236702 3300031250 Bacteria 820
232 Ga0265316_10158262 3300031344 Bacteria 1694
233 Ga0265316_10282329 3300031344 Bacteria 1213
234 Ga0265313_10143534 3300031595 Unclassified 1025
235 Ga0265314_10176565 3300031711 Bacteria 1284
236 Ga0265314_10321817 3300031711 Bacteria 860
237 Ga0265342_10025899 3300031712 Bacteria 3681
238 Ga0307416_100698776 3300032002 Bacteria 1103
239 Ga0373934_0033759 3300035086 Bacteria 2009
240 Ga0373944_0015956 3300035089 Unclassified 2112
241 Ga0373944_0020245 3300035089 Bacteria 1915
242 Ga0373936_0000429 3300035113 Bacteria 14125
243 Ga0373936_0029239 3300035113 Bacteria 2168
244 Ga0373945_0001639 3300035116 Bacteria 6866
245 Ga0373945_0011705 3300035116 Bacteria 2904
246 Ga0373953_0003881 3300035117 Bacteria 4709
247 Ga0373943_0000078 3300035170 Bacteria 34436
248 Ga0373943_0154734 3300035170 Bacteria 1244
249 Ga0373946_0002901 3300035171 Bacteria 6083
250 Ga0373946_0043007 3300035171 Bacteria 1859
251 Ga0373946_0069378 3300035171 Bacteria 1518
252 Ga0373946_0177378 3300035171 Bacteria 1010
253 Ga0373955_0001221 3300035172 Bacteria 10920
254 Ga0373931_0167533 3300035691 Bacteria 1292
255 Ga0373931_0318095 3300035691 Unclassified 966
256 Ga0373935_0003708 3300035692 Bacteria 8915
257 Ga0373935_0008899 3300035692 Bacteria 6008
258 Ga0373935_0111107 3300035692 Bacteria 1819
259 Ga0373935_0444316 3300035692 Bacteria 936
260 Ga0373927_0000491 3300035695 Bacteria 30439
261 Ga0373927_0045996 3300035695 Bacteria 2824
262 Ga0373927_0096543 3300035695 Bacteria 1921
263 Ga0373933_0005193 3300035724 Bacteria 7107
264 Ga0373947_0005376 3300035725 Bacteria 7472
265 Ga0373947_0024371 3300035725 Bacteria 3525
266 Ga0373947_0026848 3300035725 Bacteria 3367
267 Ga0373947_0276240 3300035725 Bacteria 1116
268 Ga0373937_0000058 3300036401 Bacteria 99025
269 Ga0373925_0000036 3300037068 Bacteria 143388
270 Ga0373925_0001714 3300037068 Bacteria 18478
271 Ga0373925_0346638 3300037068 Bacteria 1205
272 Ga0373925_0576007 3300037068 Bacteria 926
273 Ga0395900_0058290 3300037418 Bacteria 3975
274 Ga0395898_0063124 3300037466 Bacteria 3595
275 Ga0436364_0614469 3300037853 Unclassified 925
276 Ga0436364_1518306 3300037853 Unclassified 1445
277 Ga0395901_0116276 3300038443 Bacteria 2809
278 Ga0436360_0725302 3300039438 Bacteria 2263
279 Ga0436361_0575176 3300039447 Bacteria 16913
280 Ga0436361_1120378 3300039447 Unclassified 2638
281 Ga0436363_1573122 3300039450 Bacteria 5571
282 Ga0466957_0448169 3300044842 Bacteria 889
283 Ga0495592_0001483 3300046454 Bacteria 16332
284 Ga0495629_0040296 3300046459 Bacteria 3285
285 Ga0495629_0279276 3300046459 Bacteria 1146
286 Ga0495651_0001333 3300046462 Bacteria 19125
287 Ga0495653_0006352 3300046463 Bacteria 9698
288 Ga0495580_0069220 3300046472 Bacteria 2466
289 Ga0495639_0008234 3300046475 Bacteria 4478
290 Ga0495662_0001440 3300046476 Bacteria 11771
291 Ga0495662_0006106 3300046476 Bacteria 6020
292 Ga0495664_0000010 3300046477 Bacteria 268381
293 Ga0495664_0000068 3300046477 Bacteria 49687
294 Ga0495584_0094148 3300046491 Bacteria 1512
295 Ga0495584_0129156 3300046491 Bacteria 1282
296 Ga0495607_0075749 3300046501 Bacteria 1864
297 Ga0495608_0000008 3300046511 Bacteria 268629
298 Ga0495618_0000002 3300046514 Bacteria 271353
299 Ga0495618_0001695 3300046514 Bacteria 14641
300 Ga0495618_0042722 3300046514 Bacteria 2858
301 Ga0495618_0149608 3300046514 Bacteria 1491
302 Ga0495628_0000009 3300046516 Bacteria 237611
303 Ga0495630_0001382 3300046517 Bacteria 16742
304 Ga0495630_0003600 3300046517 Bacteria 10794
305 Ga0495644_0072791 3300046523 Bacteria 1292
306 Ga0495666_0069421 3300046526 Bacteria 1676
307 Ga0495652_0000011 3300046529 Bacteria 255329
308 Ga0495665_0002727 3300046531 Bacteria 9529
309 Ga0495665_0007496 3300046531 Bacteria 5905
310 Ga0495640_0000009 3300046533 Bacteria 217086
311 Ga0495640_0147412 3300046533 Bacteria 1513
312 Ga0495586_0021934 3300046535 Bacteria 3407
313 Ga0495586_0140103 3300046535 Bacteria 1357
314 Ga0495587_0000006 3300046536 Bacteria 310070
315 Ga0495598_0002755 3300046537 Bacteria 3653
316 Ga0495598_0244586 3300046537 Bacteria 662
317 Ga0495645_0000010 3300046543 Bacteria 238337
318 Ga0495645_0004897 3300046543 Bacteria 9159
319 Ga0495667_0000005 3300046559 Bacteria 268252
320 Ga0495656_0002300 3300046615 Bacteria 6315
321 Ga0495634_0000055 3300046642 Bacteria 89761
322 Ga0495634_0001076 3300046642 Bacteria 25489
323 Ga0495634_0003030 3300046642 Bacteria 13677
324 Ga0495634_0031037 3300046642 Bacteria 3683
325 Ga0495635_0000008 3300046663 Bacteria 268349
326 Ga0495635_0011336 3300046663 Bacteria 6252
327 Ga0495659_0164518 3300046664 Bacteria 897
328 Ga0495661_0156494 3300046665 Bacteria 1227
329 Ga0495657_0000470 3300046675 Bacteria 37809
330 Ga0495599_0000250 3300046678 Bacteria 34000
331 Ga0495623_0000004 3300046679 Bacteria 142249
332 Ga0495646_0000040 3300046680 Bacteria 71368
333 Ga0495646_0042350 3300046680 Bacteria 2794
334 Ga0495658_0104856 3300046683 Bacteria 1693
335 Ga0495613_0012773 3300046689 Bacteria 6245
336 Ga0495624_0006036 3300046690 Bacteria 8638
337 Ga0495624_0008008 3300046690 Bacteria 7403
338 Ga0495600_0000080 3300046809 Bacteria 53421
339 Ga0495581_0002181 3300047315 Bacteria 11037
340 Ga0495581_0067636 3300047315 Bacteria 2066
341 Ga0495604_0000012 3300047317 Bacteria 268341
342 Ga0495674_0000011 3300047319 Bacteria 270911
343 Ga0495674_0341764 3300047319 Bacteria 1216
344 Ga0495672_0035111 3300047320 Bacteria 3090
345 Ga0495676_0094545 3300047321 Bacteria 2226
346 Ga0495675_0000468 3300047444 Bacteria 26603
347 Ga0495684_0000014 3300047471 Bacteria 172111
348 Ga0495684_0003135 3300047471 Bacteria 12972
349 Ga0495684_0003426 3300047471 Bacteria 12426
350 Ga0495684_0014468 3300047471 Bacteria 6071
351 Ga0495593_0000650 3300047673 Bacteria 20010
352 Ga0495593_0005361 3300047673 Bacteria 7587
353 Ga0495602_0000019 3300048088 Bacteria 170922
354 Ga0495614_0032364 3300048089 Bacteria 2251
355 Ga0495626_0091761 3300048091 Bacteria 1335
356 Ga0496100_0110733 3300048903 Bacteria 1907
357 Ga0496100_0338335 3300048903 Bacteria 1134
358 Ga0496101_0015763 3300048904 Bacteria 5101
359 Ga0496101_0121248 3300048904 Bacteria 1977
360 Ga0496101_0169563 3300048904 Bacteria 1677
361 Ga0496101_0661303 3300048904 Unclassified 825
362 Ga0496102_0005726 3300048905 Bacteria 10559
363 Ga0496102_0160148 3300048905 Bacteria 2117
364 Ga0496102_0269846 3300048905 Bacteria 1604
365 Ga0496103_0057158 3300048906 Bacteria 2422
366 Ga0496104_0006242 3300048907 Bacteria 10470
367 Ga0496104_0008475 3300048907 Bacteria 9141
368 Ga0496104_0109716 3300048907 Bacteria 2645
369 Ga0496104_0255707 3300048907 Bacteria 1664
370 Ga0496105_0016944 3300048908 Bacteria 5830
371 Ga0496105_0323755 3300048908 Bacteria 1235
372 Ga0496106_0004959 3300048909 Bacteria 9848
373 Ga0496106_0251081 3300048909 Bacteria 1414
374 Ga0496107_0100805 3300048910 Bacteria 2117
375 Ga0496108_0008224 3300048911 Bacteria 8467
376 Ga0496108_0029467 3300048911 Bacteria 4545
377 Ga0496108_0044746 3300048911 Bacteria 3696
378 Ga0496109_0025923 3300048912 Bacteria 5224
379 Ga0496109_0137523 3300048912 Bacteria 2283
380 Ga0496110_0003351 3300048913 Bacteria 12246
381 Ga0496110_0017698 3300048913 Bacteria 5961
382 Ga0496110_0034717 3300048913 Bacteria 4371
383 Ga0496110_0111177 3300048913 Bacteria 2462
384 Ga0496110_0468384 3300048913 Bacteria 1148
385 Ga0496111_0050159 3300048914 Bacteria 3009
386 Ga0496111_0060996 3300048914 Bacteria 2734
387 Ga0496111_0372525 3300048914 Bacteria 1056
388 Ga0496112_0018074 3300048915 Bacteria 6634
389 Ga0496112_0033446 3300048915 Bacteria 4998
390 Ga0496112_0060323 3300048915 Bacteria 3738
391 Ga0496112_0167784 3300048915 Bacteria 2161
392 Ga0496113_0007307 3300048916 Bacteria 7091
393 Ga0496113_0069380 3300048916 Bacteria 2677
394 Ga0496113_0079885 3300048916 Bacteria 2504
395 Ga0496114_0059082 3300048917 Bacteria 3203
396 Ga0496114_0208016 3300048917 Bacteria 1715
397 Ga0496114_0431598 3300048917 Bacteria 1167
398 Ga0496115_0025559 3300048918 Bacteria 4599
399 Ga0496115_0038411 3300048918 Bacteria 3799
400 Ga0496126_0172199 3300048929 Bacteria 1843
401 Ga0501033_0027834 3300049570 Bacteria 4248
402 Ga0501033_0074835 3300049570 Bacteria 2486
403 Ga0501033_0782611 3300049570 Bacteria 646
404 Ga0501034_0217698 3300049571 Bacteria 1863
405 Ga0501034_0358876 3300049571 Bacteria 1385
406 Ga0501036_0045235 3300049572 Bacteria 3730
407 Ga0501037_0225126 3300049573 Bacteria 1318
408 Ga0501038_0017454 3300049574 Bacteria 6488
409 Ga0501038_0336417 3300049574 Bacteria 1178
410 Ga0501038_0383125 3300049574 Unclassified 1091
411 Ga0501039_0388122 3300049575 Bacteria 1097
412 Ga0501041_0362506 3300049577 Unclassified 916
413 Ga0501043_0441954 3300049579 Unclassified 978
414 Ga0501043_0448674 3300049579 Bacteria 969
415 Ga0501046_0156475 3300049580 Bacteria 1716
416 Ga0501046_0198914 3300049580 Unclassified 1492
417 Ga0501047_0010224 3300049581 Bacteria 8874
418 Ga0501070_0003380 3300049586 Bacteria 13841
419 Ga0501070_0119188 3300049586 Bacteria 2181
420 Ga0501070_0385785 3300049586 Bacteria 1134
421 Ga0501076_0536887 3300049592 Bacteria 964
422 Ga0501080_0084452 3300049742 Bacteria 2950
423 Ga0501083_0022177 3300049744 Bacteria 4407
424 Ga0501083_0288315 3300049744 Bacteria 1068
425 Ga0501035_0028480 3300049822 Bacteria 5098
426 Ga0501035_0059114 3300049822 Bacteria 3414
427 Ga0501044_0046995 3300049823 Bacteria 4466
428 Ga0501044_0063414 3300049823 Bacteria 3775
429 nmdc:mga03683_18332_c1 3300050489 Bacteria 2660
430 nmdc:mga00v17_94522_c1 3300050491 Bacteria 1881
431 nmdc:mga0yw44_176533_c1 3300050492 Bacteria 1404
432 nmdc:mga0k408_68182_c1 3300050493 Bacteria 2075
433 nmdc:mga05p37_22835_c1 3300050507 Bacteria 7587
434 nmdc:mga05p37_290827_c1 3300050507 Bacteria 1945
435 nmdc:mga05p37_743_c1 3300050507 Bacteria 36122
436 nmdc:mga05p37_88711_c1 3300050507 Bacteria 2503
437 nmdc:mga05p37_94732_c1 3300050507 Bacteria 3678
438 nmdc:mga09592_22078_c1 3300050508 Bacteria 4095
439 nmdc:mga09592_781_c1 3300050508 Bacteria 24612
440 nmdc:mga0qj67_103_c1 3300050509 Bacteria 56674
441 nmdc:mga0qj67_24196_c1 3300050509 Bacteria 4679
442 nmdc:mga0qj67_29546_c1 3300050509 Bacteria 4258
443 nmdc:mga06r32_192982_c1 3300050510 Bacteria 2024
444 nmdc:mga06r32_204986_c1 3300050510 Bacteria 1960
445 nmdc:mga06r32_58536_c1 3300050510 Bacteria 3703
446 nmdc:mga06r32_670_c1 3300050510 Bacteria 29853
447 nmdc:mga08y16_121_c1 3300050511 Bacteria 67325
448 nmdc:mga0n895_29553_c1 3300050512 Bacteria 5229
449 nmdc:mga0n895_379130_c1 3300050512 Bacteria 1431
450 nmdc:mga0n895_68418_c1 3300050512 Bacteria 3518
451 nmdc:mga0rr50_131957_c1 3300050513 Bacteria 2001
452 nmdc:mga08x19_405184_c1 3300050514 Bacteria 957
453 nmdc:mga0a205_703291_c1 3300050515 Bacteria 860
454 nmdc:mga0sz30_83420_c1 3300050516 Bacteria 1384
455 Ga0495601_0000009 3300053077 Bacteria 270622
456 Ga0495601_0109948 3300053077 Bacteria 1784
457 Ga0495612_0000021 3300053078 Bacteria 130528
458 Ga0495595_0000067 3300053084 Bacteria 51316
459 Ga0495595_0209991 3300053084 Bacteria 970
460 Ga0495619_0000012 3300053085 Bacteria 268349
461 Ga0495619_0016017 3300053085 Bacteria 4745
462 Ga0495619_0052530 3300053085 Bacteria 2694
463 Ga0495619_0194686 3300053085 Bacteria 1403
464 Ga0500556_0118127 3300053104 Bacteria 1033
465 Ga0501084_0253255 3300054114 Bacteria 1486
466 Ga0501082_0000040 3300060353 Bacteria 91596
467 Ga0501082_0576705 3300060353 Bacteria 984
468 Ga0530510_0250427 3300061734 Bacteria 1320
469 Ga0530510_0376315 3300061734 Bacteria 1069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10171351 Ga0075365_101713512 188
2 3300050492 nmdc:mga0yw44_176533_c1 nmdc:mga0yw44_176533_c1_732_1388 188
3 3300037853 Ga0436364_1518306 Ga0436364_1518306_834_1418 189
4 3300049592 Ga0501076_0536887 Ga0501076_0536887_87_740 191
5 3300049574 Ga0501038_0383125 Ga0501038_0383125_466_1065 192
6 3300046537 Ga0495598_0244586 Ga0495598_0244586_22_615 194
7 3300049570 Ga0501033_0782611 Ga0501033_0782611_13_609 194
8 3300049575 Ga0501039_0388122 Ga0501039_0388122_179_775 194
9 3300005983 Ga0081540_1027658 Ga0081540_10276582 195
10 3300025898 Ga0207692_10067602 Ga0207692_100676021 195
11 3300050509 nmdc:mga0qj67_103_c1 nmdc:mga0qj67_103_c1_37798_38403 196
12 3300061734 Ga0530510_0376315 Ga0530510_0376315_61_666 196
13 3300035086 Ga0373934_0033759 Ga0373934_0033759_466_1119 198
14 3300035089 Ga0373944_0020245 Ga0373944_0020245_40_693 198
15 3300035113 Ga0373936_0000429 Ga0373936_0000429_11357_12010 198
16 3300035116 Ga0373945_0001639 Ga0373945_0001639_5318_5971 198
17 3300035117 Ga0373953_0003881 Ga0373953_0003881_1334_1987 198
18 3300035171 Ga0373946_0002901 Ga0373946_0002901_4605_5258 198
19 3300035172 Ga0373955_0001221 Ga0373955_0001221_9836_10489 198
20 3300035692 Ga0373935_0003708 Ga0373935_0003708_7646_8299 198
21 3300035695 Ga0373927_0096543 Ga0373927_0096543_313_966 198
22 3300035724 Ga0373933_0005193 Ga0373933_0005193_1145_1798 198
23 3300035725 Ga0373947_0005376 Ga0373947_0005376_1124_1777 198
24 3300036401 Ga0373937_0000058 Ga0373937_0000058_83327_83980 198
25 3300037068 Ga0373925_0000036 Ga0373925_0000036_2084_2737 198
26 3300046454 Ga0495592_0001483 Ga0495592_0001483_665_1318 198
27 3300046462 Ga0495651_0001333 Ga0495651_0001333_2640_3293 198
28 3300046476 Ga0495662_0001440 Ga0495662_0001440_3214_3867 198
29 3300046477 Ga0495664_0000010 Ga0495664_0000010_15035_15688 198
30 3300046511 Ga0495608_0000008 Ga0495608_0000008_252961_253614 198
31 3300046514 Ga0495618_0000002 Ga0495618_0000002_17308_17961 198
32 3300046516 Ga0495628_0000009 Ga0495628_0000009_15063_15716 198
33 3300046517 Ga0495630_0001382 Ga0495630_0001382_15110_15763 198
34 3300046529 Ga0495652_0000011 Ga0495652_0000011_252651_253304 198
35 3300046533 Ga0495640_0000009 Ga0495640_0000009_201403_202056 198
36 3300046535 Ga0495586_0140103 Ga0495586_0140103_604_1257 198
37 3300046536 Ga0495587_0000006 Ga0495587_0000006_128781_129434 198
38 3300046543 Ga0495645_0000010 Ga0495645_0000010_222024_222677 198
39 3300046559 Ga0495667_0000005 Ga0495667_0000005_15063_15716 198
40 3300046642 Ga0495634_0000055 Ga0495634_0000055_15051_15704 198
41 3300046663 Ga0495635_0000008 Ga0495635_0000008_252634_253287 198
42 3300046675 Ga0495657_0000470 Ga0495657_0000470_17336_17989 198
43 3300046678 Ga0495599_0000250 Ga0495599_0000250_16012_16665 198
44 3300046679 Ga0495623_0000004 Ga0495623_0000004_50728_51381 198
45 3300046680 Ga0495646_0000040 Ga0495646_0000040_55653_56306 198
46 3300046809 Ga0495600_0000080 Ga0495600_0000080_15052_15705 198
47 3300047315 Ga0495581_0067636 Ga0495581_0067636_352_1005 198
48 3300047317 Ga0495604_0000012 Ga0495604_0000012_15050_15703 198
49 3300047319 Ga0495674_0000011 Ga0495674_0000011_17336_17989 198
50 3300047444 Ga0495675_0000468 Ga0495675_0000468_15044_15697 198
51 3300047471 Ga0495684_0000014 Ga0495684_0000014_15052_15705 198
52 3300047673 Ga0495593_0000650 Ga0495593_0000650_7463_8116 198
53 3300048088 Ga0495602_0000019 Ga0495602_0000019_15028_15681 198
54 3300053077 Ga0495601_0000009 Ga0495601_0000009_252634_253287 198
55 3300053078 Ga0495612_0000021 Ga0495612_0000021_14942_15595 198
56 3300053084 Ga0495595_0000067 Ga0495595_0000067_18022_18675 198
57 3300053085 Ga0495619_0000012 Ga0495619_0000012_252634_253287 198
58 3300005436 Ga0070713_100888393 Ga0070713_1008883931 199
59 3300035089 Ga0373944_0015956 Ga0373944_0015956_1354_2004 200
60 3300035171 Ga0373946_0043007 Ga0373946_0043007_1089_1739 200
61 3300044842 Ga0466957_0448169 Ga0466957_0448169_159_794 200
62 3300046533 Ga0495640_0147412 Ga0495640_0147412_756_1406 200
63 3300049742 Ga0501080_0084452 Ga0501080_0084452_1966_2619 202
64 3300048929 Ga0496126_0172199 Ga0496126_0172199_1183_1833 204
65 3300024227 Ga0228598_1059009 Ga0228598_10590091 205
66 3300035113 Ga0373936_0029239 Ga0373936_0029239_1406_2086 205
67 3300035116 Ga0373945_0011705 Ga0373945_0011705_2159_2839 205
68 3300035170 Ga0373943_0000078 Ga0373943_0000078_32824_33504 205
69 3300035692 Ga0373935_0111107 Ga0373935_0111107_871_1551 205
70 3300035695 Ga0373927_0000491 Ga0373927_0000491_15598_16278 205
71 3300035725 Ga0373947_0024371 Ga0373947_0024371_430_1110 205
72 3300037068 Ga0373925_0001714 Ga0373925_0001714_15383_16063 205
73 3300037853 Ga0436364_0614469 Ga0436364_0614469_78_707 205
74 3300039447 Ga0436361_1120378 Ga0436361_1120378_1075_1713 205
75 3300046459 Ga0495629_0040296 Ga0495629_0040296_1313_1993 205
76 3300046472 Ga0495580_0069220 Ga0495580_0069220_1441_2121 205
77 3300046475 Ga0495639_0008234 Ga0495639_0008234_1364_2044 205
78 3300046514 Ga0495618_0149608 Ga0495618_0149608_459_1139 205
79 3300046517 Ga0495630_0003600 Ga0495630_0003600_7966_8646 205
80 3300046526 Ga0495666_0069421 Ga0495666_0069421_113_793 205
81 3300046531 Ga0495665_0002727 Ga0495665_0002727_4811_5491 205
82 3300046642 Ga0495634_0031037 Ga0495634_0031037_227_907 205
83 3300046689 Ga0495613_0012773 Ga0495613_0012773_3428_4108 205
84 3300046690 Ga0495624_0008008 Ga0495624_0008008_2403_3083 205
85 3300047315 Ga0495581_0002181 Ga0495581_0002181_1160_1840 205
86 3300047319 Ga0495674_0341764 Ga0495674_0341764_361_1041 205
87 3300047321 Ga0495676_0094545 Ga0495676_0094545_340_1020 205
88 3300047471 Ga0495684_0003135 Ga0495684_0003135_9877_10557 205
89 3300047673 Ga0495593_0005361 Ga0495593_0005361_800_1480 205
90 3300053085 Ga0495619_0052530 Ga0495619_0052530_766_1446 205
91 3300005985 Ga0081539_10000798 Ga0081539_1000079853 206
92 3300025915 Ga0207693_10233274 Ga0207693_102332742 206
93 3300048089 Ga0495614_0032364 Ga0495614_0032364_1472_2179 206
94 3300005333 Ga0070677_10032918 Ga0070677_100329182 207
95 3300005340 Ga0070689_100138683 Ga0070689_1001386832 207
96 3300005343 Ga0070687_100154695 Ga0070687_1001546952 207
97 3300005347 Ga0070668_100204843 Ga0070668_1002048432 207
98 3300005353 Ga0070669_100168587 Ga0070669_1001685872 207
99 3300005356 Ga0070674_100097664 Ga0070674_1000976642 207
100 3300005367 Ga0070667_100386638 Ga0070667_1003866381 207
101 3300005457 Ga0070662_100177540 Ga0070662_1001775402 207
102 3300005466 Ga0070685_10040876 Ga0070685_100408763 207
103 3300005548 Ga0070665_100410781 Ga0070665_1004107812 207
104 3300005618 Ga0068864_100013016 Ga0068864_1000130167 207
105 3300005844 Ga0068862_100730410 Ga0068862_1007304102 207
106 3300006358 Ga0068871_100343764 Ga0068871_1003437642 207
107 3300006881 Ga0068865_100280726 Ga0068865_1002807262 207
108 3300009094 Ga0111539_10133722 Ga0111539_101337222 207
109 3300009101 Ga0105247_10092268 Ga0105247_100922682 207
110 3300009148 Ga0105243_10567492 Ga0105243_105674922 207
111 3300009177 Ga0105248_10563038 Ga0105248_105630382 207
112 3300013308 Ga0157375_11526740 Ga0157375_115267401 207
113 3300014325 Ga0163163_10415731 Ga0163163_104157312 207
114 3300014326 Ga0157380_10117060 Ga0157380_101170602 207
115 3300014969 Ga0157376_10058867 Ga0157376_100588674 207
116 3300025893 Ga0207682_10000232 Ga0207682_1000023227 207
117 3300025900 Ga0207710_10035428 Ga0207710_100354282 207
118 3300025901 Ga0207688_10035349 Ga0207688_100353493 207
119 3300025907 Ga0207645_10057803 Ga0207645_100578032 207
120 3300025908 Ga0207643_10069603 Ga0207643_100696032 207
121 3300025918 Ga0207662_10050133 Ga0207662_100501332 207
122 3300025923 Ga0207681_10086288 Ga0207681_100862882 207
123 3300025931 Ga0207644_10399167 Ga0207644_103991671 207
124 3300025933 Ga0207706_10206061 Ga0207706_102060612 207
125 3300025937 Ga0207669_10248736 Ga0207669_102487362 207
126 3300025938 Ga0207704_10334410 Ga0207704_103344102 207
127 3300025940 Ga0207691_10027132 Ga0207691_100271326 207
128 3300025941 Ga0207711_10418636 Ga0207711_104186362 207
129 3300025972 Ga0207668_10182262 Ga0207668_101822622 207
130 3300026041 Ga0207639_10504870 Ga0207639_105048702 207
131 3300026095 Ga0207676_10595196 Ga0207676_105951962 207
132 3300026116 Ga0207674_10010489 Ga0207674_100104892 207
133 3300026118 Ga0207675_100509258 Ga0207675_1005092582 207
134 3300026121 Ga0207683_10013200 Ga0207683_100132007 207
135 3300028379 Ga0268266_10561585 Ga0268266_105615852 207
136 3300046537 Ga0495598_0002755 Ga0495598_0002755_2235_2921 207
137 3300049570 Ga0501033_0027834 Ga0501033_0027834_2527_3174 207
138 3300049572 Ga0501036_0045235 Ga0501036_0045235_1384_2031 207
139 3300049579 Ga0501043_0441954 Ga0501043_0441954_95_742 207
140 3300049580 Ga0501046_0198914 Ga0501046_0198914_768_1415 207
141 3300049586 Ga0501070_0119188 Ga0501070_0119188_471_1118 207
142 3300049586 Ga0501070_0385785 Ga0501070_0385785_472_1119 207
143 3300049822 Ga0501035_0059114 Ga0501035_0059114_41_688 207
144 3300049823 Ga0501044_0063414 Ga0501044_0063414_447_1094 207
145 3300049744 Ga0501083_0022177 Ga0501083_0022177_169_855 208
146 3300060353 Ga0501082_0000040 Ga0501082_0000040_1338_2024 208
147 3300009148 Ga0105243_10042009 Ga0105243_100420093 209
148 3300014325 Ga0163163_10195606 Ga0163163_101956063 209
149 3300025935 Ga0207709_10023462 Ga0207709_100234622 209
150 3300025942 Ga0207689_10531483 Ga0207689_105314832 209
151 3300050512 nmdc:mga0n895_29553_c1 nmdc:mga0n895_29553_c1_2620_3264 209
152 3300005841 Ga0068863_100605889 Ga0068863_1006058891 210
153 3300006048 Ga0075363_100001280 Ga0075363_1000012802 210
154 3300006051 Ga0075364_10026981 Ga0075364_100269813 210
155 3300006163 Ga0070715_10116337 Ga0070715_101163372 210
156 3300006177 Ga0075362_10003194 Ga0075362_100031942 210
157 3300006195 Ga0075366_10000720 Ga0075366_1000072014 210
158 3300006844 Ga0075428_100007488 Ga0075428_1000074882 210
159 3300006846 Ga0075430_100026706 Ga0075430_1000267062 210
160 3300006847 Ga0075431_100001907 Ga0075431_10000190716 210
161 3300006880 Ga0075429_100030650 Ga0075429_1000306506 210
162 3300006914 Ga0075436_100152634 Ga0075436_1001526342 210
163 3300009094 Ga0111539_10000178 Ga0111539_1000017822 210
164 3300009147 Ga0114129_10001129 Ga0114129_1000112921 210
165 3300026088 Ga0207641_10802993 Ga0207641_108029932 210
166 3300027907 Ga0207428_10008153 Ga0207428_100081538 210
167 3300031240 Ga0265320_10076522 Ga0265320_100765222 210
168 3300031247 Ga0265340_10064156 Ga0265340_100641562 210
169 3300031344 Ga0265316_10282329 Ga0265316_102823292 210
170 3300031711 Ga0265314_10321817 Ga0265314_103218172 210
171 3300035171 Ga0373946_0177378 Ga0373946_0177378_269_940 210
172 3300035725 Ga0373947_0276240 Ga0373947_0276240_52_723 210
173 3300037068 Ga0373925_0346638 Ga0373925_0346638_187_897 210
174 3300048904 Ga0496101_0015763 Ga0496101_0015763_2597_3247 210
175 3300048905 Ga0496102_0005726 Ga0496102_0005726_4225_4875 210
176 3300048906 Ga0496103_0057158 Ga0496103_0057158_801_1451 210
177 3300048907 Ga0496104_0006242 Ga0496104_0006242_446_1096 210
178 3300048907 Ga0496104_0255707 Ga0496104_0255707_636_1286 210
179 3300048908 Ga0496105_0016944 Ga0496105_0016944_1482_2132 210
180 3300048909 Ga0496106_0004959 Ga0496106_0004959_4515_5165 210
181 3300048911 Ga0496108_0008224 Ga0496108_0008224_7797_8447 210
182 3300048911 Ga0496108_0029467 Ga0496108_0029467_2612_3262 210
183 3300048912 Ga0496109_0025923 Ga0496109_0025923_2715_3365 210
184 3300048912 Ga0496109_0137523 Ga0496109_0137523_176_826 210
185 3300048913 Ga0496110_0003351 Ga0496110_0003351_2905_3555 210
186 3300048913 Ga0496110_0017698 Ga0496110_0017698_476_1126 210
187 3300048914 Ga0496111_0050159 Ga0496111_0050159_706_1356 210
188 3300048914 Ga0496111_0372525 Ga0496111_0372525_281_931 210
189 3300048915 Ga0496112_0018074 Ga0496112_0018074_1043_1693 210
190 3300048915 Ga0496112_0033446 Ga0496112_0033446_2412_3062 210
191 3300048916 Ga0496113_0007307 Ga0496113_0007307_2479_3129 210
192 3300048916 Ga0496113_0079885 Ga0496113_0079885_435_1085 210
193 3300048917 Ga0496114_0431598 Ga0496114_0431598_141_791 210
194 3300050489 nmdc:mga03683_18332_c1 nmdc:mga03683_18332_c1_837_1532 210
195 3300050491 nmdc:mga00v17_94522_c1 nmdc:mga00v17_94522_c1_58_753 210
196 3300050493 nmdc:mga0k408_68182_c1 nmdc:mga0k408_68182_c1_1191_1886 210
197 3300050507 nmdc:mga05p37_743_c1 nmdc:mga05p37_743_c1_16458_17114 210
198 3300050508 nmdc:mga09592_781_c1 nmdc:mga09592_781_c1_23768_24424 210
199 3300050509 nmdc:mga0qj67_24196_c1 nmdc:mga0qj67_24196_c1_3731_4387 210
200 3300050510 nmdc:mga06r32_670_c1 nmdc:mga06r32_670_c1_28821_29477 210
201 3300050511 nmdc:mga08y16_121_c1 nmdc:mga08y16_121_c1_18904_19560 210
202 3300050514 nmdc:mga08x19_405184_c1 nmdc:mga08x19_405184_c1_129_779 210
203 3300050516 nmdc:mga0sz30_83420_c1 nmdc:mga0sz30_83420_c1_138_833 210
204 3300005329 Ga0070683_100043346 Ga0070683_1000433463 211
205 3300005335 Ga0070666_10012708 Ga0070666_100127083 211
206 3300005337 Ga0070682_100031909 Ga0070682_1000319092 211
207 3300005343 Ga0070687_100050425 Ga0070687_1000504252 211
208 3300005345 Ga0070692_10083249 Ga0070692_100832492 211
209 3300005354 Ga0070675_100117140 Ga0070675_1001171401 211
210 3300005355 Ga0070671_100045440 Ga0070671_1000454404 211
211 3300005356 Ga0070674_100030021 Ga0070674_1000300212 211
212 3300005364 Ga0070673_100037560 Ga0070673_1000375604 211
213 3300005366 Ga0070659_100250290 Ga0070659_1002502902 211
214 3300005438 Ga0070701_10036803 Ga0070701_100368032 211
215 3300005440 Ga0070705_100108027 Ga0070705_1001080271 211
216 3300005441 Ga0070700_100006656 Ga0070700_1000066563 211
217 3300005466 Ga0070685_10081114 Ga0070685_100811141 211
218 3300005535 Ga0070684_100057364 Ga0070684_1000573643 211
219 3300005539 Ga0068853_100084489 Ga0068853_1000844893 211
220 3300005543 Ga0070672_100093553 Ga0070672_1000935532 211
221 3300005544 Ga0070686_100032754 Ga0070686_1000327542 211
222 3300005564 Ga0070664_100126117 Ga0070664_1001261172 211
223 3300005578 Ga0068854_100012183 Ga0068854_1000121834 211
224 3300005615 Ga0070702_100021434 Ga0070702_1000214342 211
225 3300005616 Ga0068852_100049572 Ga0068852_1000495723 211
226 3300005718 Ga0068866_10094112 Ga0068866_100941121 211
227 3300005719 Ga0068861_100062527 Ga0068861_1000625273 211
228 3300005842 Ga0068858_100042796 Ga0068858_1000427964 211
229 3300005843 Ga0068860_100025673 Ga0068860_1000256734 211
230 3300005844 Ga0068862_100004735 Ga0068862_1000047352 211
231 3300006028 Ga0070717_10121303 Ga0070717_101213032 211
232 3300006237 Ga0097621_100063026 Ga0097621_1000630262 211
233 3300006353 Ga0075370_10188191 Ga0075370_101881912 211
234 3300006358 Ga0068871_100068389 Ga0068871_1000683893 211
235 3300006846 Ga0075430_100010104 Ga0075430_1000101043 211
236 3300006847 Ga0075431_100110331 Ga0075431_1001103312 211
237 3300006871 Ga0075434_100445350 Ga0075434_1004453502 211
238 3300006880 Ga0075429_100163345 Ga0075429_1001633452 211
239 3300006881 Ga0068865_100011559 Ga0068865_1000115594 211
240 3300007788 Ga0099795_10001280 Ga0099795_100012804 211
241 3300010159 Ga0099796_10097177 Ga0099796_100971772 211
242 3300017792 Ga0163161_10107964 Ga0163161_101079642 211
243 3300025901 Ga0207688_10000077 Ga0207688_1000007734 211
244 3300025903 Ga0207680_10010682 Ga0207680_100106822 211
245 3300025904 Ga0207647_10009116 Ga0207647_100091166 211
246 3300025915 Ga0207693_10143308 Ga0207693_101433082 211
247 3300025918 Ga0207662_10001253 Ga0207662_100012537 211
248 3300025919 Ga0207657_10068728 Ga0207657_100687281 211
249 3300025925 Ga0207650_10061118 Ga0207650_100611183 211
250 3300025926 Ga0207659_10073966 Ga0207659_100739662 211
251 3300025927 Ga0207687_10054499 Ga0207687_100544992 211
252 3300025928 Ga0207700_10069410 Ga0207700_100694103 211
253 3300025931 Ga0207644_10043355 Ga0207644_100433552 211
254 3300025933 Ga0207706_10007789 Ga0207706_1000778910 211
255 3300025934 Ga0207686_10011607 Ga0207686_100116072 211
256 3300025935 Ga0207709_10009546 Ga0207709_100095462 211
257 3300025936 Ga0207670_10032115 Ga0207670_100321154 211
258 3300025940 Ga0207691_10012684 Ga0207691_100126847 211
259 3300025941 Ga0207711_10051453 Ga0207711_100514532 211
260 3300025942 Ga0207689_10003006 Ga0207689_100030061 211
261 3300025944 Ga0207661_10551021 Ga0207661_105510211 211
262 3300025945 Ga0207679_10202204 Ga0207679_102022042 211
263 3300025960 Ga0207651_10121947 Ga0207651_101219472 211
264 3300025961 Ga0207712_10017017 Ga0207712_100170173 211
265 3300026041 Ga0207639_10357914 Ga0207639_103579141 211
266 3300026075 Ga0207708_10000155 Ga0207708_1000015531 211
267 3300026078 Ga0207702_10509501 Ga0207702_105095012 211
268 3300026089 Ga0207648_10020939 Ga0207648_100209392 211
269 3300026118 Ga0207675_100017335 Ga0207675_1000173356 211
270 3300026121 Ga0207683_10015447 Ga0207683_100154473 211
271 3300026142 Ga0207698_10045433 Ga0207698_100454333 211
272 3300028380 Ga0268265_10221955 Ga0268265_102219551 211
273 3300028381 Ga0268264_10038020 Ga0268264_100380201 211
274 3300035691 Ga0373931_0167533 Ga0373931_0167533_426_1079 211
275 3300046491 Ga0495584_0094148 Ga0495584_0094148_346_993 211
276 3300046501 Ga0495607_0075749 Ga0495607_0075749_993_1640 211
277 3300046514 Ga0495618_0042722 Ga0495618_0042722_226_891 211
278 3300046523 Ga0495644_0072791 Ga0495644_0072791_324_971 211
279 3300046531 Ga0495665_0007496 Ga0495665_0007496_4055_4720 211
280 3300046543 Ga0495645_0004897 Ga0495645_0004897_202_867 211
281 3300046615 Ga0495656_0002300 Ga0495656_0002300_4669_5316 211
282 3300046642 Ga0495634_0003030 Ga0495634_0003030_10229_10894 211
283 3300046664 Ga0495659_0164518 Ga0495659_0164518_181_828 211
284 3300046665 Ga0495661_0156494 Ga0495661_0156494_544_1197 211
285 3300047471 Ga0495684_0014468 Ga0495684_0014468_2777_3442 211
286 3300048091 Ga0495626_0091761 Ga0495626_0091761_130_783 211
287 3300048917 Ga0496114_0208016 Ga0496114_0208016_183_836 211
288 3300050507 nmdc:mga05p37_290827_c1 nmdc:mga05p37_290827_c1_1201_1848 211
289 3300050508 nmdc:mga09592_22078_c1 nmdc:mga09592_22078_c1_2826_3473 211
290 3300050509 nmdc:mga0qj67_29546_c1 nmdc:mga0qj67_29546_c1_504_1151 211
291 3300050510 nmdc:mga06r32_192982_c1 nmdc:mga06r32_192982_c1_947_1594 211
292 3300053104 Ga0500556_0118127 Ga0500556_0118127_96_761 211
293 3300005434 Ga0070709_10086152 Ga0070709_100861521 212
294 3300005435 Ga0070714_100002527 Ga0070714_1000025271 212
295 3300005436 Ga0070713_100104553 Ga0070713_1001045533 212
296 3300005436 Ga0070713_100326874 Ga0070713_1003268742 212
297 3300005437 Ga0070710_10215718 Ga0070710_102157182 212
298 3300005439 Ga0070711_100046325 Ga0070711_1000463253 212
299 3300005467 Ga0070706_100301741 Ga0070706_1003017412 212
300 3300005518 Ga0070699_100007777 Ga0070699_1000077773 212
301 3300005549 Ga0070704_100131566 Ga0070704_1001315662 212
302 3300005937 Ga0081455_10000969 Ga0081455_1000096923 212
303 3300005937 Ga0081455_10014752 Ga0081455_100147527 212
304 3300005937 Ga0081455_10115540 Ga0081455_101155402 212
305 3300005983 Ga0081540_1007455 Ga0081540_10074552 212
306 3300006028 Ga0070717_10004121 Ga0070717_1000412112 212
307 3300006173 Ga0070716_100016684 Ga0070716_1000166842 212
308 3300006844 Ga0075428_100138340 Ga0075428_1001383403 212
309 3300006844 Ga0075428_100467980 Ga0075428_1004679802 212
310 3300006871 Ga0075434_100123780 Ga0075434_1001237803 212
311 3300006871 Ga0075434_100429277 Ga0075434_1004292772 212
312 3300007076 Ga0075435_100111051 Ga0075435_1001110512 212
313 3300007076 Ga0075435_100124600 Ga0075435_1001246002 212
314 3300007265 Ga0099794_10014324 Ga0099794_100143242 212
315 3300009094 Ga0111539_10434225 Ga0111539_104342252 212
316 3300009101 Ga0105247_10081702 Ga0105247_100817022 212
317 3300009147 Ga0114129_10068331 Ga0114129_100683315 212
318 3300009147 Ga0114129_10492896 Ga0114129_104928962 212
319 3300013306 Ga0163162_10257558 Ga0163162_102575582 212
320 3300021441 Ga0213871_10020418 Ga0213871_100204182 212
321 3300025898 Ga0207692_10021667 Ga0207692_100216672 212
322 3300025905 Ga0207685_10020977 Ga0207685_100209772 212
323 3300025910 Ga0207684_10350263 Ga0207684_103502632 212
324 3300025915 Ga0207693_10019590 Ga0207693_100195902 212
325 3300025915 Ga0207693_10062716 Ga0207693_100627162 212
326 3300025928 Ga0207700_10157441 Ga0207700_101574412 212
327 3300025929 Ga0207664_10011218 Ga0207664_100112182 212
328 3300025929 Ga0207664_10330970 Ga0207664_103309702 212
329 3300025939 Ga0207665_10060100 Ga0207665_100601002 212
330 3300032002 Ga0307416_100698776 Ga0307416_1006987762 212
331 3300035170 Ga0373943_0154734 Ga0373943_0154734_186_878 212
332 3300035171 Ga0373946_0069378 Ga0373946_0069378_98_790 212
333 3300035692 Ga0373935_0008899 Ga0373935_0008899_4400_5092 212
334 3300035692 Ga0373935_0444316 Ga0373935_0444316_78_734 212
335 3300035695 Ga0373927_0045996 Ga0373927_0045996_329_1021 212
336 3300035725 Ga0373947_0026848 Ga0373947_0026848_1345_2037 212
337 3300037068 Ga0373925_0576007 Ga0373925_0576007_45_737 212
338 3300037418 Ga0395900_0058290 Ga0395900_0058290_1943_2599 212
339 3300037466 Ga0395898_0063124 Ga0395898_0063124_301_957 212
340 3300038443 Ga0395901_0116276 Ga0395901_0116276_125_781 212
341 3300039438 Ga0436360_0725302 Ga0436360_0725302_611_1273 212
342 3300039447 Ga0436361_0575176 Ga0436361_0575176_3479_4141 212
343 3300039450 Ga0436363_1573122 Ga0436363_1573122_2067_2723 212
344 3300046459 Ga0495629_0279276 Ga0495629_0279276_45_737 212
345 3300046463 Ga0495653_0006352 Ga0495653_0006352_8909_9601 212
346 3300046476 Ga0495662_0006106 Ga0495662_0006106_2858_3550 212
347 3300046477 Ga0495664_0000068 Ga0495664_0000068_15404_16096 212
348 3300046491 Ga0495584_0129156 Ga0495584_0129156_584_1240 212
349 3300046514 Ga0495618_0001695 Ga0495618_0001695_9211_9903 212
350 3300046535 Ga0495586_0021934 Ga0495586_0021934_1517_2209 212
351 3300046642 Ga0495634_0001076 Ga0495634_0001076_20458_21150 212
352 3300046663 Ga0495635_0011336 Ga0495635_0011336_4285_4977 212
353 3300046680 Ga0495646_0042350 Ga0495646_0042350_1491_2183 212
354 3300046683 Ga0495658_0104856 Ga0495658_0104856_941_1597 212
355 3300046690 Ga0495624_0006036 Ga0495624_0006036_2013_2705 212
356 3300047471 Ga0495684_0003426 Ga0495684_0003426_2530_3222 212
357 3300048903 Ga0496100_0338335 Ga0496100_0338335_216_872 212
358 3300048904 Ga0496101_0121248 Ga0496101_0121248_664_1320 212
359 3300048904 Ga0496101_0661303 Ga0496101_0661303_33_701 212
360 3300048905 Ga0496102_0160148 Ga0496102_0160148_436_1092 212
361 3300048907 Ga0496104_0008475 Ga0496104_0008475_3518_4186 212
362 3300048909 Ga0496106_0251081 Ga0496106_0251081_169_825 212
363 3300048910 Ga0496107_0100805 Ga0496107_0100805_1338_1994 212
364 3300048911 Ga0496108_0044746 Ga0496108_0044746_1433_2101 212
365 3300048913 Ga0496110_0034717 Ga0496110_0034717_1212_1877 212
366 3300048913 Ga0496110_0111177 Ga0496110_0111177_1472_2128 212
367 3300048913 Ga0496110_0468384 Ga0496110_0468384_97_753 212
368 3300048914 Ga0496111_0060996 Ga0496111_0060996_1017_1679 212
369 3300048915 Ga0496112_0167784 Ga0496112_0167784_1152_1814 212
370 3300048917 Ga0496114_0059082 Ga0496114_0059082_2483_3151 212
371 3300048918 Ga0496115_0025559 Ga0496115_0025559_2040_2708 212
372 3300049570 Ga0501033_0074835 Ga0501033_0074835_1332_1994 212
373 3300049571 Ga0501034_0217698 Ga0501034_0217698_1034_1696 212
374 3300049571 Ga0501034_0358876 Ga0501034_0358876_72_734 212
375 3300049573 Ga0501037_0225126 Ga0501037_0225126_570_1232 212
376 3300049574 Ga0501038_0017454 Ga0501038_0017454_3211_3873 212
377 3300049574 Ga0501038_0336417 Ga0501038_0336417_198_860 212
378 3300049579 Ga0501043_0448674 Ga0501043_0448674_29_691 212
379 3300049580 Ga0501046_0156475 Ga0501046_0156475_224_886 212
380 3300049581 Ga0501047_0010224 Ga0501047_0010224_3235_3897 212
381 3300049586 Ga0501070_0003380 Ga0501070_0003380_3548_4210 212
382 3300049744 Ga0501083_0288315 Ga0501083_0288315_142_804 212
383 3300049822 Ga0501035_0028480 Ga0501035_0028480_3638_4300 212
384 3300049823 Ga0501044_0046995 Ga0501044_0046995_511_1173 212
385 3300050507 nmdc:mga05p37_94732_c1 nmdc:mga05p37_94732_c1_1344_2006 212
386 3300050510 nmdc:mga06r32_58536_c1 nmdc:mga06r32_58536_c1_1479_2132 212
387 3300050512 nmdc:mga0n895_68418_c1 nmdc:mga0n895_68418_c1_2204_2860 212
388 3300050513 nmdc:mga0rr50_131957_c1 nmdc:mga0rr50_131957_c1_592_1257 212
389 3300050515 nmdc:mga0a205_703291_c1 nmdc:mga0a205_703291_c1_47_703 212
390 3300053077 Ga0495601_0109948 Ga0495601_0109948_190_882 212
391 3300053084 Ga0495595_0209991 Ga0495595_0209991_150_842 212
392 3300053085 Ga0495619_0016017 Ga0495619_0016017_1283_1975 212
393 3300053085 Ga0495619_0194686 Ga0495619_0194686_450_1106 212
394 3300054114 Ga0501084_0253255 Ga0501084_0253255_630_1283 212
395 3300061734 Ga0530510_0250427 Ga0530510_0250427_182_835 212
396 3300031247 Ga0265340_10073810 Ga0265340_100738102 213
397 3300031249 Ga0265339_10231936 Ga0265339_102319361 213
398 3300031250 Ga0265331_10236702 Ga0265331_102367021 213
399 3300031711 Ga0265314_10176565 Ga0265314_101765652 213
400 3300048905 Ga0496102_0269846 Ga0496102_0269846_853_1533 213
401 3300060353 Ga0501082_0576705 Ga0501082_0576705_242_898 213
402 3300005338 Ga0068868_100384921 Ga0068868_1003849212 214
403 3300005340 Ga0070689_100104694 Ga0070689_1001046942 214
404 3300005353 Ga0070669_100128349 Ga0070669_1001283492 214
405 3300005354 Ga0070675_100049613 Ga0070675_1000496133 214
406 3300005355 Ga0070671_100002377 Ga0070671_10000237714 214
407 3300005356 Ga0070674_100728606 Ga0070674_1007286061 214
408 3300005366 Ga0070659_100224432 Ga0070659_1002244322 214
409 3300005435 Ga0070714_100083584 Ga0070714_1000835842 214
410 3300005439 Ga0070711_100032546 Ga0070711_1000325463 214
411 3300005548 Ga0070665_100079291 Ga0070665_1000792912 214
412 3300005564 Ga0070664_100506810 Ga0070664_1005068102 214
413 3300006028 Ga0070717_10047982 Ga0070717_100479823 214
414 3300006163 Ga0070715_10124009 Ga0070715_101240092 214
415 3300006846 Ga0075430_100000194 Ga0075430_10000019442 214
416 3300006847 Ga0075431_100256244 Ga0075431_1002562442 214
417 3300006871 Ga0075434_100551023 Ga0075434_1005510232 214
418 3300009147 Ga0114129_10001774 Ga0114129_100017743 214
419 3300009147 Ga0114129_10758078 Ga0114129_107580782 214
420 3300009174 Ga0105241_10177274 Ga0105241_101772742 214
421 3300009177 Ga0105248_10144056 Ga0105248_101440563 214
422 3300009551 Ga0105238_10204664 Ga0105238_102046641 214
423 3300010375 Ga0105239_10501408 Ga0105239_105014082 214
424 3300011119 Ga0105246_10562080 Ga0105246_105620802 214
425 3300025905 Ga0207685_10162635 Ga0207685_101626352 214
426 3300025907 Ga0207645_10280133 Ga0207645_102801331 214
427 3300025911 Ga0207654_10118722 Ga0207654_101187222 214
428 3300025915 Ga0207693_10104071 Ga0207693_101040713 214
429 3300025916 Ga0207663_10074404 Ga0207663_100744042 214
430 3300025924 Ga0207694_10059214 Ga0207694_100592143 214
431 3300025925 Ga0207650_10003204 Ga0207650_1000320413 214
432 3300025926 Ga0207659_10035572 Ga0207659_100355722 214
433 3300025929 Ga0207664_10079346 Ga0207664_100793462 214
434 3300025931 Ga0207644_10028994 Ga0207644_100289943 214
435 3300025933 Ga0207706_10026231 Ga0207706_100262315 214
436 3300025936 Ga0207670_10007704 Ga0207670_100077043 214
437 3300025939 Ga0207665_10130727 Ga0207665_101307272 214
438 3300025940 Ga0207691_10091159 Ga0207691_100911592 214
439 3300025941 Ga0207711_10653994 Ga0207711_106539941 214
440 3300025960 Ga0207651_10012150 Ga0207651_100121503 214
441 3300025986 Ga0207658_10042999 Ga0207658_100429992 214
442 3300026023 Ga0207677_10302870 Ga0207677_103028702 214
443 3300026035 Ga0207703_10109318 Ga0207703_101093182 214
444 3300026121 Ga0207683_10170049 Ga0207683_101700492 214
445 3300031247 Ga0265340_10058886 Ga0265340_100588862 214
446 3300031250 Ga0265331_10010104 Ga0265331_100101042 214
447 3300031344 Ga0265316_10158262 Ga0265316_101582622 214
448 3300031595 Ga0265313_10143534 Ga0265313_101435342 214
449 3300031712 Ga0265342_10025899 Ga0265342_100258992 214
450 3300035691 Ga0373931_0318095 Ga0373931_0318095_248_910 214
451 3300047320 Ga0495672_0035111 Ga0495672_0035111_1092_1772 214
452 3300048903 Ga0496100_0110733 Ga0496100_0110733_247_930 214
453 3300048904 Ga0496101_0169563 Ga0496101_0169563_264_947 214
454 3300048907 Ga0496104_0109716 Ga0496104_0109716_714_1397 214
455 3300048908 Ga0496105_0323755 Ga0496105_0323755_310_993 214
456 3300048915 Ga0496112_0060323 Ga0496112_0060323_1313_1996 214
457 3300048916 Ga0496113_0069380 Ga0496113_0069380_1250_1933 214
458 3300048918 Ga0496115_0038411 Ga0496115_0038411_2034_2717 214
459 3300049577 Ga0501041_0362506 Ga0501041_0362506_143_826 214
460 3300050507 nmdc:mga05p37_22835_c1 nmdc:mga05p37_22835_c1_4924_5586 214
461 3300050507 nmdc:mga05p37_88711_c1 nmdc:mga05p37_88711_c1_878_1540 214
462 3300050510 nmdc:mga06r32_204986_c1 nmdc:mga06r32_204986_c1_293_955 214
463 3300050512 nmdc:mga0n895_379130_c1 nmdc:mga0n895_379130_c1_662_1324 214
464 3300005530 Ga0070679_100018641 Ga0070679_1000186412 215
465 3300025921 Ga0207652_10150529 Ga0207652_101505292 215
466 3300005530 Ga0070679_100068290 Ga0070679_1000682902 216
467 3300025921 Ga0207652_10049636 Ga0207652_100496364 216
468 3300003373 JGI25407J50210_10067541 JGI25407J50210_100675411 217
469 3300005981 Ga0081538_10005460 Ga0081538_1000546012 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

40

217

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.815 12 212
7ot8-assembly1.cif.gz_A denovotim6-sb, a de novo designed tim barrel with a salt-bridge cluster (crystal form 2) 0.8064 13 194
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.7965 12 212
6yqx-assembly1.cif.gz_A crystal structure of denovotim13, a de novo designed tim barrel 0.7952 14 193
1g4e-assembly2.cif.gz_B thiamin phosphate synthase 0.7924 16 214
ID Description Score Start End Superfamily
af_A4IE56_138_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.85 156 189 3.40.50.720
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.815 12 212 3.20.20.70
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7965 12 212 3.20.20.70
af_Q5AEJ1_1_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7754 17 209 3.20.20.70
1yadC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7668 16 217 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1H6IQL3-F1-model_v4 Thiamine-phosphate pyrophosphorylase 0.9662 15 214 GO:0009228
AF-A0A2U0U0R3-F1-model_v4 deleted 0.963 15 215
AF-A0A1Q3JVP6-F1-model_v4 Thiamine phosphate synthase 0.9411 4 212 GO:0009228
AF-A0A6P1BSJ2-F1-model_v4 Thiamine phosphate synthase 0.9348 3 119 GO:0009228
AF-A0A1M3NKJ0-F1-model_v4 Thiamine phosphate synthase/TenI domain-containing protein 0.9346 12 192 GO:0004789
GO:0005737
GO:0009228

Feature Viewer

pLDDT pTM Quality
91.42 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map