F450220

General Info

Members Datasets Scaffolds Average Seq Length
469 270 457 477

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10044911|Ga0105251_100449112
Length 512
Sequence VFLFHHGNPHPAKPVISHCPVYGDVGGNSVGMTSTQSRTGGLEIRSIDYVPLSERHGKVWHLGPLWFMSNAQIATLAVGLISITEGASLFWSVLAIVVGVLIGTLFMAFHSAQGPQLGLPQMIQSRPQFGYIGALLVWLFAYVQYAGFNVFNTILGGEAMSTTAHGPVKLWVVILTVVALVIALVGYDLIHKAEQWLTYLMIVIFGIFTITLFFIHYPAGTFDVGTFKASPFLGQFGVVAGYQISWAIYVSDYSRYLPPDVTVRKTFYWTYWGSAIGGGWMMIVGAVLAAWAGKNFDGTGIAELNQVGDHVFTGFGAVVLILATLGLVSVTALNMYGGSLTLISAVDSFRKVRPTLGLRVVTVGLTALLSLVGALAATKNFLGNFNNFLLLVLYLFIPWTAVNLVDYYIVRRGHYAIAEIFNPHGMYGRWGWRGILAYLIGFAAMVPFFDVGTLYEGPAASALGGADISFFVGLPVAGVLYYVFTRSVDVAAETRVAEAEAAELEEAAQRHR

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
3 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
4 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
5 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
6 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
7 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
8 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
9 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
265 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
266 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
269 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
270 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0.21
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 10.87
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 6.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013172 3300001989 Bacteria 3025
2 rootH2_10034612 3300003320 Bacteria 6066
3 Ga0070658_10000298 3300005327 Bacteria 43158
4 Ga0070658_10093303 3300005327 Bacteria 2483
5 Ga0068869_100017408 3300005334 Bacteria 4869
6 Ga0070682_100013983 3300005337 Bacteria 4630
7 Ga0070689_100026963 3300005340 Bacteria 4329
8 Ga0070691_10012085 3300005341 Bacteria 3953
9 Ga0070692_10051857 3300005345 Bacteria 2135
10 Ga0070671_100165675 3300005355 Bacteria 1869
11 Ga0070688_100029656 3300005365 Bacteria 3277
12 Ga0070713_100202039 3300005436 Bacteria 1795
13 Ga0070710_10001338 3300005437 Bacteria 11626
14 Ga0070710_10004600 3300005437 Bacteria 6522
15 Ga0070710_10084109 3300005437 Bacteria 1864
16 Ga0070705_100020248 3300005440 Bacteria 3516
17 Ga0070700_100020058 3300005441 Bacteria 3866
18 Ga0070694_100089544 3300005444 Bacteria 2156
19 Ga0070678_100064079 3300005456 Bacteria 2722
20 Ga0070681_10043150 3300005458 Bacteria 4518
21 Ga0070706_100009962 3300005467 Bacteria 8828
22 Ga0070706_100015730 3300005467 Bacteria 6989
23 Ga0070698_100030089 3300005471 Bacteria 5633
24 Ga0070699_100264724 3300005518 Bacteria 1538
25 Ga0070679_100023816 3300005530 Bacteria 5998
26 Ga0070684_100076569 3300005535 Bacteria 2953
27 Ga0070684_100096015 3300005535 Bacteria 2642
28 Ga0070696_100023398 3300005546 Bacteria 4199
29 Ga0070693_100021679 3300005547 Bacteria 3405
30 Ga0070693_100053062 3300005547 Bacteria 2326
31 Ga0070665_100002411 3300005548 Bacteria 20609
32 Ga0070665_100019214 3300005548 Bacteria 6856
33 Ga0070665_100058628 3300005548 Bacteria 3859
34 Ga0070704_100178898 3300005549 Bacteria 1695
35 Ga0068855_100069890 3300005563 Bacteria 4086
36 Ga0068855_100080007 3300005563 Bacteria 3790
37 Ga0070664_100049404 3300005564 Bacteria 3557
38 Ga0068856_100047809 3300005614 Bacteria 4216
39 Ga0068856_100067458 3300005614 Bacteria 3535
40 Ga0068859_100281872 3300005617 Bacteria 1755
41 Ga0068861_100067277 3300005719 Bacteria 2764
42 Ga0068861_100073266 3300005719 Bacteria 2660
43 Ga0068863_100085993 3300005841 Bacteria 2979
44 Ga0068863_100089634 3300005841 Bacteria 2916
45 Ga0068863_100167555 3300005841 Bacteria 2107
46 Ga0068860_100076262 3300005843 Bacteria 3188
47 Ga0068860_100090619 3300005843 Bacteria 2913
48 Ga0070717_10083190 3300006028 Bacteria 2690
49 Ga0070717_10168196 3300006028 Bacteria 1905
50 Ga0075365_10063651 3300006038 Bacteria 2470
51 Ga0075368_10014432 3300006042 Bacteria 2918
52 Ga0075364_10024671 3300006051 Bacteria 3820
53 Ga0070715_10006915 3300006163 Bacteria 3881
54 Ga0070715_10009124 3300006163 Bacteria 3484
55 Ga0070716_100007262 3300006173 Bacteria 5447
56 Ga0070716_100077009 3300006173 Bacteria 1978
57 Ga0070716_100098028 3300006173 Bacteria 1790
58 Ga0070712_100033700 3300006175 Bacteria 3467
59 Ga0070712_100050186 3300006175 Bacteria 2901
60 Ga0075362_10032413 3300006177 Bacteria 2267
61 Ga0075367_10029261 3300006178 Bacteria 3150
62 Ga0075369_10005688 3300006186 Bacteria 4675
63 Ga0075434_100048289 3300006871 Bacteria 4223
64 Ga0097620_100281857 3300006931 Bacteria 1755
65 Ga0105251_10044911 3300009011 Bacteria 2132
66 Ga0105240_10187837 3300009093 Bacteria 2432
67 Ga0111539_10183870 3300009094 Bacteria 2441
68 Ga0105245_10114443 3300009098 Bacteria 2512
69 Ga0105245_10183785 3300009098 Bacteria 1999
70 Ga0105247_10064345 3300009101 Bacteria 2278
71 Ga0105241_10017660 3300009174 Bacteria 5246
72 Ga0105241_10043978 3300009174 Bacteria 3383
73 Ga0105242_10090631 3300009176 Bacteria 2572
74 Ga0105248_10144168 3300009177 Bacteria 2687
75 Ga0105237_10000359 3300009545 Bacteria 64494
76 Ga0105237_10155604 3300009545 Bacteria 2282
77 Ga0099796_10033220 3300010159 Bacteria 1696
78 Ga0105246_10019361 3300011119 Bacteria 4348
79 Ga0105246_10053788 3300011119 Bacteria 2772
80 Ga0105246_10193973 3300011119 Bacteria 1574
81 Ga0157371_10000670 3300013102 Bacteria 40597
82 Ga0157370_10118015 3300013104 Bacteria 2478
83 Ga0157374_10118927 3300013296 Bacteria 2548
84 Ga0157378_10078890 3300013297 Bacteria 2971
85 Ga0157378_10144100 3300013297 Bacteria 2215
86 Ga0163162_10009979 3300013306 Bacteria 9233
87 Ga0163162_10133291 3300013306 Bacteria 2594
88 Ga0157372_10000024 3300013307 Bacteria 197716
89 Ga0157372_10019403 3300013307 Bacteria 7329
90 Ga0157372_10160445 3300013307 Bacteria 2599
91 Ga0157372_10266180 3300013307 Bacteria 1991
92 Ga0157375_10011095 3300013308 Bacteria 7945
93 Ga0163163_10243105 3300014325 Bacteria 1850
94 Ga0157380_10077176 3300014326 Bacteria 2714
95 Ga0157379_10120439 3300014968 Bacteria 2360
96 Ga0213875_10000934 3300021388 Bacteria 20993
97 Ga0213875_10001835 3300021388 Bacteria 13203
98 Ga0224712_10055611 3300022467 Bacteria 1557
99 Ga0209677_100519 3300025253 Bacteria 21478
100 Ga0209759_1009586 3300025256 Bacteria 2915
101 Ga0207692_10000617 3300025898 Bacteria 12512
102 Ga0207692_10009409 3300025898 Bacteria 4081
103 Ga0207710_10031306 3300025900 Bacteria 2326
104 Ga0207688_10000257 3300025901 Bacteria 24012
105 Ga0207688_10055874 3300025901 Bacteria 2217
106 Ga0207647_10014467 3300025904 Bacteria 5439
107 Ga0207647_10041648 3300025904 Bacteria 2886
108 Ga0207685_10003343 3300025905 Bacteria 3889
109 Ga0207685_10006830 3300025905 Bacteria 3138
110 Ga0207699_10011350 3300025906 Bacteria 4496
111 Ga0207645_10051317 3300025907 Bacteria 2635
112 Ga0207643_10016568 3300025908 Bacteria 4021
113 Ga0207705_10000001 3300025909 Bacteria 2061880
114 Ga0207684_10013759 3300025910 Bacteria 6988
115 Ga0207707_10050453 3300025912 Bacteria 3625
116 Ga0207671_10027524 3300025914 Bacteria 4250
117 Ga0207693_10003361 3300025915 Bacteria 13661
118 Ga0207693_10003989 3300025915 Bacteria 12541
119 Ga0207693_10040874 3300025915 Bacteria 3652
120 Ga0207663_10010360 3300025916 Bacteria 4959
121 Ga0207646_10181301 3300025922 Bacteria 1902
122 Ga0207694_10156154 3300025924 Bacteria 1840
123 Ga0207687_10055260 3300025927 Bacteria 2782
124 Ga0207700_10000253 3300025928 Bacteria 31867
125 Ga0207664_10000254 3300025929 Bacteria 40157
126 Ga0207664_10012609 3300025929 Bacteria 6047
127 Ga0207706_10032368 3300025933 Bacteria 4657
128 Ga0207665_10012133 3300025939 Bacteria 5656
129 Ga0207665_10058897 3300025939 Bacteria 2598
130 Ga0207665_10132657 3300025939 Bacteria 1770
131 Ga0207691_10099538 3300025940 Bacteria 2596
132 Ga0207689_10005414 3300025942 Bacteria 11426
133 Ga0207689_10066380 3300025942 Bacteria 2967
134 Ga0207661_10083076 3300025944 Bacteria 2650
135 Ga0207661_10091947 3300025944 Bacteria 2529
136 Ga0207679_10043330 3300025945 Bacteria 3240
137 Ga0207667_10032954 3300025949 Bacteria 5576
138 Ga0207667_10189845 3300025949 Bacteria 2108
139 Ga0207651_10027323 3300025960 Bacteria 3583
140 Ga0207651_10036712 3300025960 Bacteria 3203
141 Ga0207658_10012443 3300025986 Bacteria 5813
142 Ga0207677_10049972 3300026023 Bacteria 2826
143 Ga0207678_10031348 3300026067 Bacteria 4637
144 Ga0207678_10170570 3300026067 Bacteria 1858
145 Ga0207708_10013245 3300026075 Bacteria 6157
146 Ga0207708_10021322 3300026075 Bacteria 4885
147 Ga0207702_10062102 3300026078 Bacteria 3189
148 Ga0207702_10068948 3300026078 Bacteria 3039
149 Ga0207702_10188616 3300026078 Bacteria 1903
150 Ga0207641_10145221 3300026088 Bacteria 2144
151 Ga0207648_10052839 3300026089 Bacteria 3552
152 Ga0207648_10143077 3300026089 Bacteria 2109
153 Ga0207674_10130048 3300026116 Bacteria 2482
154 Ga0207675_100027115 3300026118 Bacteria 5335
155 Ga0207683_10013618 3300026121 Bacteria 6937
156 Ga0207683_10037143 3300026121 Bacteria 4242
157 Ga0207683_10057951 3300026121 Bacteria 3400
158 Ga0207698_10091874 3300026142 Bacteria 2486
159 Ga0268266_10004983 3300028379 Bacteria 12557
160 Ga0268264_10053787 3300028381 Bacteria 3360
161 Ga0307515_10000046 3300028794 Bacteria 293319
162 Ga0307511_10002049 3300030521 Bacteria 21100
163 Ga0307511_10036951 3300030521 Bacteria 4230
164 Ga0307512_10028541 3300030522 Bacteria 4891
165 Ga0307513_10060567 3300031456 Bacteria 4013
166 Ga0307509_10006530 3300031507 Bacteria 15634
167 Ga0307509_10113995 3300031507 Bacteria 2699
168 Ga0307508_10001845 3300031616 Bacteria 23415
169 Ga0307508_10038097 3300031616 Bacteria 4322
170 Ga0307508_10040231 3300031616 Bacteria 4198
171 Ga0307508_10054928 3300031616 Bacteria 3529
172 Ga0307516_10049204 3300031730 Bacteria 4144
173 Ga0307507_10008287 3300033179 Bacteria 14482
174 Ga0307510_10019295 3300033180 Bacteria 8000
175 Ga0307510_10076570 3300033180 Bacteria 3289
176 Ga0373926_0001797 3300035083 Bacteria 6654
177 Ga0373934_0000110 3300035086 Bacteria 29197
178 Ga0373934_0004017 3300035086 Bacteria 5415
179 Ga0373944_0001491 3300035089 Bacteria 5917
180 Ga0373936_0001616 3300035113 Bacteria 8237
181 Ga0373936_0024969 3300035113 Bacteria 2335
182 Ga0373945_0000010 3300035116 Bacteria 41491
183 Ga0373953_0018363 3300035117 Bacteria 2586
184 Ga0373953_0045508 3300035117 Bacteria 1759
185 Ga0373956_0000113 3300035119 Bacteria 27903
186 Ga0373957_0000001 3300035120 Bacteria 79449
187 Ga0373957_0006645 3300035120 Bacteria 3656
188 Ga0373957_0021940 3300035120 Bacteria 2271
189 Ga0373943_0002837 3300035170 Bacteria 7872
190 Ga0373946_0003116 3300035171 Bacteria 5872
191 Ga0373955_0000035 3300035172 Bacteria 53201
192 Ga0373955_0042047 3300035172 Bacteria 2452
193 Ga0373924_0016190 3300035410 Bacteria 2845
194 Ga0373924_0023219 3300035410 Bacteria 2431
195 Ga0373931_0025674 3300035691 Bacteria 2993
196 Ga0373935_0023647 3300035692 Bacteria 3776
197 Ga0373927_0048418 3300035695 Bacteria 2749
198 Ga0373933_0000042 3300035724 Bacteria 79645
199 Ga0373933_0006625 3300035724 Bacteria 6311
200 Ga0373947_0010440 3300035725 Bacteria 5329
201 Ga0373947_0054921 3300035725 Bacteria 2404
202 Ga0373937_0000002 3300036401 Bacteria 304133
203 Ga0373937_0002074 3300036401 Bacteria 16765
204 Ga0373925_0013047 3300037068 Bacteria 6016
205 Ga0395899_0024141 3300037312 Bacteria 4599
206 Ga0395900_0017029 3300037418 Bacteria 7419
207 Ga0395898_0002002 3300037466 Bacteria 25558
208 Ga0395898_0055919 3300037466 Bacteria 3848
209 Ga0395898_0139057 3300037466 Bacteria 2325
210 Ga0395898_0170401 3300037466 Bacteria 2081
211 Ga0395905_0235321 3300037471 Bacteria 1712
212 Ga0436364_0330965 3300037853 Bacteria 247749
213 Ga0436364_0583902 3300037853 Bacteria 21040
214 Ga0395901_0014340 3300038443 Bacteria 8069
215 Ga0395901_0095795 3300038443 Bacteria 3110
216 Ga0395901_0293683 3300038443 Bacteria 1686
217 Ga0466965_0001319 3300044683 Bacteria 9907
218 Ga0466966_0002319 3300044684 Bacteria 12404
219 Ga0466961_0040491 3300044693 Bacteria 2987
220 Ga0466963_0000138 3300044694 Bacteria 28316
221 Ga0466963_0000339 3300044694 Bacteria 21203
222 Ga0466963_0004055 3300044694 Bacteria 8474
223 Ga0466963_0009334 3300044694 Bacteria 5905
224 Ga0466963_0017643 3300044694 Bacteria 4451
225 Ga0466963_0049629 3300044694 Bacteria 2776
226 Ga0466963_0102545 3300044694 Bacteria 1959
227 Ga0466971_0011100 3300044719 Bacteria 3944
228 Ga0466970_0000125 3300044765 Bacteria 34778
229 Ga0466957_0000483 3300044842 Bacteria 19817
230 Ga0466957_0026797 3300044842 Bacteria 3421
231 Ga0466957_0079919 3300044842 Bacteria 2035
232 Ga0466959_0008028 3300045049 Bacteria 7436
233 Ga0466959_0043052 3300045049 Bacteria 3330
234 Ga0466958_0000220 3300045836 Bacteria 21589
235 Ga0466958_0005474 3300045836 Bacteria 6841
236 Ga0466967_0003106 3300045976 Bacteria 10678
237 Ga0466967_0006032 3300045976 Bacteria 8517
238 Ga0466967_0049845 3300045976 Bacteria 3664
239 Ga0466967_0058697 3300045976 Bacteria 3402
240 Ga0466967_0098286 3300045976 Bacteria 2672
241 Ga0466967_0128628 3300045976 Bacteria 2349
242 Ga0466967_0160512 3300045976 Bacteria 2109
243 Ga0466967_0162398 3300045976 Bacteria 2098
244 Ga0466967_0214512 3300045976 Bacteria 1827
245 Ga0495592_0000003 3300046454 Bacteria 200744
246 Ga0495592_0021814 3300046454 Bacteria 4872
247 Ga0495603_0046593 3300046455 Bacteria 2583
248 Ga0495603_0084194 3300046455 Bacteria 1862
249 Ga0495629_0005328 3300046459 Bacteria 9611
250 Ga0495629_0007675 3300046459 Bacteria 7941
251 Ga0495629_0103534 3300046459 Bacteria 1985
252 Ga0495641_0009141 3300046461 Bacteria 5932
253 Ga0495651_0000036 3300046462 Bacteria 97779
254 Ga0495651_0000902 3300046462 Bacteria 23044
255 Ga0495651_0143935 3300046462 Bacteria 1725
256 Ga0495653_0000776 3300046463 Bacteria 24510
257 Ga0495653_0006963 3300046463 Bacteria 9284
258 Ga0495653_0037739 3300046463 Bacteria 3793
259 Ga0495580_0020418 3300046472 Bacteria 4901
260 Ga0495580_0061260 3300046472 Bacteria 2642
261 Ga0495582_0017075 3300046473 Bacteria 3973
262 Ga0495662_0000318 3300046476 Bacteria 20980
263 Ga0495662_0034144 3300046476 Bacteria 2456
264 Ga0495664_0000319 3300046477 Bacteria 23147
265 Ga0495664_0002401 3300046477 Bacteria 10048
266 Ga0495594_0071896 3300046499 Bacteria 1924
267 Ga0495607_0029881 3300046501 Bacteria 3352
268 Ga0495606_0034816 3300046507 Bacteria 3451
269 Ga0495608_0000018 3300046511 Bacteria 192512
270 Ga0495608_0023516 3300046511 Bacteria 4223
271 Ga0495616_0066720 3300046513 Bacteria 1750
272 Ga0495620_0000922 3300046515 Bacteria 18084
273 Ga0495628_0010244 3300046516 Bacteria 7975
274 Ga0495643_0000857 3300046522 Bacteria 32721
275 Ga0495648_0007337 3300046524 Bacteria 8835
276 Ga0495648_0015469 3300046524 Bacteria 5540
277 Ga0495652_0000013 3300046529 Bacteria 238164
278 Ga0495652_0007156 3300046529 Bacteria 10296
279 Ga0495652_0023262 3300046529 Bacteria 5494
280 Ga0495652_0038533 3300046529 Bacteria 4140
281 Ga0495654_0042713 3300046530 Bacteria 2249
282 Ga0495665_0000797 3300046531 Bacteria 16504
283 Ga0495665_0018700 3300046531 Bacteria 3722
284 Ga0495640_0001035 3300046533 Bacteria 21576
285 Ga0495586_0006034 3300046535 Bacteria 6477
286 Ga0495586_0011360 3300046535 Bacteria 4735
287 Ga0495586_0165759 3300046535 Bacteria 1247
288 Ga0495587_0000014 3300046536 Bacteria 192100
289 Ga0495587_0002446 3300046536 Bacteria 12391
290 Ga0495587_0002853 3300046536 Bacteria 11582
291 Ga0495597_0056236 3300046542 Bacteria 1723
292 Ga0495645_0005702 3300046543 Bacteria 8577
293 Ga0495645_0008511 3300046543 Bacteria 7166
294 Ga0495633_0017383 3300046558 Bacteria 3680
295 Ga0495667_0000014 3300046559 Bacteria 200767
296 Ga0495667_0000675 3300046559 Bacteria 21853
297 Ga0495667_0005142 3300046559 Bacteria 8839
298 Ga0495668_0067363 3300046616 Bacteria 1969
299 Ga0495634_0001575 3300046642 Bacteria 20069
300 Ga0495634_0017456 3300046642 Bacteria 5119
301 Ga0495625_0005060 3300046660 Bacteria 12203
302 Ga0495625_0008136 3300046660 Bacteria 8985
303 Ga0495635_0018753 3300046663 Bacteria 4827
304 Ga0495635_0018800 3300046663 Bacteria 4821
305 Ga0495635_0061319 3300046663 Bacteria 2583
306 Ga0495635_0143445 3300046663 Bacteria 1626
307 Ga0495588_0000633 3300046674 Bacteria 16371
308 Ga0495657_0000012 3300046675 Bacteria 197154
309 Ga0495657_0000666 3300046675 Bacteria 31065
310 Ga0495657_0047249 3300046675 Bacteria 2910
311 Ga0495599_0000037 3300046678 Bacteria 101892
312 Ga0495599_0022106 3300046678 Bacteria 3969
313 Ga0495599_0069701 3300046678 Bacteria 2194
314 Ga0495623_0000875 3300046679 Bacteria 20425
315 Ga0495623_0006546 3300046679 Bacteria 7584
316 Ga0495646_0001333 3300046680 Bacteria 14574
317 Ga0495646_0010241 3300046680 Bacteria 5964
318 Ga0495646_0054301 3300046680 Bacteria 2410
319 Ga0495646_0068310 3300046680 Bacteria 2098
320 Ga0495647_0003890 3300046681 Bacteria 4816
321 Ga0495658_0018461 3300046683 Bacteria 3627
322 Ga0495658_0070644 3300046683 Bacteria 2026
323 Ga0495658_0146364 3300046683 Bacteria 1448
324 Ga0495613_0009961 3300046689 Bacteria 7062
325 Ga0495624_0003852 3300046690 Bacteria 11069
326 Ga0495671_0006565 3300046692 Bacteria 6707
327 Ga0495600_0008045 3300046809 Bacteria 6463
328 Ga0495600_0015917 3300046809 Bacteria 4764
329 Ga0495600_0028837 3300046809 Bacteria 3592
330 Ga0495600_0104526 3300046809 Bacteria 1845
331 Ga0495600_0105975 3300046809 Bacteria 1832
332 Ga0495600_0141555 3300046809 Bacteria 1560
333 Ga0495581_0004972 3300047315 Bacteria 7695
334 Ga0495581_0011343 3300047315 Bacteria 5156
335 Ga0495581_0012042 3300047315 Bacteria 5004
336 Ga0495581_0025732 3300047315 Bacteria 3413
337 Ga0495581_0032328 3300047315 Bacteria 3030
338 Ga0495581_0054373 3300047315 Bacteria 2311
339 Ga0495604_0000016 3300047317 Bacteria 193985
340 Ga0495604_0000748 3300047317 Bacteria 27300
341 Ga0495636_0010941 3300047318 Bacteria 3592
342 Ga0495674_0059098 3300047319 Bacteria 3349
343 Ga0495674_0098862 3300047319 Bacteria 2485
344 Ga0495674_0179637 3300047319 Bacteria 1763
345 Ga0495672_0003945 3300047320 Bacteria 12420
346 Ga0495672_0141221 3300047320 Bacteria 1258
347 Ga0495676_0041017 3300047321 Bacteria 3814
348 Ga0495676_0043405 3300047321 Bacteria 3680
349 Ga0495680_0000003 3300047322 Bacteria 172246
350 Ga0495680_0002840 3300047322 Bacteria 17404
351 Ga0495680_0003289 3300047322 Bacteria 16012
352 Ga0495680_0012053 3300047322 Bacteria 7629
353 Ga0495680_0034977 3300047322 Bacteria 4051
354 Ga0495687_034382 3300047443 Bacteria 2290
355 Ga0495675_0000324 3300047444 Bacteria 33941
356 Ga0495675_0005892 3300047444 Bacteria 7488
357 Ga0495685_020130 3300047447 Bacteria 2292
358 Ga0495673_0000709 3300047469 Bacteria 32300
359 Ga0495684_0006413 3300047471 Bacteria 9129
360 Ga0495684_0034849 3300047471 Bacteria 3861
361 Ga0495684_0054573 3300047471 Bacteria 3048
362 Ga0495686_0051640 3300047472 Bacteria 2579
363 Ga0495686_0082489 3300047472 Bacteria 1962
364 Ga0495593_0001397 3300047673 Bacteria 14124
365 Ga0495593_0008703 3300047673 Bacteria 5896
366 Ga0495593_0043696 3300047673 Bacteria 2399
367 Ga0495593_0052604 3300047673 Bacteria 2152
368 Ga0495593_0069439 3300047673 Bacteria 1832
369 Ga0495602_0000014 3300048088 Bacteria 193335
370 Ga0496100_0000724 3300048903 Bacteria 15776
371 Ga0496100_0004358 3300048903 Bacteria 7493
372 Ga0496100_0005808 3300048903 Bacteria 6674
373 Ga0496100_0034918 3300048903 Bacteria 3159
374 Ga0496101_0000024 3300048904 Bacteria 205570
375 Ga0496101_0017692 3300048904 Bacteria 4834
376 Ga0496101_0030407 3300048904 Bacteria 3786
377 Ga0496101_0053152 3300048904 Bacteria 2921
378 Ga0496102_0000001 3300048905 Bacteria 873433
379 Ga0496102_0019377 3300048905 Bacteria 5993
380 Ga0496102_0098796 3300048905 Bacteria 2709
381 Ga0496102_0156479 3300048905 Bacteria 2142
382 Ga0496103_0000003 3300048906 Bacteria 603967
383 Ga0496103_0008364 3300048906 Bacteria 6146
384 Ga0496103_0010300 3300048906 Bacteria 5530
385 Ga0496103_0041046 3300048906 Bacteria 2844
386 Ga0496104_0033629 3300048907 Bacteria 4778
387 Ga0496104_0079532 3300048907 Bacteria 3125
388 Ga0496104_0223403 3300048907 Bacteria 1796
389 Ga0496105_0046942 3300048908 Bacteria 3564
390 Ga0496105_0076887 3300048908 Bacteria 2756
391 Ga0496106_0010551 3300048909 Bacteria 6823
392 Ga0496106_0091037 3300048909 Bacteria 2354
393 Ga0496107_0003217 3300048910 Bacteria 10867
394 Ga0496107_0026803 3300048910 Bacteria 4089
395 Ga0496107_0046642 3300048910 Bacteria 3119
396 Ga0496107_0048999 3300048910 Bacteria 3044
397 Ga0496108_0020277 3300048911 Bacteria 5463
398 Ga0496108_0025431 3300048911 Bacteria 4879
399 Ga0496108_0091054 3300048911 Bacteria 2592
400 Ga0496108_0096181 3300048911 Bacteria 2522
401 Ga0496108_0283146 3300048911 Bacteria 1443
402 Ga0496109_0000816 3300048912 Bacteria 25973
403 Ga0496109_0018433 3300048912 Bacteria 6132
404 Ga0496109_0068936 3300048912 Bacteria 3242
405 Ga0496109_0074105 3300048912 Bacteria 3129
406 Ga0496109_0097346 3300048912 Bacteria 2727
407 Ga0496109_0112951 3300048912 Bacteria 2526
408 Ga0496110_0062951 3300048913 Bacteria 3277
409 Ga0496111_0034799 3300048914 Bacteria 3598
410 Ga0496111_0069257 3300048914 Bacteria 2565
411 Ga0496111_0077126 3300048914 Bacteria 2429
412 Ga0496112_0023173 3300048915 Bacteria 5926
413 Ga0496112_0040367 3300048915 Bacteria 4563
414 Ga0496112_0075639 3300048915 Bacteria 3330
415 Ga0496112_0335582 3300048915 Bacteria 1455
416 Ga0496113_0079031 3300048916 Bacteria 2517
417 Ga0496113_0092185 3300048916 Bacteria 2336
418 Ga0496114_0032844 3300048917 Bacteria 4274
419 Ga0496114_0233276 3300048917 Bacteria 1617
420 Ga0496115_0153170 3300048918 Bacteria 1904
421 Ga0496116_0000013 3300048919 Bacteria 603993
422 Ga0496117_0000013 3300048920 Bacteria 603995
423 Ga0496118_0000011 3300048921 Bacteria 603995
424 Ga0496119_0000914 3300048922 Bacteria 38252
425 Ga0496120_0001969 3300048923 Bacteria 22433
426 Ga0496121_0002163 3300048924 Bacteria 30756
427 Ga0496126_0002656 3300048929 Bacteria 23689
428 Ga0495678_034981 3300049459 Bacteria 2063
429 Ga0501032_0045252 3300049569 Bacteria 2977
430 Ga0501033_0003621 3300049570 Bacteria 12600
431 Ga0501033_0023443 3300049570 Bacteria 4654
432 Ga0501033_0061929 3300049570 Bacteria 2756
433 Ga0501034_0051784 3300049571 Bacteria 4139
434 Ga0501036_0021828 3300049572 Bacteria 5383
435 Ga0501038_0000917 3300049574 Bacteria 26165
436 Ga0501043_0038359 3300049579 Bacteria 3767
437 Ga0501043_0046810 3300049579 Bacteria 3401
438 Ga0501043_0121097 3300049579 Bacteria 2052
439 Ga0501047_0024283 3300049581 Bacteria 5820
440 Ga0501035_0050145 3300049822 Bacteria 3741
441 Ga0501035_0060616 3300049822 Bacteria 3368
442 Ga0501044_0004785 3300049823 Bacteria 15145
443 Ga0501044_0100748 3300049823 Bacteria 2906
444 nmdc:mga00v17_21533_c1 3300050491 Bacteria 3707
445 nmdc:mga04h51_3875_c1 3300050495 Bacteria 3679
446 nmdc:mga07m45_46232_c1 3300050496 Bacteria 2445
447 nmdc:mga08y16_113863_c1 3300050511 Bacteria 2816
448 nmdc:mga0n895_47393_c1 3300050512 Bacteria 4202
449 nmdc:mga0rr50_8981_c1 3300050513 Bacteria 6252
450 Ga0495619_0064765 3300053085 Bacteria 2437
451 Ga0500643_009587 3300053087 Bacteria 3687
452 Ga0500553_040374 3300053101 Bacteria 2291
453 Ga0500560_001596 3300053107 Bacteria 4006
454 Ga0500573_0082721 3300053140 Bacteria 1823
455 Ga0466962_0002339 3300061719 Bacteria 8985
456 Ga0466962_0009102 3300061719 Bacteria 4756
457 Ga0466962_0031924 3300061719 Bacteria 2522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0165759 Ga0495586_0165759_26_1204 364
2 3300047472 Ga0495686_0082489 Ga0495686_0082489_798_1946 373
3 3300045976 Ga0466967_0162398 Ga0466967_0162398_35_1228 381
4 3300047320 Ga0495672_0141221 Ga0495672_0141221_17_1210 381
5 3300046472 Ga0495580_0061260 Ga0495580_0061260_638_1978 412
6 3300046543 Ga0495645_0005702 Ga0495645_0005702_5522_6862 418
7 3300047315 Ga0495581_0032328 Ga0495581_0032328_588_1928 422
8 3300046683 Ga0495658_0146364 Ga0495658_0146364_46_1386 428
9 3300011119 Ga0105246_10193973 Ga0105246_101939731 431
10 3300046476 Ga0495662_0034144 Ga0495662_0034144_423_1817 431
11 3300046642 Ga0495634_0017456 Ga0495634_0017456_3354_4748 431
12 3300046683 Ga0495658_0070644 Ga0495658_0070644_346_1740 431
13 3300013102 Ga0157371_10000670 Ga0157371_1000067027 433
14 3300013307 Ga0157372_10019403 Ga0157372_100194034 434
15 3300013104 Ga0157370_10118015 Ga0157370_101180153 435
16 3300046674 Ga0495588_0000633 Ga0495588_0000633_11533_12873 435
17 3300047315 Ga0495581_0054373 Ga0495581_0054373_436_1776 435
18 3300047673 Ga0495593_0069439 Ga0495593_0069439_17_1357 435
19 3300048911 Ga0496108_0283146 Ga0496108_0283146_48_1409 435
20 3300048915 Ga0496112_0335582 Ga0496112_0335582_29_1390 435
21 3300037312 Ga0395899_0024141 Ga0395899_0024141_3185_4558 436
22 3300035117 Ga0373953_0045508 Ga0373953_0045508_319_1740 440
23 3300035120 Ga0373957_0021940 Ga0373957_0021940_20_1441 440
24 3300006163 Ga0070715_10006915 Ga0070715_100069152 442
25 3300009174 Ga0105241_10043978 Ga0105241_100439782 442
26 3300025898 Ga0207692_10009409 Ga0207692_100094094 442
27 3300025905 Ga0207685_10006830 Ga0207685_100068301 442
28 3300025906 Ga0207699_10011350 Ga0207699_100113502 442
29 3300025939 Ga0207665_10058897 Ga0207665_100588972 442
30 3300026078 Ga0207702_10068948 Ga0207702_100689482 442
31 3300048903 Ga0496100_0004358 Ga0496100_0004358_1871_3337 442
32 3300048908 Ga0496105_0046942 Ga0496105_0046942_148_1614 442
33 3300048911 Ga0496108_0025431 Ga0496108_0025431_747_2213 442
34 3300048912 Ga0496109_0112951 Ga0496109_0112951_14_1480 442
35 3300005467 Ga0070706_100009962 Ga0070706_1000099624 443
36 3300044694 Ga0466963_0102545 Ga0466963_0102545_17_1432 444
37 3300044694 Ga0466963_0004055 Ga0466963_0004055_1329_2756 445
38 3300044842 Ga0466957_0079919 Ga0466957_0079919_559_1986 445
39 3300005518 Ga0070699_100264724 Ga0070699_1002647241 448
40 3300006871 Ga0075434_100048289 Ga0075434_1000482893 448
41 3300050512 nmdc:mga0n895_47393_c1 nmdc:mga0n895_47393_c1_1396_2862 448
42 3300050513 nmdc:mga0rr50_8981_c1 nmdc:mga0rr50_8981_c1_1814_3280 448
43 3300044694 Ga0466963_0009334 Ga0466963_0009334_134_1561 449
44 3300035113 Ga0373936_0024969 Ga0373936_0024969_620_2086 450
45 3300035117 Ga0373953_0018363 Ga0373953_0018363_865_2331 450
46 3300035120 Ga0373957_0006645 Ga0373957_0006645_588_2054 450
47 3300035172 Ga0373955_0042047 Ga0373955_0042047_965_2431 450
48 3300035724 Ga0373933_0006625 Ga0373933_0006625_330_1796 450
49 3300035725 Ga0373947_0010440 Ga0373947_0010440_488_1954 450
50 3300037466 Ga0395898_0139057 Ga0395898_0139057_790_2217 450
51 3300046455 Ga0495603_0046593 Ga0495603_0046593_668_2134 450
52 3300046463 Ga0495653_0037739 Ga0495653_0037739_2306_3772 450
53 3300046511 Ga0495608_0023516 Ga0495608_0023516_2507_3973 450
54 3300046663 Ga0495635_0061319 Ga0495635_0061319_789_2255 450
55 3300046675 Ga0495657_0047249 Ga0495657_0047249_1165_2631 450
56 3300046679 Ga0495623_0006546 Ga0495623_0006546_1318_2784 450
57 3300046680 Ga0495646_0054301 Ga0495646_0054301_404_1870 450
58 3300046681 Ga0495647_0003890 Ga0495647_0003890_992_2458 450
59 3300047471 Ga0495684_0034849 Ga0495684_0034849_1757_3223 450
60 3300047673 Ga0495593_0043696 Ga0495593_0043696_377_1843 450
61 3300053085 Ga0495619_0064765 Ga0495619_0064765_419_1885 450
62 3300035086 Ga0373934_0004017 Ga0373934_0004017_2582_4075 451
63 3300036401 Ga0373937_0002074 Ga0373937_0002074_8297_9790 451
64 3300046529 Ga0495652_0007156 Ga0495652_0007156_572_2065 451
65 3300047318 Ga0495636_0010941 Ga0495636_0010941_1705_3156 451
66 3300047322 Ga0495680_0002840 Ga0495680_0002840_15393_16886 451
67 3300048910 Ga0496107_0046642 Ga0496107_0046642_725_2182 452
68 3300005437 Ga0070710_10084109 Ga0070710_100841091 453
69 3300049569 Ga0501032_0045252 Ga0501032_0045252_50_1453 453
70 3300049570 Ga0501033_0023443 Ga0501033_0023443_1548_2951 453
71 3300049571 Ga0501034_0051784 Ga0501034_0051784_472_1875 453
72 3300049572 Ga0501036_0021828 Ga0501036_0021828_949_2352 453
73 3300049579 Ga0501043_0046810 Ga0501043_0046810_1847_3250 453
74 3300049822 Ga0501035_0060616 Ga0501035_0060616_986_2389 453
75 3300053101 Ga0500553_040374 Ga0500553_040374_399_1826 454
76 3300044694 Ga0466963_0000339 Ga0466963_0000339_17874_19331 455
77 3300045049 Ga0466959_0043052 Ga0466959_0043052_608_2065 455
78 3300045836 Ga0466958_0000220 Ga0466958_0000220_18250_19707 455
79 3300046463 Ga0495653_0000776 Ga0495653_0000776_19488_20942 455
80 3300046531 Ga0495665_0000797 Ga0495665_0000797_4963_6417 455
81 3300046535 Ga0495586_0006034 Ga0495586_0006034_3643_5097 455
82 3300046536 Ga0495587_0002446 Ga0495587_0002446_3878_5332 455
83 3300046559 Ga0495667_0000675 Ga0495667_0000675_5234_6688 455
84 3300046809 Ga0495600_0015917 Ga0495600_0015917_2022_3476 455
85 3300047315 Ga0495581_0012042 Ga0495581_0012042_1778_3232 455
86 3300047322 Ga0495680_0034977 Ga0495680_0034977_2116_3570 455
87 3300047444 Ga0495675_0005892 Ga0495675_0005892_1381_2835 455
88 3300047471 Ga0495684_0054573 Ga0495684_0054573_1291_2745 455
89 3300030521 Ga0307511_10036951 Ga0307511_100369512 456
90 3300033180 Ga0307510_10019295 Ga0307510_100192954 456
91 3300044719 Ga0466971_0011100 Ga0466971_0011100_1783_3240 456
92 3300045976 Ga0466967_0049845 Ga0466967_0049845_812_2269 456
93 3300013297 Ga0157378_10144100 Ga0157378_101441002 457
94 3300025256 Ga0209759_1009586 Ga0209759_10095862 457
95 3300026023 Ga0207677_10049972 Ga0207677_100499722 457
96 3300046454 Ga0495592_0021814 Ga0495592_0021814_3123_4550 457
97 3300046459 Ga0495629_0007675 Ga0495629_0007675_1559_2986 457
98 3300046462 Ga0495651_0000902 Ga0495651_0000902_16879_18306 457
99 3300046476 Ga0495662_0000318 Ga0495662_0000318_14525_15952 457
100 3300046529 Ga0495652_0023262 Ga0495652_0023262_1581_3008 457
101 3300046536 Ga0495587_0002853 Ga0495587_0002853_7164_8591 457
102 3300046675 Ga0495657_0000666 Ga0495657_0000666_20698_22125 457
103 3300046680 Ga0495646_0001333 Ga0495646_0001333_3236_4663 457
104 3300046689 Ga0495613_0009961 Ga0495613_0009961_2057_3484 457
105 3300046809 Ga0495600_0008045 Ga0495600_0008045_1458_2885 457
106 3300047315 Ga0495581_0004972 Ga0495581_0004972_4300_5727 457
107 3300047319 Ga0495674_0179637 Ga0495674_0179637_240_1667 457
108 3300047673 Ga0495593_0001397 Ga0495593_0001397_6828_8255 457
109 3300048915 Ga0496112_0023173 Ga0496112_0023173_848_2299 457
110 3300053140 Ga0500573_0082721 Ga0500573_0082721_122_1549 457
111 3300021388 Ga0213875_10001835 Ga0213875_100018354 458
112 3300025942 Ga0207689_10066380 Ga0207689_100663802 458
113 3300035086 Ga0373934_0000110 Ga0373934_0000110_54_1520 458
114 3300035119 Ga0373956_0000113 Ga0373956_0000113_19873_21339 458
115 3300035120 Ga0373957_0000001 Ga0373957_0000001_50339_51805 458
116 3300035172 Ga0373955_0000035 Ga0373955_0000035_12754_14220 458
117 3300035410 Ga0373924_0016190 Ga0373924_0016190_872_2338 458
118 3300035724 Ga0373933_0000042 Ga0373933_0000042_45412_46878 458
119 3300036401 Ga0373937_0000002 Ga0373937_0000002_136131_137597 458
120 3300037853 Ga0436364_0583902 Ga0436364_0583902_16594_18081 458
121 3300038443 Ga0395901_0293683 Ga0395901_0293683_122_1600 458
122 3300046454 Ga0495592_0000003 Ga0495592_0000003_32771_34237 458
123 3300046462 Ga0495651_0000036 Ga0495651_0000036_32790_34256 458
124 3300046511 Ga0495608_0000018 Ga0495608_0000018_32767_34233 458
125 3300046516 Ga0495628_0010244 Ga0495628_0010244_5817_7283 458
126 3300046529 Ga0495652_0000013 Ga0495652_0000013_160028_161494 458
127 3300046536 Ga0495587_0000014 Ga0495587_0000014_32755_34221 458
128 3300046559 Ga0495667_0000014 Ga0495667_0000014_166516_167982 458
129 3300046675 Ga0495657_0000012 Ga0495657_0000012_163955_165421 458
130 3300046678 Ga0495599_0000037 Ga0495599_0000037_11197_12663 458
131 3300046679 Ga0495623_0000875 Ga0495623_0000875_12927_14393 458
132 3300046680 Ga0495646_0068310 Ga0495646_0068310_427_1893 458
133 3300046809 Ga0495600_0141555 Ga0495600_0141555_12_1478 458
134 3300047317 Ga0495604_0000016 Ga0495604_0000016_143703_145169 458
135 3300047322 Ga0495680_0000003 Ga0495680_0000003_10686_12152 458
136 3300047444 Ga0495675_0000324 Ga0495675_0000324_21296_22762 458
137 3300048088 Ga0495602_0000014 Ga0495602_0000014_31784_33250 458
138 3300048906 Ga0496103_0041046 Ga0496103_0041046_1095_2510 459
139 3300006175 Ga0070712_100050186 Ga0070712_1000501862 460
140 3300013307 Ga0157372_10160445 Ga0157372_101604451 460
141 3300025915 Ga0207693_10040874 Ga0207693_100408742 460
142 3300025922 Ga0207646_10181301 Ga0207646_101813012 460
143 3300049570 Ga0501033_0003621 Ga0501033_0003621_10520_11971 460
144 3300049579 Ga0501043_0121097 Ga0501043_0121097_154_1674 460
145 3300049581 Ga0501047_0024283 Ga0501047_0024283_406_1926 460
146 3300049822 Ga0501035_0050145 Ga0501035_0050145_595_2115 460
147 3300049823 Ga0501044_0100748 Ga0501044_0100748_496_2016 460
148 3300061719 Ga0466962_0009102 Ga0466962_0009102_1944_3395 460
149 3300005355 Ga0070671_100165675 Ga0070671_1001656752 461
150 3300005549 Ga0070704_100178898 Ga0070704_1001788982 461
151 3300005719 Ga0068861_100073266 Ga0068861_1000732662 461
152 3300005841 Ga0068863_100167555 Ga0068863_1001675551 461
153 3300005843 Ga0068860_100076262 Ga0068860_1000762623 461
154 3300009094 Ga0111539_10183870 Ga0111539_101838702 461
155 3300013296 Ga0157374_10118927 Ga0157374_101189272 461
156 3300025901 Ga0207688_10055874 Ga0207688_100558742 461
157 3300025960 Ga0207651_10036712 Ga0207651_100367121 461
158 3300026075 Ga0207708_10013245 Ga0207708_100132455 461
159 3300026089 Ga0207648_10143077 Ga0207648_101430771 461
160 3300026121 Ga0207683_10057951 Ga0207683_100579512 461
161 3300026142 Ga0207698_10091874 Ga0207698_100918741 461
162 3300028381 Ga0268264_10053787 Ga0268264_100537872 461
163 3300048911 Ga0496108_0091054 Ga0496108_0091054_411_1859 461
164 3300048914 Ga0496111_0069257 Ga0496111_0069257_858_2306 461
165 3300048916 Ga0496113_0079031 Ga0496113_0079031_999_2447 461
166 3300050511 nmdc:mga08y16_113863_c1 nmdc:mga08y16_113863_c1_1184_2632 461
167 3300005436 Ga0070713_100202039 Ga0070713_1002020391 462
168 3300005437 Ga0070710_10001338 Ga0070710_100013386 462
169 3300005467 Ga0070706_100015730 Ga0070706_1000157304 462
170 3300005471 Ga0070698_100030089 Ga0070698_1000300895 462
171 3300006028 Ga0070717_10083190 Ga0070717_100831902 462
172 3300006173 Ga0070716_100098028 Ga0070716_1000980281 462
173 3300025898 Ga0207692_10000617 Ga0207692_1000061713 462
174 3300025910 Ga0207684_10013759 Ga0207684_100137593 462
175 3300025915 Ga0207693_10003361 Ga0207693_1000336111 462
176 3300025928 Ga0207700_10000253 Ga0207700_100002534 462
177 3300025929 Ga0207664_10000254 Ga0207664_1000025427 462
178 3300025939 Ga0207665_10132657 Ga0207665_101326571 462
179 3300011119 Ga0105246_10053788 Ga0105246_100537882 463
180 3300025944 Ga0207661_10091947 Ga0207661_100919471 463
181 3300026116 Ga0207674_10130048 Ga0207674_101300482 463
182 3300037471 Ga0395905_0235321 Ga0395905_0235321_211_1638 463
183 3300038443 Ga0395901_0095795 Ga0395901_0095795_1570_2997 463
184 3300003320 rootH2_10034612 rootH2_100346125 465
185 3300044694 Ga0466963_0017643 Ga0466963_0017643_1998_3470 465
186 3300005458 Ga0070681_10043150 Ga0070681_100431502 466
187 3300005530 Ga0070679_100023816 Ga0070679_1000238163 466
188 3300005535 Ga0070684_100096015 Ga0070684_1000960151 466
189 3300005614 Ga0068856_100067458 Ga0068856_1000674582 466
190 3300013306 Ga0163162_10009979 Ga0163162_1000997910 466
191 3300013308 Ga0157375_10011095 Ga0157375_100110955 466
192 3300022467 Ga0224712_10055611 Ga0224712_100556111 466
193 3300035083 Ga0373926_0001797 Ga0373926_0001797_72_1505 466
194 3300035089 Ga0373944_0001491 Ga0373944_0001491_3565_4998 466
195 3300035113 Ga0373936_0001616 Ga0373936_0001616_4386_5819 466
196 3300035116 Ga0373945_0000010 Ga0373945_0000010_30280_31713 466
197 3300035170 Ga0373943_0002837 Ga0373943_0002837_6249_7682 466
198 3300035171 Ga0373946_0003116 Ga0373946_0003116_3293_4726 466
199 3300035410 Ga0373924_0023219 Ga0373924_0023219_545_1978 466
200 3300035692 Ga0373935_0023647 Ga0373935_0023647_605_2038 466
201 3300035695 Ga0373927_0048418 Ga0373927_0048418_34_1467 466
202 3300035725 Ga0373947_0054921 Ga0373947_0054921_51_1484 466
203 3300037068 Ga0373925_0013047 Ga0373925_0013047_3663_5096 466
204 3300044683 Ga0466965_0001319 Ga0466965_0001319_1718_3145 466
205 3300044684 Ga0466966_0002319 Ga0466966_0002319_2552_3979 466
206 3300044693 Ga0466961_0040491 Ga0466961_0040491_291_1718 466
207 3300044694 Ga0466963_0000138 Ga0466963_0000138_23390_24817 466
208 3300044694 Ga0466963_0049629 Ga0466963_0049629_842_2275 466
209 3300044765 Ga0466970_0000125 Ga0466970_0000125_8633_10060 466
210 3300044842 Ga0466957_0000483 Ga0466957_0000483_2551_3978 466
211 3300044842 Ga0466957_0026797 Ga0466957_0026797_134_1606 466
212 3300045049 Ga0466959_0008028 Ga0466959_0008028_1184_2611 466
213 3300045836 Ga0466958_0005474 Ga0466958_0005474_3162_4589 466
214 3300045976 Ga0466967_0003106 Ga0466967_0003106_3090_4523 466
215 3300045976 Ga0466967_0006032 Ga0466967_0006032_6075_7502 466
216 3300045976 Ga0466967_0058697 Ga0466967_0058697_81_1508 466
217 3300045976 Ga0466967_0098286 Ga0466967_0098286_1069_2541 466
218 3300046459 Ga0495629_0103534 Ga0495629_0103534_450_1886 466
219 3300046461 Ga0495641_0009141 Ga0495641_0009141_2948_4381 466
220 3300046463 Ga0495653_0006963 Ga0495653_0006963_7187_8620 466
221 3300046477 Ga0495664_0000319 Ga0495664_0000319_13469_14896 466
222 3300046477 Ga0495664_0002401 Ga0495664_0002401_2555_3988 466
223 3300046499 Ga0495594_0071896 Ga0495594_0071896_171_1598 466
224 3300046529 Ga0495652_0038533 Ga0495652_0038533_681_2114 466
225 3300046531 Ga0495665_0018700 Ga0495665_0018700_1352_2785 466
226 3300046543 Ga0495645_0008511 Ga0495645_0008511_4849_6276 466
227 3300046559 Ga0495667_0005142 Ga0495667_0005142_3113_4546 466
228 3300046642 Ga0495634_0001575 Ga0495634_0001575_10391_11818 466
229 3300046660 Ga0495625_0005060 Ga0495625_0005060_737_2164 466
230 3300046663 Ga0495635_0018800 Ga0495635_0018800_1700_3133 466
231 3300046678 Ga0495599_0022106 Ga0495599_0022106_1187_2620 466
232 3300046680 Ga0495646_0010241 Ga0495646_0010241_1008_2441 466
233 3300046690 Ga0495624_0003852 Ga0495624_0003852_5232_6665 466
234 3300046692 Ga0495671_0006565 Ga0495671_0006565_3022_4449 466
235 3300046809 Ga0495600_0028837 Ga0495600_0028837_1364_2797 466
236 3300047315 Ga0495581_0011343 Ga0495581_0011343_3086_4519 466
237 3300047317 Ga0495604_0000748 Ga0495604_0000748_20225_21652 466
238 3300047319 Ga0495674_0059098 Ga0495674_0059098_178_1611 466
239 3300047321 Ga0495676_0041017 Ga0495676_0041017_2185_3618 466
240 3300047321 Ga0495676_0043405 Ga0495676_0043405_1814_3241 466
241 3300047322 Ga0495680_0012053 Ga0495680_0012053_5107_6540 466
242 3300047443 Ga0495687_034382 Ga0495687_034382_20_1447 466
243 3300047471 Ga0495684_0006413 Ga0495684_0006413_1661_3094 466
244 3300047673 Ga0495593_0052604 Ga0495593_0052604_504_1937 466
245 3300048903 Ga0496100_0005808 Ga0496100_0005808_1759_3297 466
246 3300048904 Ga0496101_0017692 Ga0496101_0017692_1803_3341 466
247 3300048905 Ga0496102_0019377 Ga0496102_0019377_4184_5722 466
248 3300048906 Ga0496103_0008364 Ga0496103_0008364_3221_4759 466
249 3300048909 Ga0496106_0010551 Ga0496106_0010551_5019_6557 466
250 3300048910 Ga0496107_0003217 Ga0496107_0003217_4375_5913 466
251 3300048911 Ga0496108_0096181 Ga0496108_0096181_187_1725 466
252 3300048912 Ga0496109_0068936 Ga0496109_0068936_1659_3197 466
253 3300048913 Ga0496110_0062951 Ga0496110_0062951_917_2455 466
254 3300050495 nmdc:mga04h51_3875_c1 nmdc:mga04h51_3875_c1_1324_2751 466
255 3300053107 Ga0500560_001596 Ga0500560_001596_984_2411 466
256 3300061719 Ga0466962_0002339 Ga0466962_0002339_1428_2855 466
257 3300061719 Ga0466962_0031924 Ga0466962_0031924_995_2467 466
258 3300005327 Ga0070658_10000298 Ga0070658_1000029816 467
259 3300005563 Ga0068855_100069890 Ga0068855_1000698902 467
260 3300013307 Ga0157372_10266180 Ga0157372_102661802 467
261 3300025909 Ga0207705_10000001 Ga0207705_10000001968 467
262 3300025949 Ga0207667_10032954 Ga0207667_100329544 467
263 3300026067 Ga0207678_10170570 Ga0207678_101705701 467
264 3300031616 Ga0307508_10001845 Ga0307508_1000184516 467
265 iso_pu_bacteria 2811994882 2812372644 467
266 iso_pu_bacteria 2818991462 2819690910 467
267 iso_pu_bacteria 2818991469 2819727749 467
268 3300005548 Ga0070665_100019214 Ga0070665_1000192146 469
269 iso_pu_bacteria 8004025490 8004028451 469
270 3300005340 Ga0070689_100026963 Ga0070689_1000269631 470
271 3300005456 Ga0070678_100064079 Ga0070678_1000640792 470
272 3300005535 Ga0070684_100076569 Ga0070684_1000765691 470
273 3300005547 Ga0070693_100021679 Ga0070693_1000216792 470
274 3300005564 Ga0070664_100049404 Ga0070664_1000494043 470
275 3300005617 Ga0068859_100281872 Ga0068859_1002818721 470
276 3300006931 Ga0097620_100281857 Ga0097620_1002818571 470
277 3300009011 Ga0105251_10044911 Ga0105251_100449112 470
278 3300009093 Ga0105240_10187837 Ga0105240_101878372 470
279 3300009098 Ga0105245_10183785 Ga0105245_101837852 470
280 3300009174 Ga0105241_10017660 Ga0105241_100176602 470
281 3300009177 Ga0105248_10144168 Ga0105248_101441682 470
282 3300013306 Ga0163162_10133291 Ga0163162_101332912 470
283 3300014325 Ga0163163_10243105 Ga0163163_102431052 470
284 3300014968 Ga0157379_10120439 Ga0157379_101204392 470
285 3300025908 Ga0207643_10016568 Ga0207643_100165682 470
286 3300025912 Ga0207707_10050453 Ga0207707_100504532 470
287 3300025924 Ga0207694_10156154 Ga0207694_101561542 470
288 3300025929 Ga0207664_10012609 Ga0207664_100126096 470
289 3300025944 Ga0207661_10083076 Ga0207661_100830762 470
290 3300025945 Ga0207679_10043330 Ga0207679_100433302 470
291 3300026078 Ga0207702_10188616 Ga0207702_101886162 470
292 3300026121 Ga0207683_10037143 Ga0207683_100371434 470
293 3300048905 Ga0496102_0156479 Ga0496102_0156479_287_1732 470
294 3300048909 Ga0496106_0091037 Ga0496106_0091037_84_1529 470
295 3300048914 Ga0496111_0077126 Ga0496111_0077126_146_1684 470
296 3300048917 Ga0496114_0032844 Ga0496114_0032844_2701_4239 470
297 iso_pu_bacteria 2582581314 2585317414 470
298 iso_pu_bacteria 2616644814 2616697985 470
299 iso_pu_bacteria 2731639228 2731906929 470
300 iso_pu_bacteria 2799112218 2799183793 470
301 iso_pu_bacteria 2808606375 2808917741 470
302 iso_pu_bacteria 8008574985 8008579534 470
303 iso_pu_bacteria 8056829672 8056834568 470
304 3300005334 Ga0068869_100017408 Ga0068869_1000174086 471
305 3300005337 Ga0070682_100013983 Ga0070682_1000139832 471
306 3300005341 Ga0070691_10012085 Ga0070691_100120852 471
307 3300005345 Ga0070692_10051857 Ga0070692_100518572 471
308 3300005365 Ga0070688_100029656 Ga0070688_1000296563 471
309 3300005437 Ga0070710_10004600 Ga0070710_100046005 471
310 3300005440 Ga0070705_100020248 Ga0070705_1000202482 471
311 3300005441 Ga0070700_100020058 Ga0070700_1000200583 471
312 3300005444 Ga0070694_100089544 Ga0070694_1000895441 471
313 3300005546 Ga0070696_100023398 Ga0070696_1000233984 471
314 3300005547 Ga0070693_100053062 Ga0070693_1000530622 471
315 3300005548 Ga0070665_100002411 Ga0070665_10000241111 471
316 3300005548 Ga0070665_100058628 Ga0070665_1000586282 471
317 3300005719 Ga0068861_100067277 Ga0068861_1000672772 471
318 3300005841 Ga0068863_100085993 Ga0068863_1000859932 471
319 3300005843 Ga0068860_100090619 Ga0068860_1000906192 471
320 3300006163 Ga0070715_10009124 Ga0070715_100091242 471
321 3300006173 Ga0070716_100007262 Ga0070716_1000072622 471
322 3300009098 Ga0105245_10114443 Ga0105245_101144432 471
323 3300009101 Ga0105247_10064345 Ga0105247_100643452 471
324 3300009176 Ga0105242_10090631 Ga0105242_100906311 471
325 3300009545 Ga0105237_10000359 Ga0105237_1000035912 471
326 3300010159 Ga0099796_10033220 Ga0099796_100332201 471
327 3300011119 Ga0105246_10019361 Ga0105246_100193612 471
328 3300013297 Ga0157378_10078890 Ga0157378_100788902 471
329 3300014326 Ga0157380_10077176 Ga0157380_100771762 471
330 3300025900 Ga0207710_10031306 Ga0207710_100313062 471
331 3300025901 Ga0207688_10000257 Ga0207688_100002574 471
332 3300025904 Ga0207647_10041648 Ga0207647_100416482 471
333 3300025905 Ga0207685_10003343 Ga0207685_100033431 471
334 3300025907 Ga0207645_10051317 Ga0207645_100513172 471
335 3300025914 Ga0207671_10027524 Ga0207671_100275241 471
336 3300025915 Ga0207693_10003989 Ga0207693_100039892 471
337 3300025916 Ga0207663_10010360 Ga0207663_100103604 471
338 3300025927 Ga0207687_10055260 Ga0207687_100552602 471
339 3300025933 Ga0207706_10032368 Ga0207706_100323682 471
340 3300025939 Ga0207665_10012133 Ga0207665_100121332 471
341 3300025940 Ga0207691_10099538 Ga0207691_100995382 471
342 3300025942 Ga0207689_10005414 Ga0207689_100054147 471
343 3300025960 Ga0207651_10027323 Ga0207651_100273232 471
344 3300025986 Ga0207658_10012443 Ga0207658_100124432 471
345 3300026067 Ga0207678_10031348 Ga0207678_100313484 471
346 3300026075 Ga0207708_10021322 Ga0207708_100213223 471
347 3300026088 Ga0207641_10145221 Ga0207641_101452211 471
348 3300026089 Ga0207648_10052839 Ga0207648_100528392 471
349 3300026118 Ga0207675_100027115 Ga0207675_1000271154 471
350 3300026121 Ga0207683_10013618 Ga0207683_100136182 471
351 3300028379 Ga0268266_10004983 Ga0268266_100049839 471
352 3300037418 Ga0395900_0017029 Ga0395900_0017029_4455_5906 471
353 3300037466 Ga0395898_0002002 Ga0395898_0002002_4642_6102 471
354 3300037466 Ga0395898_0055919 Ga0395898_0055919_605_2056 471
355 3300038443 Ga0395901_0014340 Ga0395901_0014340_860_2320 471
356 3300046455 Ga0495603_0084194 Ga0495603_0084194_173_1654 471
357 3300046459 Ga0495629_0005328 Ga0495629_0005328_7307_8788 471
358 3300046473 Ga0495582_0017075 Ga0495582_0017075_2452_3906 471
359 3300046524 Ga0495648_0007337 Ga0495648_0007337_5899_7380 471
360 3300046530 Ga0495654_0042713 Ga0495654_0042713_424_1905 471
361 3300046683 Ga0495658_0018461 Ga0495658_0018461_1076_2557 471
362 3300047315 Ga0495581_0025732 Ga0495581_0025732_1856_3337 471
363 3300047320 Ga0495672_0003945 Ga0495672_0003945_9820_11301 471
364 3300047469 Ga0495673_0000709 Ga0495673_0000709_6093_7574 471
365 3300047673 Ga0495593_0008703 Ga0495593_0008703_3114_4595 471
366 3300048903 Ga0496100_0000724 Ga0496100_0000724_1591_3072 471
367 3300048904 Ga0496101_0000024 Ga0496101_0000024_184596_186077 471
368 3300048904 Ga0496101_0030407 Ga0496101_0030407_352_1818 471
369 3300048905 Ga0496102_0000001 Ga0496102_0000001_696002_697483 471
370 3300048905 Ga0496102_0098796 Ga0496102_0098796_935_2413 471
371 3300048906 Ga0496103_0000003 Ga0496103_0000003_427064_428545 471
372 3300048907 Ga0496104_0033629 Ga0496104_0033629_281_1765 471
373 3300048910 Ga0496107_0048999 Ga0496107_0048999_512_1978 471
374 3300048911 Ga0496108_0020277 Ga0496108_0020277_1356_2822 471
375 3300048912 Ga0496109_0000816 Ga0496109_0000816_6519_7985 471
376 3300048915 Ga0496112_0040367 Ga0496112_0040367_1238_2704 471
377 3300048918 Ga0496115_0153170 Ga0496115_0153170_98_1564 471
378 3300048919 Ga0496116_0000013 Ga0496116_0000013_175449_176930 471
379 3300048920 Ga0496117_0000013 Ga0496117_0000013_427064_428545 471
380 3300048921 Ga0496118_0000011 Ga0496118_0000011_175451_176932 471
381 3300048922 Ga0496119_0000914 Ga0496119_0000914_30930_32411 471
382 3300048923 Ga0496120_0001969 Ga0496120_0001969_11159_12640 471
383 3300048924 Ga0496121_0002163 Ga0496121_0002163_17177_18658 471
384 3300048929 Ga0496126_0002656 Ga0496126_0002656_7349_8830 471
385 3300050496 nmdc:mga07m45_46232_c1 nmdc:mga07m45_46232_c1_545_2023 471
386 3300053087 Ga0500643_009587 Ga0500643_009587_2174_3655 471
387 iso_pu_bacteria 2902792274 2902796640 471
388 3300005841 Ga0068863_100089634 Ga0068863_1000896342 472
389 3300006028 Ga0070717_10168196 Ga0070717_101681962 472
390 3300006038 Ga0075365_10063651 Ga0075365_100636511 472
391 3300006051 Ga0075364_10024671 Ga0075364_100246712 472
392 3300006173 Ga0070716_100077009 Ga0070716_1000770092 472
393 3300006175 Ga0070712_100033700 Ga0070712_1000337003 472
394 3300006177 Ga0075362_10032413 Ga0075362_100324132 472
395 3300006186 Ga0075369_10005688 Ga0075369_100056884 472
396 3300021388 Ga0213875_10000934 Ga0213875_1000093415 472
397 3300031616 Ga0307508_10054928 Ga0307508_100549282 472
398 3300035691 Ga0373931_0025674 Ga0373931_0025674_969_2420 472
399 3300037853 Ga0436364_0330965 Ga0436364_0330965_101780_103390 472
400 3300045976 Ga0466967_0160512 Ga0466967_0160512_332_1783 472
401 3300045976 Ga0466967_0214512 Ga0466967_0214512_111_1580 472
402 3300046462 Ga0495651_0143935 Ga0495651_0143935_48_1499 472
403 3300046472 Ga0495580_0020418 Ga0495580_0020418_2258_3712 472
404 3300046535 Ga0495586_0011360 Ga0495586_0011360_2096_3550 472
405 3300046663 Ga0495635_0143445 Ga0495635_0143445_155_1606 472
406 3300046678 Ga0495599_0069701 Ga0495599_0069701_73_1524 472
407 3300046809 Ga0495600_0105975 Ga0495600_0105975_173_1624 472
408 3300048907 Ga0496104_0223403 Ga0496104_0223403_195_1664 472
409 3300048912 Ga0496109_0074105 Ga0496109_0074105_302_1771 472
410 3300050491 nmdc:mga00v17_21533_c1 nmdc:mga00v17_21533_c1_287_1774 472
411 3300005327 Ga0070658_10093303 Ga0070658_100933032 473
412 3300009545 Ga0105237_10155604 Ga0105237_101556042 473
413 3300025253 Ga0209677_100519 Ga0209677_1005192 473
414 3300037466 Ga0395898_0170401 Ga0395898_0170401_228_1691 473
415 3300045976 Ga0466967_0128628 Ga0466967_0128628_14_1480 473
416 3300048903 Ga0496100_0034918 Ga0496100_0034918_680_2143 473
417 3300048904 Ga0496101_0053152 Ga0496101_0053152_785_2248 473
418 3300048906 Ga0496103_0010300 Ga0496103_0010300_162_1625 473
419 3300048907 Ga0496104_0079532 Ga0496104_0079532_158_1615 473
420 3300048908 Ga0496105_0076887 Ga0496105_0076887_877_2340 473
421 3300048910 Ga0496107_0026803 Ga0496107_0026803_2226_3689 473
422 3300048912 Ga0496109_0018433 Ga0496109_0018433_322_1779 473
423 3300048912 Ga0496109_0097346 Ga0496109_0097346_876_2339 473
424 3300048914 Ga0496111_0034799 Ga0496111_0034799_1618_3081 473
425 3300048915 Ga0496112_0075639 Ga0496112_0075639_552_2015 473
426 3300048916 Ga0496113_0092185 Ga0496113_0092185_590_2053 473
427 3300048917 Ga0496114_0233276 Ga0496114_0233276_145_1602 473
428 3300001989 JGI24739J22299_10013172 JGI24739J22299_100131722 474
429 3300005563 Ga0068855_100080007 Ga0068855_1000800072 474
430 3300005614 Ga0068856_100047809 Ga0068856_1000478092 474
431 3300006042 Ga0075368_10014432 Ga0075368_100144322 474
432 3300006178 Ga0075367_10029261 Ga0075367_100292612 474
433 3300013307 Ga0157372_10000024 Ga0157372_10000024149 474
434 3300025904 Ga0207647_10014467 Ga0207647_100144672 474
435 3300025949 Ga0207667_10189845 Ga0207667_101898452 474
436 3300026078 Ga0207702_10062102 Ga0207702_100621022 474
437 3300028794 Ga0307515_10000046 Ga0307515_1000004637 474
438 3300030521 Ga0307511_10002049 Ga0307511_100020495 474
439 3300030522 Ga0307512_10028541 Ga0307512_100285413 474
440 3300031456 Ga0307513_10060567 Ga0307513_100605672 474
441 3300031507 Ga0307509_10006530 Ga0307509_1000653010 474
442 3300031507 Ga0307509_10113995 Ga0307509_101139953 474
443 3300031616 Ga0307508_10038097 Ga0307508_100380973 474
444 3300031616 Ga0307508_10040231 Ga0307508_100402312 474
445 3300031730 Ga0307516_10049204 Ga0307516_100492042 474
446 3300033179 Ga0307507_10008287 Ga0307507_1000828710 474
447 3300033180 Ga0307510_10076570 Ga0307510_100765702 474
448 3300046501 Ga0495607_0029881 Ga0495607_0029881_121_1572 474
449 3300046507 Ga0495606_0034816 Ga0495606_0034816_253_1704 474
450 3300046513 Ga0495616_0066720 Ga0495616_0066720_283_1734 474
451 3300046515 Ga0495620_0000922 Ga0495620_0000922_12534_13985 474
452 3300046522 Ga0495643_0000857 Ga0495643_0000857_9950_11401 474
453 3300046524 Ga0495648_0015469 Ga0495648_0015469_1430_2881 474
454 3300046533 Ga0495640_0001035 Ga0495640_0001035_17634_19085 474
455 3300046542 Ga0495597_0056236 Ga0495597_0056236_44_1495 474
456 3300046558 Ga0495633_0017383 Ga0495633_0017383_2204_3655 474
457 3300046616 Ga0495668_0067363 Ga0495668_0067363_122_1573 474
458 3300046660 Ga0495625_0008136 Ga0495625_0008136_7253_8704 474
459 3300046663 Ga0495635_0018753 Ga0495635_0018753_1392_2843 474
460 3300046809 Ga0495600_0104526 Ga0495600_0104526_356_1807 474
461 3300047319 Ga0495674_0098862 Ga0495674_0098862_275_1726 474
462 3300047322 Ga0495680_0003289 Ga0495680_0003289_14095_15546 474
463 3300047447 Ga0495685_020130 Ga0495685_020130_510_1961 474
464 3300047472 Ga0495686_0051640 Ga0495686_0051640_1008_2459 474
465 3300049459 Ga0495678_034981 Ga0495678_034981_47_1498 474
466 3300049570 Ga0501033_0061929 Ga0501033_0061929_214_1665 474
467 3300049574 Ga0501038_0000917 Ga0501038_0000917_12380_13873 474
468 3300049579 Ga0501043_0038359 Ga0501043_0038359_1316_2809 474
469 3300049823 Ga0501044_0004785 Ga0501044_0004785_10707_12158 474

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02133

Transp_cyt_pur

Permease for cytosine/purines, uracil, thiamine, allantoin

49

473

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x79-assembly1.cif.gz_A inward facing conformation of mhp1 0.722 30 458
7qoa-assembly2.cif.gz_B structure of codb, a cytosine transporter in an outward-facing conformation 0.7214 20 449
7qoa-assembly2.cif.gz_B structure of codb, a cytosine transporter in an outward-facing conformation 0.7075 20 449
2jln-assembly1.cif.gz_A structure of mhp1, a nucleobase-cation-symport-1 family transporter 0.6937 30 458
8hg7-assembly1.cif.gz_A structure of human sglt2-map17 complex with sotagliflozin 0.6864 30 445
ID Description Score Start End Superfamily
af_Q12119_63_501_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.8469 11 422 1.10.4160.10
af_P53099_71_468_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.8358 15 372 1.10.4160.10
af_A0A1D8PJQ2_67_497_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.827 13 422 1.10.4160.10
af_A0A1D8PTX5_60_507_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.8205 20 432 1.10.4160.10
af_Q12119_63_501_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.7972 11 422 1.10.4160.10
ID Description Score Start End GO Terms
AF-A0A0K2RHJ9-F1-model_v4 Putative purine-cytosine permease YxlA 0.95 93 392 GO:0005886
GO:0022857
AF-L8MQ63-F1-model_v4 deleted 0.9474 108 465
AF-A0A534ALP5-F1-model_v4 Cytosine permease 0.9407 34 464 GO:0005886
GO:0022857
AF-A0A534CTU4-F1-model_v4 Cytosine permease 0.9351 193 459 GO:0005886
GO:0022857
AF-A0A0Q6SCX3-F1-model_v4 Cytosine permease 0.9345 40 459 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
81.87 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map