F450257

General Info

Members Datasets Scaffolds Average Seq Length
469 279 432 229

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10401908|Ga0207678_104019082
Length 263
Sequence MTKAERVLALLEALQDRGSATGPELAARLETDVRTLRRDVVALRALGFPVEGARGRFPVHRIYCVGRNYAEHAREMGHDPDREPPFFFMKPADAIVTDGGDFGYPSHSRDVHHELELVVALGSGGSSVPASRALDLVYGYAVGLDMTRRDLQGEAKKMGRPWDTGKAFDGSAPCSSIRRASEIGHPTKGAVWLEVNGGARQRGDLSQLIWKIPEMIAYLSTLFTLAPGDLIFTGTPSGVGPVDRGDVLKGGVDGVGTLTVRVV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
12 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541307 Variovorax sp. GV008 Isolate Unclassified
15 2738543019 Variovorax sp. GV040 Isolate Unclassified
16 2818991446 Variovorax sp. 1180 Isolate Unclassified
17 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
18 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
19 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
20 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
21 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
22 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
23 2885198086 Variovorax sp. 679 Isolate Unclassified
24 2885211737 Variovorax sp. 553 Isolate Unclassified
25 2899924645 Variovorax sp. 369 Isolate Unclassified
26 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
27 2919150387 Rahnella aceris 1817 Isolate Unclassified
28 2927143783 Rahnella sp. 2050 Isolate Unclassified
29 2928037797 Variovorax sp. 1126 Isolate Unclassified
30 2928044640 Variovorax sp. 1128 Isolate Unclassified
31 2928051484 Variovorax sp. 1133 Isolate Unclassified
32 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
33 2928070936 Variovorax gossypii 1167 Isolate Unclassified
34 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
35 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
36 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
37 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
42 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
43 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
44 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
52 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
255 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
256 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
261 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
262 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
263 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
274 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.11
Nodule 0.21
Rhizoplane 3.2
Rhizosphere 63.11
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2267015 2162886007 Bacteria 3058
2 JGI24740J21852_10023276 3300001979 Bacteria 2118
3 JGI25163J39215_1000079 3300002771 Bacteria 42883
4 JGI25164J39214_1000011 3300002772 Bacteria 262057
5 Ga0055538_1000021 3300003751 Bacteria 262057
6 Ga0055539_1000026 3300003752 Bacteria 262057
7 Ga0055533_1000035 3300003756 Bacteria 262057
8 Ga0055525_1000045 3300003759 Bacteria 262057
9 Ga0055535_1000259 3300003761 Bacteria 55584
10 Ga0055542_1000070 3300003762 Bacteria 147374
11 Ga0055536_1002088 3300003781 Bacteria 11388
12 Ga0055536_1002437 3300003781 Bacteria 10450
13 Ga0055536_1005927 3300003781 Bacteria 5846
14 Ga0055530_10000631 3300003791 Bacteria 30394
15 Ga0055530_10001360 3300003791 Bacteria 18126
16 Ga0055530_10029523 3300003791 Bacteria 1465
17 Ga0055540_1002470 3300003792 Bacteria 9723
18 Ga0055540_1004868 3300003792 Bacteria 5878
19 Ga0055531_10003640 3300003794 Bacteria 9723
20 Ga0055541_1000020 3300003841 Bacteria 262057
21 Ga0055543_1001935 3300004625 Bacteria 7409
22 Ga0055543_1006993 3300004625 Bacteria 2658
23 Ga0065704_10002330 3300005289 Bacteria 9239
24 Ga0070670_100276726 3300005331 Bacteria 1465
25 Ga0070668_100000237 3300005347 Bacteria 36121
26 Ga0070668_100720746 3300005347 Bacteria 881
27 Ga0070669_100161269 3300005353 Bacteria 1742
28 Ga0070674_100015739 3300005356 Bacteria 4729
29 Ga0070688_100360996 3300005365 Bacteria 1066
30 Ga0070667_100000030 3300005367 Bacteria 178327
31 Ga0070663_100586393 3300005455 Bacteria 936
32 Ga0070662_100006050 3300005457 Bacteria 7768
33 Ga0070662_100076447 3300005457 Bacteria 2482
34 Ga0070681_10546423 3300005458 Bacteria 1072
35 Ga0068867_100303406 3300005459 Bacteria 1317
36 Ga0070706_100827013 3300005467 Bacteria 857
37 Ga0068853_100005701 3300005539 Bacteria 9795
38 Ga0070665_100042956 3300005548 Bacteria 4545
39 Ga0068854_100241096 3300005578 Bacteria 1440
40 Ga0068856_100422587 3300005614 Bacteria 1353
41 Ga0068852_100107223 3300005616 Bacteria 2534
42 Ga0068852_100489100 3300005616 Bacteria 1224
43 Ga0068861_100321888 3300005719 Bacteria 1347
44 Ga0068851_10043331 3300005834 Bacteria 2268
45 Ga0068863_100000049 3300005841 Bacteria 132539
46 Ga0068860_100428099 3300005843 Bacteria 1313
47 Ga0068862_100028395 3300005844 Bacteria 4711
48 Ga0068862_100082737 3300005844 Bacteria 2786
49 Ga0068862_100231458 3300005844 Bacteria 1677
50 Ga0081455_10000505 3300005937 Bacteria 50605
51 Ga0081539_10000028 3300005985 Bacteria 328182
52 Ga0075367_10131569 3300006178 Bacteria 1547
53 Ga0097621_100912157 3300006237 Bacteria 819
54 Ga0075370_10045763 3300006353 Bacteria 2475
55 Ga0068871_100466603 3300006358 Bacteria 1134
56 Ga0075433_10073463 3300006852 Bacteria 3008
57 Ga0068865_100093176 3300006881 Bacteria 2190
58 Ga0105251_10202746 3300009011 Bacteria 894
59 Ga0105244_10008823 3300009036 Bacteria 6260
60 Ga0105244_10013277 3300009036 Bacteria 4823
61 Ga0105244_10088239 3300009036 Bacteria 1528
62 Ga0105240_10179658 3300009093 Unclassified 2498
63 Ga0114129_10001797 3300009147 Bacteria 29229
64 Ga0114129_10357593 3300009147 Bacteria 1933
65 Ga0105243_10023953 3300009148 Bacteria 4651
66 Ga0105243_10110231 3300009148 Bacteria 2301
67 Ga0105248_10146793 3300009177 Bacteria 2662
68 Ga0105248_10858993 3300009177 Bacteria 1024
69 Ga0105237_10012511 3300009545 Bacteria 8940
70 Ga0105249_10029306 3300009553 Bacteria 4970
71 Ga0105249_10296849 3300009553 Bacteria 1619
72 Ga0105249_10432951 3300009553 Bacteria 1351
73 Ga0105239_10964598 3300010375 Bacteria 980
74 Ga0105246_10033411 3300011119 Bacteria 3419
75 Ga0105246_10086673 3300011119 Bacteria 2246
76 Ga0157373_10181034 3300013100 Bacteria 1484
77 Ga0157371_10025590 3300013102 Bacteria 4298
78 Ga0157371_10063747 3300013102 Bacteria 2612
79 Ga0157369_10008608 3300013105 Bacteria 11701
80 Ga0157369_10295360 3300013105 Bacteria 1686
81 Ga0163162_10013248 3300013306 Bacteria 8053
82 Ga0163162_10137202 3300013306 Bacteria 2557
83 Ga0163162_10712629 3300013306 Bacteria 1124
84 Ga0157372_10095380 3300013307 Bacteria 3389
85 Ga0157380_10001074 3300014326 Bacteria 17550
86 Ga0182008_10001193 3300014497 Bacteria 17905
87 Ga0182008_10009757 3300014497 Bacteria 5168
88 Ga0157376_10027877 3300014969 Bacteria 4483
89 Ga0157376_10046135 3300014969 Bacteria 3592
90 Ga0182006_1000046 3300015261 Bacteria 189544
91 Ga0182006_1008851 3300015261 Bacteria 4546
92 Ga0182007_10000044 3300015262 Bacteria 106301
93 Ga0182007_10006468 3300015262 Bacteria 5025
94 Ga0182005_1000032 3300015265 Bacteria 188517
95 Ga0163161_10016120 3300017792 Bacteria 5217
96 Ga0163161_10136519 3300017792 Bacteria 1854
97 Ga0209760_100004 3300025207 Bacteria 254650
98 Ga0209784_100001 3300025224 Bacteria 3600592
99 Ga0209566_100001 3300025225 Bacteria 3600765
100 Ga0209674_100002 3300025226 Bacteria 3600592
101 Ga0209672_101359 3300025228 Bacteria 9175
102 Ga0209147_101085 3300025229 Bacteria 11433
103 Ga0209563_100002 3300025230 Bacteria 2045675
104 Ga0207427_100012 3300025231 Bacteria 585657
105 Ga0209437_100001 3300025233 Bacteria 2045675
106 Ga0209258_100018 3300025242 Bacteria 567561
107 Ga0207425_1000252 3300025245 Bacteria 40307
108 Ga0209677_100002 3300025253 Bacteria 2045675
109 Ga0209148_1000030 3300025254 Bacteria 567582
110 Ga0209129_1000114 3300025258 Bacteria 141791
111 Ga0209233_1008568 3300025261 Bacteria 3152
112 Ga0209565_1000198 3300025263 Bacteria 71641
113 Ga0209565_1005929 3300025263 Bacteria 3498
114 Ga0209673_1000216 3300025273 Bacteria 114232
115 Ga0209673_1000481 3300025273 Bacteria 66688
116 Ga0209130_1000256 3300025284 Bacteria 66866
117 Ga0209130_1000364 3300025284 Bacteria 51592
118 Ga0209675_1012905 3300025291 Bacteria 2655
119 Ga0209676_1000004 3300025292 Bacteria 1138360
120 Ga0209676_1001531 3300025292 Bacteria 21006
121 Ga0209676_1002913 3300025292 Bacteria 11196
122 Ga0209025_1000682 3300025294 Bacteria 58271
123 Ga0209564_1000070 3300025295 Bacteria 303126
124 Ga0209564_1000295 3300025295 Bacteria 100738
125 Ga0209758_1000180 3300025297 Bacteria 141791
126 Ga0209758_1003915 3300025297 Bacteria 12992
127 Ga0209050_1000002 3300025298 Bacteria 1792849
128 Ga0209050_1000270 3300025298 Bacteria 110916
129 Ga0209050_1000715 3300025298 Bacteria 48729
130 Ga0209050_1018831 3300025298 Bacteria 2658
131 Ga0209256_1000047 3300025299 Bacteria 314709
132 Ga0209256_1000157 3300025299 Bacteria 141791
133 Ga0207426_1000184 3300025302 Bacteria 154290
134 Ga0207426_1000204 3300025302 Bacteria 141791
135 Ga0209051_1000002 3300025303 Bacteria 1631846
136 Ga0209051_1000523 3300025303 Bacteria 47869
137 Ga0209051_1001891 3300025303 Bacteria 16342
138 Ga0209051_1020417 3300025303 Bacteria 2853
139 Ga0209257_1000002 3300025304 Bacteria 1767052
140 Ga0209257_1000149 3300025304 Bacteria 192835
141 Ga0209257_1000938 3300025304 Bacteria 40312
142 Ga0207656_10028023 3300025321 Bacteria 2309
143 Ga0207696_1000298 3300025711 Bacteria 57382
144 Ga0207655_1000229 3300025728 Bacteria 93185
145 Ga0207655_1002184 3300025728 Bacteria 16248
146 Ga0207713_1116474 3300025735 Bacteria 901
147 Ga0207695_10330065 3300025913 Bacteria 1414
148 Ga0207671_10033214 3300025914 Bacteria 3839
149 Ga0207681_10061832 3300025923 Bacteria 2576
150 Ga0207681_10136950 3300025923 Bacteria 1818
151 Ga0207694_10356934 3300025924 Bacteria 1211
152 Ga0207650_10344273 3300025925 Bacteria 1225
153 Ga0207706_10005474 3300025933 Bacteria 11839
154 Ga0207706_10118411 3300025933 Bacteria 2329
155 Ga0207706_10255671 3300025933 Bacteria 1529
156 Ga0207709_10014044 3300025935 Bacteria 4422
157 Ga0207709_10017215 3300025935 Bacteria 4030
158 Ga0207669_10004937 3300025937 Bacteria 5933
159 Ga0207704_10117938 3300025938 Bacteria 1809
160 Ga0207704_10536507 3300025938 Bacteria 949
161 Ga0207711_10207462 3300025941 Bacteria 1789
162 Ga0207712_10012020 3300025961 Bacteria 5525
163 Ga0207712_10155060 3300025961 Bacteria 1773
164 Ga0207668_10000346 3300025972 Bacteria 30181
165 Ga0207668_10578799 3300025972 Bacteria 976
166 Ga0207658_10000019 3300025986 Bacteria 206335
167 Ga0207678_10401908 3300026067 Bacteria 1186
168 Ga0207641_10000029 3300026088 Bacteria 229383
169 Ga0207674_10079702 3300026116 Bacteria 3278
170 Ga0207675_100062254 3300026118 Bacteria 3484
171 Ga0207675_100069161 3300026118 Bacteria 3300
172 Ga0207675_100117298 3300026118 Bacteria 2517
173 Ga0207698_10376361 3300026142 Bacteria 1349
174 Ga0268264_10432022 3300028381 Bacteria 1272
175 Ga0268264_10759151 3300028381 Bacteria 967
176 Ga0307517_10142692 3300028786 Bacteria 1674
177 Ga0265332_10005619 3300031238 Bacteria 5774
178 Ga0265332_10223075 3300031238 Bacteria 782
179 Ga0307408_100769714 3300031548 Bacteria 871
180 Ga0316579_10141607 3300031691 Bacteria 1159
181 Ga0307405_10160431 3300031731 Bacteria 1592
182 Ga0307407_10143311 3300031903 Bacteria 1544
183 Ga0307409_100202458 3300031995 Bacteria 1777
184 Ga0307414_10363402 3300032004 Bacteria 1246
185 Ga0316583_10079676 3300032133 Bacteria 1145
186 Ga0373949_0000002 3300035090 Bacteria 102187
187 Ga0373949_0012879 3300035090 Bacteria 1853
188 Ga0373962_0166217 3300035242 Bacteria 730
189 Ga0316574_0000501 3300035398 Bacteria 15898
190 Ga0316574_0553136 3300035398 Bacteria 714
191 Ga0395899_0000315 3300037312 Bacteria 61724
192 Ga0395905_1242575 3300037471 Bacteria 648
193 Ga0395901_0001718 3300038443 Bacteria 22613
194 Ga0400486_16978 3300038742 Bacteria 2940
195 Ga0436363_0281235 3300039450 Bacteria 1133
196 Ga0436362_1196005 3300039453 Bacteria 1821
197 Ga0439465_0208283 3300041413 Bacteria 714
198 Ga0439435_0041383 3300042436 Bacteria 1291
199 Ga0451577_0006533 3300042876 Bacteria 11601
200 Ga0451577_0073341 3300042876 Bacteria 3054
201 Ga0451577_0375717 3300042876 Bacteria 1289
202 Ga0466972_0000088 3300044658 Bacteria 84167
203 Ga0453684_0273356 3300044712 Bacteria 1930
204 Ga0466968_0045337 3300044735 Bacteria 1865
205 Ga0495638_0007560 3300046460 Bacteria 7774
206 Ga0495650_0000182 3300046471 Bacteria 137031
207 Ga0495650_0001545 3300046471 Bacteria 21808
208 Ga0495607_0317175 3300046501 Bacteria 728
209 Ga0495610_0000116 3300046512 Bacteria 90702
210 Ga0495610_0026102 3300046512 Bacteria 3123
211 Ga0495616_0001319 3300046513 Bacteria 17310
212 Ga0495630_0312647 3300046517 Bacteria 1201
213 Ga0495631_0000067 3300046518 Bacteria 64990
214 Ga0495637_0011583 3300046520 Bacteria 4235
215 Ga0495643_0000048 3300046522 Bacteria 212788
216 Ga0495648_0027461 3300046524 Bacteria 3808
217 Ga0495654_0014848 3300046530 Bacteria 4139
218 Ga0495633_0000756 3300046558 Bacteria 29179
219 Ga0495668_0221763 3300046616 Bacteria 1035
220 Ga0495625_0146067 3300046660 Bacteria 1592
221 Ga0495635_0414736 3300046663 Bacteria 893
222 Ga0495588_0030556 3300046674 Bacteria 2708
223 Ga0495588_0033946 3300046674 Bacteria 2580
224 Ga0495658_0065521 3300046683 Bacteria 2096
225 Ga0495676_0021899 3300047321 Bacteria 5571
226 Ga0495593_0062809 3300047673 Bacteria 1940
227 Ga0495602_0208718 3300048088 Bacteria 1485
228 Ga0495614_0001725 3300048089 Bacteria 9555
229 Ga0496101_0047879 3300048904 Bacteria 3070
230 Ga0496101_0389799 3300048904 Bacteria 1096
231 Ga0496101_0924772 3300048904 Bacteria 686
232 Ga0496102_0399091 3300048905 Bacteria 1293
233 Ga0496104_0025440 3300048907 Bacteria 5456
234 Ga0496106_0189721 3300048909 Bacteria 1634
235 Ga0496111_0068931 3300048914 Bacteria 2572
236 Ga0496114_0560204 3300048917 Bacteria 1009
237 Ga0496115_0000043 3300048918 Bacteria 116422
238 Ga0496115_0591979 3300048918 Unclassified 883
239 Ga0496116_0000094 3300048919 Bacteria 205588
240 Ga0496116_0035776 3300048919 Bacteria 3484
241 Ga0496116_0038081 3300048919 Bacteria 3344
242 Ga0496117_0000010 3300048920 Bacteria 611954
243 Ga0496117_0009586 3300048920 Bacteria 8971
244 Ga0496117_0013513 3300048920 Bacteria 7117
245 Ga0496117_0120922 3300048920 Bacteria 1608
246 Ga0496118_0000009 3300048921 Bacteria 611954
247 Ga0496118_0007105 3300048921 Bacteria 12016
248 Ga0496118_0007512 3300048921 Bacteria 11526
249 Ga0496118_0014810 3300048921 Bacteria 7274
250 Ga0496118_0035253 3300048921 Bacteria 4066
251 Ga0496119_0015133 3300048922 Bacteria 5970
252 Ga0496120_0003422 3300048923 Bacteria 14495
253 Ga0496121_0003180 3300048924 Bacteria 23668
254 Ga0496121_0035821 3300048924 Bacteria 4436
255 Ga0496121_0050491 3300048924 Bacteria 3513
256 Ga0496121_0052596 3300048924 Bacteria 3418
257 Ga0496122_0000007 3300048925 Bacteria 606493
258 Ga0496122_0002845 3300048925 Bacteria 23688
259 Ga0496122_0050211 3300048925 Bacteria 3184
260 Ga0496122_0221802 3300048925 Bacteria 1084
261 Ga0496123_0000004 3300048926 Bacteria 777230
262 Ga0496123_0015202 3300048926 Bacteria 6330
263 Ga0496123_0060579 3300048926 Bacteria 2439
264 Ga0496123_0091541 3300048926 Bacteria 1803
265 Ga0496124_0000025 3300048927 Bacteria 405471
266 Ga0496124_0020244 3300048927 Bacteria 6157
267 Ga0496125_0000013 3300048928 Bacteria 628761
268 Ga0496125_0015591 3300048928 Bacteria 7336
269 Ga0496125_0128280 3300048928 Bacteria 1792
270 Ga0496125_0236423 3300048928 Bacteria 1164
271 Ga0496125_0293406 3300048928 Bacteria 1000
272 Ga0496126_0000087 3300048929 Bacteria 215031
273 Ga0496126_0000276 3300048929 Bacteria 108459
274 Ga0495682_0003050 3300049460 Bacteria 7611
275 Ga0501031_0323533 3300049568 Bacteria 999
276 Ga0501032_0237286 3300049569 Bacteria 1185
277 Ga0501033_0023091 3300049570 Bacteria 4690
278 Ga0501033_0045988 3300049570 Bacteria 3246
279 Ga0501033_0114137 3300049570 Bacteria 1964
280 Ga0501033_0528471 3300049570 Bacteria 814
281 Ga0501034_0211224 3300049571 Bacteria 1896
282 Ga0501036_0001534 3300049572 Bacteria 17849
283 Ga0501036_0047451 3300049572 Bacteria 3637
284 Ga0501036_0154321 3300049572 Bacteria 1937
285 Ga0501037_0118091 3300049573 Bacteria 1908
286 Ga0501037_0283527 3300049573 Bacteria 1154
287 Ga0501038_0003980 3300049574 Bacteria 13721
288 Ga0501038_0146340 3300049574 Bacteria 1929
289 Ga0501038_0236136 3300049574 Bacteria 1453
290 Ga0501039_0002072 3300049575 Bacteria 14853
291 Ga0501039_0053743 3300049575 Bacteria 3117
292 Ga0501039_0202654 3300049575 Bacteria 1560
293 Ga0501039_0224523 3300049575 Bacteria 1476
294 Ga0501039_0658967 3300049575 Bacteria 819
295 Ga0501040_0000193 3300049576 Bacteria 35390
296 Ga0501040_0000673 3300049576 Bacteria 21137
297 Ga0501040_0038914 3300049576 Bacteria 3234
298 Ga0501040_0068104 3300049576 Bacteria 2454
299 Ga0501040_0528535 3300049576 Bacteria 851
300 Ga0501041_0000915 3300049577 Bacteria 15984
301 Ga0501041_0001547 3300049577 Bacteria 12791
302 Ga0501041_0128541 3300049577 Bacteria 1578
303 Ga0501041_0170836 3300049577 Bacteria 1360
304 Ga0501042_0000004 3300049578 Bacteria 65867
305 Ga0501042_0002828 3300049578 Bacteria 10751
306 Ga0501042_0007204 3300049578 Bacteria 7278
307 Ga0501042_0015060 3300049578 Bacteria 5288
308 Ga0501042_0029951 3300049578 Bacteria 3842
309 Ga0501042_0109151 3300049578 Bacteria 1992
310 Ga0501046_0004070 3300049580 Bacteria 13337
311 Ga0501046_0305876 3300049580 Bacteria 1160
312 Ga0501047_0137931 3300049581 Bacteria 2319
313 Ga0501047_0704750 3300049581 Bacteria 827
314 Ga0501048_0008139 3300049582 Bacteria 7932
315 Ga0501048_0050682 3300049582 Bacteria 2956
316 Ga0501068_0132460 3300049584 Bacteria 1559
317 Ga0501070_0059509 3300049586 Bacteria 3167
318 Ga0501070_0289381 3300049586 Bacteria 1335
319 Ga0501070_0537620 3300049586 Bacteria 936
320 Ga0501071_0002919 3300049587 Bacteria 10552
321 Ga0501071_0007420 3300049587 Bacteria 7200
322 Ga0501072_0000948 3300049588 Bacteria 21365
323 Ga0501072_0001322 3300049588 Bacteria 18579
324 Ga0501072_0010132 3300049588 Bacteria 7175
325 Ga0501073_0279252 3300049589 Bacteria 1152
326 Ga0501074_0012019 3300049590 Bacteria 6292
327 Ga0501074_0086632 3300049590 Bacteria 2244
328 Ga0501074_0250628 3300049590 Bacteria 1259
329 Ga0501074_0365749 3300049590 Bacteria 1023
330 Ga0501075_0000559 3300049591 Bacteria 22565
331 Ga0501075_0000585 3300049591 Bacteria 22234
332 Ga0501075_0016033 3300049591 Bacteria 5391
333 Ga0501075_0070702 3300049591 Bacteria 2637
334 Ga0501075_0128168 3300049591 Bacteria 1932
335 Ga0501075_0155595 3300049591 Bacteria 1743
336 Ga0501076_0000047 3300049592 Bacteria 59013
337 Ga0501076_0002518 3300049592 Bacteria 12609
338 Ga0501076_0008901 3300049592 Bacteria 7384
339 Ga0501076_0012244 3300049592 Bacteria 6413
340 Ga0501076_0077332 3300049592 Bacteria 2670
341 Ga0501076_0091600 3300049592 Bacteria 2445
342 Ga0501076_0543050 3300049592 Bacteria 958
343 Ga0501077_0002705 3300049593 Bacteria 10624
344 Ga0501077_0020086 3300049593 Bacteria 4228
345 Ga0501077_0048736 3300049593 Bacteria 2692
346 Ga0501077_0151056 3300049593 Bacteria 1474
347 Ga0501077_0175413 3300049593 Bacteria 1362
348 Ga0501077_0250369 3300049593 Bacteria 1126
349 Ga0501079_0000593 3300049741 Bacteria 23982
350 Ga0501079_0002634 3300049741 Bacteria 13062
351 Ga0501079_0015886 3300049741 Bacteria 5754
352 Ga0501079_0045363 3300049741 Bacteria 3392
353 Ga0501079_0503297 3300049741 Bacteria 952
354 Ga0501080_0001160 3300049742 Bacteria 21756
355 Ga0501080_0004945 3300049742 Bacteria 11873
356 Ga0501080_0106998 3300049742 Bacteria 2592
357 Ga0501080_0197854 3300049742 Bacteria 1846
358 Ga0501081_0000076 3300049743 Bacteria 38632
359 Ga0501081_0015896 3300049743 Bacteria 4970
360 Ga0501081_0045620 3300049743 Bacteria 3010
361 Ga0501081_0045854 3300049743 Bacteria 3002
362 Ga0501081_0112301 3300049743 Bacteria 1934
363 Ga0501081_0118129 3300049743 Bacteria 1886
364 Ga0501083_0006955 3300049744 Bacteria 8025
365 Ga0501083_0089500 3300049744 Bacteria 2034
366 Ga0501083_0102166 3300049744 Bacteria 1890
367 Ga0501083_0178062 3300049744 Bacteria 1389
368 Ga0501035_0004917 3300049822 Bacteria 12675
369 Ga0501035_0067667 3300049822 Bacteria 3169
370 Ga0501035_0077815 3300049822 Bacteria 2931
371 Ga0501044_0045852 3300049823 Bacteria 4528
372 Ga0501044_0229148 3300049823 Bacteria 1806
373 Ga0501044_0366640 3300049823 Bacteria 1358
374 Ga0501045_0000080 3300049824 Bacteria 45916
375 Ga0501045_0000180 3300049824 Bacteria 35044
376 Ga0501045_0028394 3300049824 Bacteria 4036
377 Ga0501045_0174699 3300049824 Bacteria 1600
378 Ga0501045_0197205 3300049824 Bacteria 1500
379 nmdc:mga07m45_46112_c1 3300050496 Bacteria 2448
380 nmdc:mga07m45_92605_c1 3300050496 Bacteria 1732
381 nmdc:mga05p37_195161_c1 3300050507 Bacteria 2455
382 nmdc:mga05p37_24542_c1 3300050507 Bacteria 7328
383 nmdc:mga0n895_119735_c1 3300050512 Bacteria 2653
384 nmdc:mga0n895_1204813_c1 3300050512 Bacteria 731
385 nmdc:mga0a205_90738_c1 3300050515 Bacteria 2952
386 Ga0500643_012896 3300053087 Bacteria 2977
387 Ga0500646_0022814 3300053090 Bacteria 1675
388 Ga0500583_0205717 3300053092 Bacteria 978
389 Ga0500651_0000040 3300053093 Bacteria 92649
390 Ga0500566_0036884 3300053094 Bacteria 2835
391 Ga0500556_0178542 3300053104 Bacteria 839
392 Ga0500571_000092 3300053110 Bacteria 29030
393 Ga0500594_0036784 3300053118 Bacteria 1319
394 Ga0500597_068977 3300053120 Bacteria 1527
395 Ga0500618_025736 3300053125 Bacteria 1409
396 Ga0500642_0000467 3300053130 Bacteria 12599
397 Ga0500642_0031207 3300053130 Bacteria 2224
398 Ga0500642_0033388 3300053130 Bacteria 2168
399 Ga0500642_0152101 3300053130 Bacteria 1086
400 Ga0500655_000326 3300053133 Bacteria 10469
401 Ga0500658_0000942 3300053134 Bacteria 11874
402 Ga0500658_0001301 3300053134 Bacteria 10104
403 Ga0500658_0104450 3300053134 Bacteria 1240
404 Ga0500559_0002318 3300053136 Bacteria 9990
405 Ga0500568_0000214 3300053139 Bacteria 49688
406 Ga0500568_0004819 3300053139 Bacteria 7131
407 Ga0500574_000588 3300053141 Bacteria 4694
408 Ga0500577_0092652 3300053142 Bacteria 1224
409 Ga0500577_0209682 3300053142 Bacteria 842
410 Ga0500588_0006486 3300053146 Bacteria 2655
411 Ga0500616_0000073 3300053153 Bacteria 231290
412 Ga0500616_0037840 3300053153 Bacteria 2609
413 Ga0500619_000275 3300053154 Bacteria 10588
414 Ga0500609_000542 3300053731 Bacteria 5697
415 Ga0501084_0010337 3300054114 Bacteria 7722
416 Ga0501084_0011365 3300054114 Bacteria 7373
417 Ga0501084_0027410 3300054114 Bacteria 4760
418 Ga0501084_0230243 3300054114 Bacteria 1564
419 Ga0501084_0294697 3300054114 Bacteria 1370
420 Ga0501084_0364229 3300054114 Bacteria 1222
421 Ga0590071_058856 3300059421 Bacteria 937
422 Ga0501082_0000715 3300060353 Bacteria 29183
423 Ga0501082_0004403 3300060353 Bacteria 12298
424 Ga0501082_0011886 3300060353 Bacteria 7483
425 Ga0501082_0098132 3300060353 Bacteria 2533
426 Ga0501082_0345170 3300060353 Bacteria 1297
427 Ga0501082_0670075 3300060353 Bacteria 908
428 Ga0530510_0000011 3300061734 Bacteria 125603
429 Ga0530510_0000366 3300061734 Bacteria 29385
430 Ga0530510_0008365 3300061734 Bacteria 7210
431 Ga0530510_0083128 3300061734 Bacteria 2332
432 Ga0530510_0205224 3300061734 Bacteria 1464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100276726 Ga0070670_1002767262 184
2 3300025925 Ga0207650_10344273 Ga0207650_103442731 184
3 3300037471 Ga0395905_1242575 Ga0395905_1242575_14_583 187
4 3300049592 Ga0501076_0543050 Ga0501076_0543050_30_599 187
5 3300048904 Ga0496101_0924772 Ga0496101_0924772_89_664 188
6 3300048918 Ga0496115_0591979 Ga0496115_0591979_13_588 188
7 3300048904 Ga0496101_0389799 Ga0496101_0389799_416_1051 198
8 3300041413 Ga0439465_0208283 Ga0439465_0208283_43_690 213
9 3300049584 Ga0501068_0132460 Ga0501068_0132460_11_655 214
10 3300050507 nmdc:mga05p37_24542_c1 nmdc:mga05p37_24542_c1_5526_6170 214
11 3300061734 Ga0530510_0205224 Ga0530510_0205224_520_1164 214
12 3300035398 Ga0316574_0553136 Ga0316574_0553136_45_695 216
13 iso_pu_bacteria 2946787523 2946787743 216
14 3300005347 Ga0070668_100000237 Ga0070668_10000023726 219
15 3300005353 Ga0070669_100161269 Ga0070669_1001612693 219
16 3300005367 Ga0070667_100000030 Ga0070667_10000003044 219
17 3300005841 Ga0068863_100000049 Ga0068863_10000004960 219
18 3300005843 Ga0068860_100428099 Ga0068860_1004280992 219
19 3300005844 Ga0068862_100082737 Ga0068862_1000827372 219
20 3300009177 Ga0105248_10146793 Ga0105248_101467932 219
21 3300025923 Ga0207681_10136950 Ga0207681_101369502 219
22 3300025972 Ga0207668_10000346 Ga0207668_100003465 219
23 3300025986 Ga0207658_10000019 Ga0207658_1000001944 219
24 3300026088 Ga0207641_10000029 Ga0207641_1000002960 219
25 3300028381 Ga0268264_10432022 Ga0268264_104320222 219
26 3300046471 Ga0495650_0001545 Ga0495650_0001545_11685_12356 219
27 3300046501 Ga0495607_0317175 Ga0495607_0317175_44_712 219
28 3300013102 Ga0157371_10063747 Ga0157371_100637472 220
29 3300013105 Ga0157369_10295360 Ga0157369_102953602 220
30 3300013306 Ga0163162_10137202 Ga0163162_101372022 220
31 3300049586 Ga0501070_0289381 Ga0501070_0289381_482_1189 223
32 3300049592 Ga0501076_0077332 Ga0501076_0077332_381_1088 223
33 3300049742 Ga0501080_0106998 Ga0501080_0106998_1654_2361 223
34 3300049822 Ga0501035_0067667 Ga0501035_0067667_59_766 223
35 3300049823 Ga0501044_0045852 Ga0501044_0045852_274_981 223
36 iso_pu_bacteria 2600255292 2601670616 223
37 iso_pu_bacteria 2671180139 2671694795 223
38 iso_pu_bacteria 2857547612 2857548039 223
39 iso_pu_bacteria 2885080285 2885084140 223
40 iso_pu_bacteria 2932410948 2932412629 223
41 iso_pu_bacteria 2932416698 2932420144 223
42 3300010375 Ga0105239_10964598 Ga0105239_109645981 224
43 3300042876 Ga0451577_0073341 Ga0451577_0073341_2197_2895 224
44 iso_pu_bacteria 2599185214 2599625209 225
45 iso_pu_bacteria 2599185226 2599673339 225
46 iso_pu_bacteria 2599185227 2599683009 225
47 iso_pu_bacteria 2599185229 2599694947 225
48 iso_pu_bacteria 2667528173 2671108711 225
49 iso_pu_bacteria 2818991446 2819600795 225
50 iso_pu_bacteria 2831265667 2831267375 225
51 iso_pu_bacteria 2838054893 2838060357 225
52 iso_pu_bacteria 2852103415 2852105542 225
53 iso_pu_bacteria 2885198086 2885198335 225
54 iso_pu_bacteria 2885211737 2885212285 225
55 iso_pu_bacteria 2899924645 2899931652 225
56 iso_pu_bacteria 2904474040 2904475594 225
57 iso_pu_bacteria 2919150387 2919151763 225
58 iso_pu_bacteria 2927143783 2927144432 225
59 iso_pu_bacteria 2928037797 2928043033 225
60 iso_pu_bacteria 2928044640 2928050308 225
61 iso_pu_bacteria 2928051484 2928056666 225
62 iso_pu_bacteria 2928064002 2928068875 225
63 iso_pu_bacteria 2928070936 2928075706 225
64 3300001979 JGI24740J21852_10023276 JGI24740J21852_100232762 226
65 3300003761 Ga0055535_1000259 Ga0055535_100025943 226
66 3300003762 Ga0055542_1000070 Ga0055542_100007096 226
67 3300003781 Ga0055536_1002088 Ga0055536_10020888 226
68 3300003791 Ga0055530_10000631 Ga0055530_1000063122 226
69 3300003791 Ga0055530_10001360 Ga0055530_100013607 226
70 3300003792 Ga0055540_1004868 Ga0055540_10048682 226
71 3300004625 Ga0055543_1001935 Ga0055543_10019353 226
72 3300004625 Ga0055543_1006993 Ga0055543_10069933 226
73 3300005539 Ga0068853_100005701 Ga0068853_1000057017 226
74 3300005578 Ga0068854_100241096 Ga0068854_1002410961 226
75 3300005834 Ga0068851_10043331 Ga0068851_100433312 226
76 3300013100 Ga0157373_10181034 Ga0157373_101810342 226
77 3300013102 Ga0157371_10025590 Ga0157371_100255901 226
78 3300013307 Ga0157372_10095380 Ga0157372_100953804 226
79 3300025228 Ga0209672_101359 Ga0209672_1013592 226
80 3300025229 Ga0209147_101085 Ga0209147_1010852 226
81 3300025242 Ga0209258_100018 Ga0209258_100018417 226
82 3300025245 Ga0207425_1000252 Ga0207425_100025214 226
83 3300025254 Ga0209148_1000030 Ga0209148_1000030417 226
84 3300025258 Ga0209129_1000114 Ga0209129_100011423 226
85 3300025263 Ga0209565_1000198 Ga0209565_100019823 226
86 3300025263 Ga0209565_1005929 Ga0209565_10059293 226
87 3300025273 Ga0209673_1000216 Ga0209673_100021645 226
88 3300025273 Ga0209673_1000481 Ga0209673_100048123 226
89 3300025284 Ga0209130_1000256 Ga0209130_100025626 226
90 3300025284 Ga0209130_1000364 Ga0209130_10003646 226
91 3300025291 Ga0209675_1012905 Ga0209675_10129052 226
92 3300025292 Ga0209676_1000004 Ga0209676_1000004666 226
93 3300025292 Ga0209676_1002913 Ga0209676_10029136 226
94 3300025294 Ga0209025_1000682 Ga0209025_100068233 226
95 3300025295 Ga0209564_1000070 Ga0209564_100007098 226
96 3300025295 Ga0209564_1000295 Ga0209564_100029562 226
97 3300025297 Ga0209758_1000180 Ga0209758_100018023 226
98 3300025297 Ga0209758_1003915 Ga0209758_100391510 226
99 3300025298 Ga0209050_1000002 Ga0209050_10000021176 226
100 3300025298 Ga0209050_1000270 Ga0209050_100027059 226
101 3300025299 Ga0209256_1000047 Ga0209256_1000047110 226
102 3300025299 Ga0209256_1000157 Ga0209256_100015796 226
103 3300025302 Ga0207426_1000184 Ga0207426_1000184110 226
104 3300025302 Ga0207426_1000204 Ga0207426_100020496 226
105 3300025303 Ga0209051_1000002 Ga0209051_1000002945 226
106 3300025303 Ga0209051_1001891 Ga0209051_100189112 226
107 3300025303 Ga0209051_1020417 Ga0209051_10204173 226
108 3300025304 Ga0209257_1000002 Ga0209257_10000021086 226
109 3300025304 Ga0209257_1000938 Ga0209257_100093814 226
110 3300025321 Ga0207656_10028023 Ga0207656_100280232 226
111 3300025913 Ga0207695_10330065 Ga0207695_103300652 226
112 3300038443 Ga0395901_0001718 Ga0395901_0001718_15769_16461 226
113 3300044658 Ga0466972_0000088 Ga0466972_0000088_28701_29393 226
114 3300048921 Ga0496118_0007105 Ga0496118_0007105_877_1566 226
115 3300048928 Ga0496125_0015591 Ga0496125_0015591_3999_4688 226
116 3300050496 nmdc:mga07m45_92605_c1 nmdc:mga07m45_92605_c1_484_1173 226
117 iso_pu_bacteria 2738541277 2738723349 226
118 iso_pu_bacteria 2738543019 2739284080 226
119 3300005347 Ga0070668_100720746 Ga0070668_1007207461 227
120 3300005458 Ga0070681_10546423 Ga0070681_105464231 227
121 3300005467 Ga0070706_100827013 Ga0070706_1008270131 227
122 3300005548 Ga0070665_100042956 Ga0070665_1000429563 227
123 3300005844 Ga0068862_100231458 Ga0068862_1002314583 227
124 3300005937 Ga0081455_10000505 Ga0081455_100005059 227
125 3300005985 Ga0081539_10000028 Ga0081539_10000028253 227
126 3300009553 Ga0105249_10029306 Ga0105249_100293063 227
127 3300014497 Ga0182008_10001193 Ga0182008_100011934 227
128 3300015261 Ga0182006_1000046 Ga0182006_100004610 227
129 3300015262 Ga0182007_10000044 Ga0182007_1000004492 227
130 3300015265 Ga0182005_1000032 Ga0182005_100003210 227
131 3300017792 Ga0163161_10136519 Ga0163161_101365192 227
132 3300025961 Ga0207712_10012020 Ga0207712_100120203 227
133 3300025972 Ga0207668_10578799 Ga0207668_105787991 227
134 3300028786 Ga0307517_10142692 Ga0307517_101426922 227
135 3300038742 Ga0400486_16978 Ga0400486_16978_2031_2729 227
136 3300042876 Ga0451577_0375717 Ga0451577_0375717_417_1100 227
137 3300046558 Ga0495633_0000756 Ga0495633_0000756_15135_15830 227
138 3300048914 Ga0496111_0068931 Ga0496111_0068931_1449_2144 227
139 3300048920 Ga0496117_0000010 Ga0496117_0000010_12544_13239 227
140 3300048921 Ga0496118_0000009 Ga0496118_0000009_598716_599411 227
141 3300048924 Ga0496121_0003180 Ga0496121_0003180_22031_22726 227
142 3300048924 Ga0496121_0052596 Ga0496121_0052596_914_1609 227
143 3300048925 Ga0496122_0002845 Ga0496122_0002845_14882_15577 227
144 3300048926 Ga0496123_0015202 Ga0496123_0015202_1390_2085 227
145 3300048928 Ga0496125_0236423 Ga0496125_0236423_405_1100 227
146 3300049460 Ga0495682_0003050 Ga0495682_0003050_1173_1868 227
147 3300049568 Ga0501031_0323533 Ga0501031_0323533_94_777 227
148 3300049570 Ga0501033_0023091 Ga0501033_0023091_2014_2697 227
149 3300049574 Ga0501038_0236136 Ga0501038_0236136_289_972 227
150 3300049575 Ga0501039_0202654 Ga0501039_0202654_714_1397 227
151 3300049576 Ga0501040_0068104 Ga0501040_0068104_1374_2057 227
152 3300049577 Ga0501041_0001547 Ga0501041_0001547_3401_4084 227
153 3300049578 Ga0501042_0007204 Ga0501042_0007204_2268_2951 227
154 3300049581 Ga0501047_0137931 Ga0501047_0137931_1181_1873 227
155 3300049582 Ga0501048_0050682 Ga0501048_0050682_392_1075 227
156 3300049586 Ga0501070_0537620 Ga0501070_0537620_210_902 227
157 3300049587 Ga0501071_0007420 Ga0501071_0007420_270_953 227
158 3300049588 Ga0501072_0001322 Ga0501072_0001322_2353_3036 227
159 3300049589 Ga0501073_0279252 Ga0501073_0279252_73_765 227
160 3300049590 Ga0501074_0250628 Ga0501074_0250628_135_818 227
161 3300049590 Ga0501074_0365749 Ga0501074_0365749_96_788 227
162 3300049591 Ga0501075_0016033 Ga0501075_0016033_944_1627 227
163 3300049592 Ga0501076_0002518 Ga0501076_0002518_9763_10446 227
164 3300049593 Ga0501077_0048736 Ga0501077_0048736_1652_2335 227
165 3300049741 Ga0501079_0000593 Ga0501079_0000593_12522_13205 227
166 3300049742 Ga0501080_0004945 Ga0501080_0004945_10985_11668 227
167 3300049743 Ga0501081_0112301 Ga0501081_0112301_641_1324 227
168 3300049744 Ga0501083_0089500 Ga0501083_0089500_209_901 227
169 3300049823 Ga0501044_0229148 Ga0501044_0229148_1060_1752 227
170 3300049823 Ga0501044_0366640 Ga0501044_0366640_336_1019 227
171 3300049824 Ga0501045_0000080 Ga0501045_0000080_17643_18326 227
172 3300053092 Ga0500583_0205717 Ga0500583_0205717_260_943 227
173 3300053104 Ga0500556_0178542 Ga0500556_0178542_127_810 227
174 3300053130 Ga0500642_0152101 Ga0500642_0152101_330_1013 227
175 3300053134 Ga0500658_0104450 Ga0500658_0104450_13_696 227
176 3300053146 Ga0500588_0006486 Ga0500588_0006486_85_768 227
177 3300053153 Ga0500616_0000073 Ga0500616_0000073_27373_28056 227
178 3300054114 Ga0501084_0011365 Ga0501084_0011365_6366_7049 227
179 3300060353 Ga0501082_0011886 Ga0501082_0011886_1106_1789 227
180 3300061734 Ga0530510_0000366 Ga0530510_0000366_27378_28061 227
181 3300005365 Ga0070688_100360996 Ga0070688_1003609962 228
182 3300005455 Ga0070663_100586393 Ga0070663_1005863931 228
183 3300005719 Ga0068861_100321888 Ga0068861_1003218882 228
184 3300006852 Ga0075433_10073463 Ga0075433_100734633 228
185 3300009093 Ga0105240_10179658 Ga0105240_101796583 228
186 3300009147 Ga0114129_10001797 Ga0114129_1000179720 228
187 3300009148 Ga0105243_10110231 Ga0105243_101102312 228
188 3300009177 Ga0105248_10858993 Ga0105248_108589931 228
189 3300014969 Ga0157376_10027877 Ga0157376_100278773 228
190 3300025933 Ga0207706_10255671 Ga0207706_102556712 228
191 3300025935 Ga0207709_10017215 Ga0207709_100172154 228
192 3300025941 Ga0207711_10207462 Ga0207711_102074621 228
193 3300025961 Ga0207712_10155060 Ga0207712_101550602 228
194 3300026118 Ga0207675_100062254 Ga0207675_1000622542 228
195 3300031238 Ga0265332_10005619 Ga0265332_100056194 228
196 3300031238 Ga0265332_10223075 Ga0265332_102230751 228
197 3300035090 Ga0373949_0000002 Ga0373949_0000002_19260_19946 228
198 3300035090 Ga0373949_0012879 Ga0373949_0012879_424_1110 228
199 3300039453 Ga0436362_1196005 Ga0436362_1196005_876_1577 228
200 3300042436 Ga0439435_0041383 Ga0439435_0041383_523_1209 228
201 3300044735 Ga0466968_0045337 Ga0466968_0045337_792_1517 228
202 3300046512 Ga0495610_0000116 Ga0495610_0000116_72652_73359 228
203 3300046517 Ga0495630_0312647 Ga0495630_0312647_63_749 228
204 3300046522 Ga0495643_0000048 Ga0495643_0000048_23193_23900 228
205 3300048904 Ga0496101_0047879 Ga0496101_0047879_702_1394 228
206 3300048909 Ga0496106_0189721 Ga0496106_0189721_710_1396 228
207 3300048917 Ga0496114_0560204 Ga0496114_0560204_12_698 228
208 3300048918 Ga0496115_0000043 Ga0496115_0000043_49705_50391 228
209 3300048921 Ga0496118_0014810 Ga0496118_0014810_1341_2027 228
210 3300048929 Ga0496126_0000087 Ga0496126_0000087_66319_67005 228
211 3300049569 Ga0501032_0237286 Ga0501032_0237286_108_794 228
212 3300049570 Ga0501033_0045988 Ga0501033_0045988_826_1512 228
213 3300049570 Ga0501033_0114137 Ga0501033_0114137_258_944 228
214 3300049570 Ga0501033_0528471 Ga0501033_0528471_29_715 228
215 3300049571 Ga0501034_0211224 Ga0501034_0211224_1058_1762 228
216 3300049572 Ga0501036_0001534 Ga0501036_0001534_1081_1767 228
217 3300049572 Ga0501036_0047451 Ga0501036_0047451_1573_2259 228
218 3300049572 Ga0501036_0154321 Ga0501036_0154321_680_1366 228
219 3300049573 Ga0501037_0118091 Ga0501037_0118091_54_740 228
220 3300049573 Ga0501037_0283527 Ga0501037_0283527_325_1011 228
221 3300049574 Ga0501038_0003980 Ga0501038_0003980_2124_2810 228
222 3300049574 Ga0501038_0146340 Ga0501038_0146340_284_970 228
223 3300049575 Ga0501039_0002072 Ga0501039_0002072_7729_8415 228
224 3300049575 Ga0501039_0053743 Ga0501039_0053743_979_1665 228
225 3300049575 Ga0501039_0224523 Ga0501039_0224523_67_753 228
226 3300049575 Ga0501039_0658967 Ga0501039_0658967_42_728 228
227 3300049576 Ga0501040_0000193 Ga0501040_0000193_6543_7241 228
228 3300049576 Ga0501040_0000673 Ga0501040_0000673_10591_11277 228
229 3300049576 Ga0501040_0038914 Ga0501040_0038914_2521_3207 228
230 3300049576 Ga0501040_0528535 Ga0501040_0528535_105_791 228
231 3300049577 Ga0501041_0000915 Ga0501041_0000915_4327_5013 228
232 3300049577 Ga0501041_0128541 Ga0501041_0128541_110_796 228
233 3300049577 Ga0501041_0170836 Ga0501041_0170836_49_744 228
234 3300049578 Ga0501042_0000004 Ga0501042_0000004_25697_26383 228
235 3300049578 Ga0501042_0002828 Ga0501042_0002828_494_1180 228
236 3300049578 Ga0501042_0015060 Ga0501042_0015060_3621_4319 228
237 3300049578 Ga0501042_0029951 Ga0501042_0029951_352_1038 228
238 3300049578 Ga0501042_0109151 Ga0501042_0109151_551_1237 228
239 3300049580 Ga0501046_0004070 Ga0501046_0004070_841_1527 228
240 3300049580 Ga0501046_0305876 Ga0501046_0305876_312_998 228
241 3300049581 Ga0501047_0704750 Ga0501047_0704750_41_745 228
242 3300049582 Ga0501048_0008139 Ga0501048_0008139_3617_4303 228
243 3300049586 Ga0501070_0059509 Ga0501070_0059509_1595_2281 228
244 3300049587 Ga0501071_0002919 Ga0501071_0002919_6219_6905 228
245 3300049588 Ga0501072_0000948 Ga0501072_0000948_18802_19488 228
246 3300049588 Ga0501072_0010132 Ga0501072_0010132_3826_4512 228
247 3300049590 Ga0501074_0012019 Ga0501074_0012019_4026_4712 228
248 3300049590 Ga0501074_0086632 Ga0501074_0086632_922_1608 228
249 3300049591 Ga0501075_0000559 Ga0501075_0000559_2930_3616 228
250 3300049591 Ga0501075_0000585 Ga0501075_0000585_11086_11772 228
251 3300049591 Ga0501075_0070702 Ga0501075_0070702_356_1042 228
252 3300049591 Ga0501075_0128168 Ga0501075_0128168_659_1345 228
253 3300049591 Ga0501075_0155595 Ga0501075_0155595_761_1447 228
254 3300049592 Ga0501076_0000047 Ga0501076_0000047_1312_1998 228
255 3300049592 Ga0501076_0008901 Ga0501076_0008901_6321_7007 228
256 3300049592 Ga0501076_0012244 Ga0501076_0012244_3815_4501 228
257 3300049592 Ga0501076_0091600 Ga0501076_0091600_1461_2147 228
258 3300049593 Ga0501077_0002705 Ga0501077_0002705_3862_4548 228
259 3300049593 Ga0501077_0020086 Ga0501077_0020086_1625_2311 228
260 3300049593 Ga0501077_0151056 Ga0501077_0151056_314_1009 228
261 3300049593 Ga0501077_0175413 Ga0501077_0175413_10_696 228
262 3300049593 Ga0501077_0250369 Ga0501077_0250369_45_731 228
263 3300049741 Ga0501079_0002634 Ga0501079_0002634_9841_10527 228
264 3300049741 Ga0501079_0015886 Ga0501079_0015886_3752_4447 228
265 3300049741 Ga0501079_0045363 Ga0501079_0045363_609_1295 228
266 3300049741 Ga0501079_0503297 Ga0501079_0503297_56_742 228
267 3300049742 Ga0501080_0001160 Ga0501080_0001160_19707_20393 228
268 3300049742 Ga0501080_0197854 Ga0501080_0197854_1026_1712 228
269 3300049743 Ga0501081_0000076 Ga0501081_0000076_31655_32341 228
270 3300049743 Ga0501081_0015896 Ga0501081_0015896_2716_3402 228
271 3300049743 Ga0501081_0045620 Ga0501081_0045620_40_726 228
272 3300049743 Ga0501081_0045854 Ga0501081_0045854_508_1203 228
273 3300049743 Ga0501081_0118129 Ga0501081_0118129_995_1681 228
274 3300049744 Ga0501083_0006955 Ga0501083_0006955_5840_6526 228
275 3300049744 Ga0501083_0102166 Ga0501083_0102166_524_1210 228
276 3300049744 Ga0501083_0178062 Ga0501083_0178062_383_1072 228
277 3300049822 Ga0501035_0004917 Ga0501035_0004917_8282_8968 228
278 3300049822 Ga0501035_0077815 Ga0501035_0077815_1070_1756 228
279 3300049824 Ga0501045_0000180 Ga0501045_0000180_23526_24212 228
280 3300049824 Ga0501045_0028394 Ga0501045_0028394_3131_3817 228
281 3300049824 Ga0501045_0174699 Ga0501045_0174699_317_1003 228
282 3300049824 Ga0501045_0197205 Ga0501045_0197205_649_1335 228
283 3300050512 nmdc:mga0n895_119735_c1 nmdc:mga0n895_119735_c1_1603_2289 228
284 3300050512 nmdc:mga0n895_1204813_c1 nmdc:mga0n895_1204813_c1_32_718 228
285 3300050515 nmdc:mga0a205_90738_c1 nmdc:mga0a205_90738_c1_679_1365 228
286 3300053130 Ga0500642_0031207 Ga0500642_0031207_817_1503 228
287 3300054114 Ga0501084_0010337 Ga0501084_0010337_3760_4446 228
288 3300054114 Ga0501084_0027410 Ga0501084_0027410_3443_4129 228
289 3300054114 Ga0501084_0230243 Ga0501084_0230243_140_826 228
290 3300054114 Ga0501084_0294697 Ga0501084_0294697_333_1019 228
291 3300054114 Ga0501084_0364229 Ga0501084_0364229_251_937 228
292 3300060353 Ga0501082_0000715 Ga0501082_0000715_4932_5618 228
293 3300060353 Ga0501082_0004403 Ga0501082_0004403_285_971 228
294 3300060353 Ga0501082_0098132 Ga0501082_0098132_1298_1993 228
295 3300060353 Ga0501082_0345170 Ga0501082_0345170_109_795 228
296 3300060353 Ga0501082_0670075 Ga0501082_0670075_33_719 228
297 3300061734 Ga0530510_0000011 Ga0530510_0000011_58562_59248 228
298 3300061734 Ga0530510_0008365 Ga0530510_0008365_6147_6833 228
299 3300061734 Ga0530510_0083128 Ga0530510_0083128_698_1384 228
300 iso_pu_bacteria 2513020051 2513231146 228
301 iso_pu_bacteria 2643221658 2644328360 228
302 iso_pu_bacteria 2643221672 2644397522 228
303 iso_pu_bacteria 8045864390 8045864913 228
304 2162886007 SwRhRL2b_contig_2267015 SwRhRL2b_0115.00001150 229
305 3300002771 JGI25163J39215_1000079 JGI25163J39215_100007941 229
306 3300002772 JGI25164J39214_1000011 JGI25164J39214_100001172 229
307 3300003751 Ga0055538_1000021 Ga0055538_100002172 229
308 3300003752 Ga0055539_1000026 Ga0055539_1000026202 229
309 3300003756 Ga0055533_1000035 Ga0055533_100003572 229
310 3300003759 Ga0055525_1000045 Ga0055525_100004572 229
311 3300003781 Ga0055536_1002437 Ga0055536_10024379 229
312 3300003781 Ga0055536_1005927 Ga0055536_10059271 229
313 3300003791 Ga0055530_10029523 Ga0055530_100295232 229
314 3300003792 Ga0055540_1002470 Ga0055540_10024701 229
315 3300003794 Ga0055531_10003640 Ga0055531_100036401 229
316 3300003841 Ga0055541_1000020 Ga0055541_100002072 229
317 3300005289 Ga0065704_10002330 Ga0065704_100023305 229
318 3300005356 Ga0070674_100015739 Ga0070674_1000157394 229
319 3300005457 Ga0070662_100006050 Ga0070662_1000060503 229
320 3300005457 Ga0070662_100076447 Ga0070662_1000764471 229
321 3300005459 Ga0068867_100303406 Ga0068867_1003034062 229
322 3300005614 Ga0068856_100422587 Ga0068856_1004225871 229
323 3300005616 Ga0068852_100107223 Ga0068852_1001072233 229
324 3300005616 Ga0068852_100489100 Ga0068852_1004891001 229
325 3300005844 Ga0068862_100028395 Ga0068862_1000283954 229
326 3300006178 Ga0075367_10131569 Ga0075367_101315691 229
327 3300006237 Ga0097621_100912157 Ga0097621_1009121571 229
328 3300006353 Ga0075370_10045763 Ga0075370_100457631 229
329 3300006358 Ga0068871_100466603 Ga0068871_1004666032 229
330 3300006881 Ga0068865_100093176 Ga0068865_1000931762 229
331 3300009011 Ga0105251_10202746 Ga0105251_102027461 229
332 3300009036 Ga0105244_10008823 Ga0105244_100088235 229
333 3300009036 Ga0105244_10013277 Ga0105244_100132775 229
334 3300009036 Ga0105244_10088239 Ga0105244_100882392 229
335 3300009147 Ga0114129_10357593 Ga0114129_103575932 229
336 3300009148 Ga0105243_10023953 Ga0105243_100239534 229
337 3300009545 Ga0105237_10012511 Ga0105237_100125117 229
338 3300009553 Ga0105249_10296849 Ga0105249_102968492 229
339 3300009553 Ga0105249_10432951 Ga0105249_104329511 229
340 3300011119 Ga0105246_10033411 Ga0105246_100334112 229
341 3300011119 Ga0105246_10086673 Ga0105246_100866732 229
342 3300013105 Ga0157369_10008608 Ga0157369_100086088 229
343 3300013306 Ga0163162_10013248 Ga0163162_100132486 229
344 3300013306 Ga0163162_10712629 Ga0163162_107126292 229
345 3300014326 Ga0157380_10001074 Ga0157380_100010748 229
346 3300014497 Ga0182008_10009757 Ga0182008_100097575 229
347 3300014969 Ga0157376_10046135 Ga0157376_100461351 229
348 3300015261 Ga0182006_1008851 Ga0182006_10088513 229
349 3300015262 Ga0182007_10006468 Ga0182007_100064683 229
350 3300017792 Ga0163161_10016120 Ga0163161_100161202 229
351 3300025207 Ga0209760_100004 Ga0209760_10000472 229
352 3300025224 Ga0209784_100001 Ga0209784_1000012517 229
353 3300025225 Ga0209566_100001 Ga0209566_1000012517 229
354 3300025226 Ga0209674_100002 Ga0209674_1000022517 229
355 3300025230 Ga0209563_100002 Ga0209563_1000021052 229
356 3300025231 Ga0207427_100012 Ga0207427_100012299 229
357 3300025233 Ga0209437_100001 Ga0209437_1000011052 229
358 3300025253 Ga0209677_100002 Ga0209677_1000021052 229
359 3300025261 Ga0209233_1008568 Ga0209233_10085683 229
360 3300025292 Ga0209676_1001531 Ga0209676_100153112 229
361 3300025298 Ga0209050_1000715 Ga0209050_10007159 229
362 3300025298 Ga0209050_1018831 Ga0209050_10188312 229
363 3300025303 Ga0209051_1000523 Ga0209051_100052335 229
364 3300025304 Ga0209257_1000149 Ga0209257_1000149130 229
365 3300025711 Ga0207696_1000298 Ga0207696_10002987 229
366 3300025728 Ga0207655_1000229 Ga0207655_100022910 229
367 3300025728 Ga0207655_1002184 Ga0207655_10021843 229
368 3300025735 Ga0207713_1116474 Ga0207713_11164741 229
369 3300025914 Ga0207671_10033214 Ga0207671_100332142 229
370 3300025923 Ga0207681_10061832 Ga0207681_100618322 229
371 3300025924 Ga0207694_10356934 Ga0207694_103569341 229
372 3300025933 Ga0207706_10005474 Ga0207706_100054743 229
373 3300025933 Ga0207706_10118411 Ga0207706_101184112 229
374 3300025935 Ga0207709_10014044 Ga0207709_100140443 229
375 3300025937 Ga0207669_10004937 Ga0207669_100049374 229
376 3300025938 Ga0207704_10117938 Ga0207704_101179383 229
377 3300025938 Ga0207704_10536507 Ga0207704_105365071 229
378 3300026067 Ga0207678_10401908 Ga0207678_104019082 229
379 3300026116 Ga0207674_10079702 Ga0207674_100797023 229
380 3300026118 Ga0207675_100069161 Ga0207675_1000691611 229
381 3300026118 Ga0207675_100117298 Ga0207675_1001172984 229
382 3300026142 Ga0207698_10376361 Ga0207698_103763612 229
383 3300028381 Ga0268264_10759151 Ga0268264_107591511 229
384 3300031548 Ga0307408_100769714 Ga0307408_1007697141 229
385 3300031691 Ga0316579_10141607 Ga0316579_101416071 229
386 3300031731 Ga0307405_10160431 Ga0307405_101604312 229
387 3300031903 Ga0307407_10143311 Ga0307407_101433112 229
388 3300031995 Ga0307409_100202458 Ga0307409_1002024581 229
389 3300032004 Ga0307414_10363402 Ga0307414_103634022 229
390 3300032133 Ga0316583_10079676 Ga0316583_100796762 229
391 3300035242 Ga0373962_0166217 Ga0373962_0166217_28_720 229
392 3300035398 Ga0316574_0000501 Ga0316574_0000501_11729_12442 229
393 3300037312 Ga0395899_0000315 Ga0395899_0000315_48511_49221 229
394 3300039450 Ga0436363_0281235 Ga0436363_0281235_316_1023 229
395 3300042876 Ga0451577_0006533 Ga0451577_0006533_8407_9108 229
396 3300044712 Ga0453684_0273356 Ga0453684_0273356_87_788 229
397 3300046460 Ga0495638_0007560 Ga0495638_0007560_6967_7671 229
398 3300046471 Ga0495650_0000182 Ga0495650_0000182_78854_79543 229
399 3300046512 Ga0495610_0026102 Ga0495610_0026102_2271_2975 229
400 3300046513 Ga0495616_0001319 Ga0495616_0001319_1379_2083 229
401 3300046518 Ga0495631_0000067 Ga0495631_0000067_49059_49763 229
402 3300046520 Ga0495637_0011583 Ga0495637_0011583_2465_3169 229
403 3300046524 Ga0495648_0027461 Ga0495648_0027461_219_929 229
404 3300046530 Ga0495654_0014848 Ga0495654_0014848_1758_2462 229
405 3300046616 Ga0495668_0221763 Ga0495668_0221763_207_911 229
406 3300046660 Ga0495625_0146067 Ga0495625_0146067_90_794 229
407 3300046663 Ga0495635_0414736 Ga0495635_0414736_107_811 229
408 3300046674 Ga0495588_0030556 Ga0495588_0030556_274_978 229
409 3300046674 Ga0495588_0033946 Ga0495588_0033946_861_1565 229
410 3300046683 Ga0495658_0065521 Ga0495658_0065521_723_1427 229
411 3300047321 Ga0495676_0021899 Ga0495676_0021899_4733_5437 229
412 3300047673 Ga0495593_0062809 Ga0495593_0062809_1058_1762 229
413 3300048088 Ga0495602_0208718 Ga0495602_0208718_88_792 229
414 3300048089 Ga0495614_0001725 Ga0495614_0001725_5428_6132 229
415 3300048905 Ga0496102_0399091 Ga0496102_0399091_425_1123 229
416 3300048907 Ga0496104_0025440 Ga0496104_0025440_1613_2302 229
417 3300048919 Ga0496116_0000094 Ga0496116_0000094_73435_74124 229
418 3300048919 Ga0496116_0035776 Ga0496116_0035776_85_783 229
419 3300048919 Ga0496116_0038081 Ga0496116_0038081_527_1231 229
420 3300048920 Ga0496117_0009586 Ga0496117_0009586_2781_3485 229
421 3300048920 Ga0496117_0013513 Ga0496117_0013513_1600_2289 229
422 3300048920 Ga0496117_0120922 Ga0496117_0120922_867_1565 229
423 3300048921 Ga0496118_0007512 Ga0496118_0007512_7037_7726 229
424 3300048921 Ga0496118_0035253 Ga0496118_0035253_158_856 229
425 3300048922 Ga0496119_0015133 Ga0496119_0015133_5120_5809 229
426 3300048923 Ga0496120_0003422 Ga0496120_0003422_5361_6050 229
427 3300048924 Ga0496121_0035821 Ga0496121_0035821_33_737 229
428 3300048924 Ga0496121_0050491 Ga0496121_0050491_1864_2568 229
429 3300048925 Ga0496122_0000007 Ga0496122_0000007_310945_311634 229
430 3300048925 Ga0496122_0050211 Ga0496122_0050211_1541_2245 229
431 3300048925 Ga0496122_0221802 Ga0496122_0221802_72_776 229
432 3300048926 Ga0496123_0000004 Ga0496123_0000004_465596_466285 229
433 3300048926 Ga0496123_0060579 Ga0496123_0060579_1509_2213 229
434 3300048926 Ga0496123_0091541 Ga0496123_0091541_760_1464 229
435 3300048927 Ga0496124_0000025 Ga0496124_0000025_172575_173264 229
436 3300048927 Ga0496124_0020244 Ga0496124_0020244_1611_2309 229
437 3300048928 Ga0496125_0000013 Ga0496125_0000013_269813_270502 229
438 3300048928 Ga0496125_0128280 Ga0496125_0128280_54_758 229
439 3300048928 Ga0496125_0293406 Ga0496125_0293406_151_855 229
440 3300048929 Ga0496126_0000276 Ga0496126_0000276_73677_74366 229
441 3300050496 nmdc:mga07m45_46112_c1 nmdc:mga07m45_46112_c1_1584_2282 229
442 3300050507 nmdc:mga05p37_195161_c1 nmdc:mga05p37_195161_c1_848_1549 229
443 3300053087 Ga0500643_012896 Ga0500643_012896_1988_2692 229
444 3300053090 Ga0500646_0022814 Ga0500646_0022814_869_1558 229
445 3300053093 Ga0500651_0000040 Ga0500651_0000040_46812_47516 229
446 3300053094 Ga0500566_0036884 Ga0500566_0036884_136_840 229
447 3300053110 Ga0500571_000092 Ga0500571_000092_3479_4183 229
448 3300053118 Ga0500594_0036784 Ga0500594_0036784_615_1304 229
449 3300053120 Ga0500597_068977 Ga0500597_068977_610_1314 229
450 3300053125 Ga0500618_025736 Ga0500618_025736_516_1220 229
451 3300053130 Ga0500642_0000467 Ga0500642_0000467_6578_7267 229
452 3300053130 Ga0500642_0033388 Ga0500642_0033388_1076_1765 229
453 3300053133 Ga0500655_000326 Ga0500655_000326_2471_3175 229
454 3300053134 Ga0500658_0000942 Ga0500658_0000942_5213_5917 229
455 3300053134 Ga0500658_0001301 Ga0500658_0001301_3473_4177 229
456 3300053136 Ga0500559_0002318 Ga0500559_0002318_6265_6969 229
457 3300053139 Ga0500568_0000214 Ga0500568_0000214_41060_41764 229
458 3300053139 Ga0500568_0004819 Ga0500568_0004819_1640_2329 229
459 3300053141 Ga0500574_000588 Ga0500574_000588_2865_3569 229
460 3300053142 Ga0500577_0092652 Ga0500577_0092652_387_1094 229
461 3300053142 Ga0500577_0209682 Ga0500577_0209682_90_797 229
462 3300053153 Ga0500616_0037840 Ga0500616_0037840_1055_1759 229
463 3300053154 Ga0500619_000275 Ga0500619_000275_8669_9367 229
464 3300053731 Ga0500609_000542 Ga0500609_000542_4660_5349 229
465 3300059421 Ga0590071_058856 Ga0590071_058856_74_775 229
466 iso_pu_bacteria 2574179768 2574429996 229
467 iso_pu_bacteria 2738541307 2738883004 229
468 iso_pu_bacteria 2883291878 2883295409 229
469 iso_pu_bacteria 2928084124 2928090239 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

61

263

0.96

PF08279

HTH_11

HTH domain

6

57

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4maq-assembly1.cif.gz_B crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9867 1 228
4maq-assembly1.cif.gz_A crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9777 2 228
6j5y-assembly1.cif.gz_A crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate 0.9751 3 229
6j5y-assembly1.cif.gz_A crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate 0.9626 3 229
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9592 25 228
ID Description Score Start End Superfamily
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9777 2 228 3.90.850.10
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9562 2 228 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9533 25 228 3.90.850.10
af_A4IBF4_2_274_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9522 3 229 3.90.850.10
af_P34673_5_211_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9425 25 226 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A226WXR6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9931 84 227 GO:0018773
GO:0046872
AF-A0A0E1UZ23-F1-model_v4 deleted 0.9921 1 180
AF-A0A5J6ML05-F1-model_v4 Fumarylacetoacetase 0.9896 2 229 GO:0018773
GO:0046872
AF-A0A1R3U2A7-F1-model_v4 Fumarylpyruvate hydrolase (EC 3.7.1.5) 0.9886 1 229 GO:0018773
GO:0046872
GO:0047621
AF-W9T2P7-F1-model_v4 Putative fumarylpyruvate hydrolase 0.9879 113 228 GO:0018773
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.21 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map