F450207

General Info

Members Datasets Scaffolds Average Seq Length
469 274 938 229

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10572645|Ga0075365_105726451
Length 239
Sequence MPDRTRLHYEEELKEVESRTLGGLDLVSSAMERTLEAVEHQDIELAELVVADDDIIDGRYLEVHQAILTLFATQAPVATDLRLIAALLHVMKNIERMGDQCVNVAKLIPIAGHEPPADERLIKNIVTMGNATRAQIRQAKRAFAERNVDMARDLVRQDDVVDNLNKECFQLALEIGDDVDRREWAMTMLLVARAIERIGDNAVDVGEQVAFVVTGLFREFEDASHPEAAAQFSEPQPSP

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
271 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
272 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 12.37
Rhizosphere 81.02
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10572645 3300006038 Bacteria 799
2 CNAas_1002987 3300000532 Bacteria 1150
3 JGI24748J21848_1001262 3300002074 Bacteria 2772
4 JGI24034J26672_10000824 3300002239 Bacteria 4021
5 JGI24742J22300_10001581 3300002244 Bacteria 3619
6 JGI24751J29686_10046773 3300002459 Bacteria 893
7 JGI25407J50210_10000323 3300003373 Bacteria 8880
8 JGI25407J50210_10004079 3300003373 Bacteria 3548
9 JGI25404J52841_10002289 3300003659 Bacteria 3603
10 Ga0070683_100000865 3300005329 Bacteria 22403
11 Ga0070683_100000942 3300005329 Bacteria 21657
12 Ga0070683_100016227 3300005329 Bacteria 6562
13 Ga0070683_100292292 3300005329 Bacteria 1550
14 Ga0070683_100380122 3300005329 Bacteria 1346
15 Ga0070677_10001273 3300005333 Bacteria 8076
16 Ga0070666_10076795 3300005335 Bacteria 2279
17 Ga0070680_100047083 3300005336 Bacteria 3511
18 Ga0070682_100000045 3300005337 Bacteria 131960
19 Ga0068868_100010847 3300005338 Bacteria 6610
20 Ga0068868_100296700 3300005338 Bacteria 1372
21 Ga0070689_100023093 3300005340 Bacteria 4652
22 Ga0070689_100092489 3300005340 Bacteria 2386
23 Ga0070691_10000012 3300005341 Bacteria 56648
24 Ga0070691_10006507 3300005341 Bacteria 5343
25 Ga0070669_100417955 3300005353 Unclassified 1100
26 Ga0070674_100000029 3300005356 Bacteria 69489
27 Ga0070688_100000252 3300005365 Bacteria 28245
28 Ga0070688_100348397 3300005365 Bacteria 1084
29 Ga0070667_100002490 3300005367 Bacteria 16068
30 Ga0070667_100057679 3300005367 Bacteria 3282
31 Ga0070703_10010392 3300005406 Bacteria 2623
32 Ga0070714_100042832 3300005435 Bacteria 3826
33 Ga0070711_100010698 3300005439 Bacteria 5685
34 Ga0070700_100030196 3300005441 Bacteria 3237
35 Ga0070663_100005121 3300005455 Bacteria 7761
36 Ga0070663_100087391 3300005455 Bacteria 2304
37 Ga0070678_100809612 3300005456 Bacteria 851
38 Ga0070662_100000016 3300005457 Bacteria 105820
39 Ga0068867_100000266 3300005459 Bacteria 34381
40 Ga0070685_10000127 3300005466 Bacteria 48844
41 Ga0070679_100000388 3300005530 Bacteria 37491
42 Ga0070679_100006203 3300005530 Bacteria 11133
43 Ga0070684_100060646 3300005535 Bacteria 3310
44 Ga0070684_100124545 3300005535 Bacteria 2320
45 Ga0070684_100453106 3300005535 Bacteria 1186
46 Ga0068853_100059882 3300005539 Bacteria 3290
47 Ga0070672_100000027 3300005543 Bacteria 67016
48 Ga0070693_100002792 3300005547 Bacteria 8035
49 Ga0070665_100000244 3300005548 Bacteria 90284
50 Ga0070665_100116749 3300005548 Bacteria 2671
51 Ga0070665_100449725 3300005548 Bacteria 1298
52 Ga0068855_100357299 3300005563 Bacteria 1608
53 Ga0068854_100000114 3300005578 Bacteria 55089
54 Ga0068856_100002797 3300005614 Bacteria 17859
55 Ga0068856_100034443 3300005614 Bacteria 4960
56 Ga0068852_100000156 3300005616 Bacteria 45492
57 Ga0068866_10000001 3300005718 Bacteria 519680
58 Ga0068851_10000305 3300005834 Bacteria 22308
59 Ga0068863_100000021 3300005841 Bacteria 198088
60 Ga0068863_100001312 3300005841 Bacteria 24799
61 Ga0068863_100145853 3300005841 Bacteria 2264
62 Ga0068858_100000267 3300005842 Bacteria 55818
63 Ga0068858_100000590 3300005842 Bacteria 37996
64 Ga0068858_100434271 3300005842 Bacteria 1264
65 Ga0068860_100030377 3300005843 Bacteria 5197
66 Ga0068860_100496050 3300005843 Bacteria 1219
67 Ga0068862_100000574 3300005844 Bacteria 38284
68 Ga0081455_10013358 3300005937 Bacteria 8122
69 Ga0081455_10031938 3300005937 Bacteria 4753
70 Ga0081538_10000457 3300005981 Bacteria 45671
71 Ga0081538_10006779 3300005981 Bacteria 10009
72 Ga0081538_10008524 3300005981 Bacteria 8688
73 Ga0081538_10081237 3300005981 Bacteria 1725
74 Ga0081540_1000139 3300005983 Bacteria 76578
75 Ga0081539_10008106 3300005985 Bacteria 9282
76 Ga0075365_10021745 3300006038 Bacteria 4007
77 Ga0075363_100011512 3300006048 Bacteria 4237
78 Ga0075364_10047108 3300006051 Bacteria 2807
79 Ga0070715_10000001 3300006163 Bacteria 693690
80 Ga0070712_100053703 3300006175 Bacteria 2814
81 Ga0070712_100232135 3300006175 Bacteria 1466
82 Ga0075430_100019802 3300006846 Bacteria 5723
83 Ga0075433_10001110 3300006852 Bacteria 19439
84 Ga0075434_100768737 3300006871 Bacteria 980
85 Ga0075434_100848746 3300006871 Bacteria 929
86 Ga0068865_100006939 3300006881 Bacteria 6943
87 Ga0105240_10770442 3300009093 Bacteria 1044
88 Ga0105245_10000016 3300009098 Bacteria 204372
89 Ga0105245_10001295 3300009098 Bacteria 22566
90 Ga0105245_10004349 3300009098 Bacteria 12539
91 Ga0105245_10007771 3300009098 Bacteria 9395
92 Ga0105245_10033543 3300009098 Bacteria 4551
93 Ga0105245_10060727 3300009098 Bacteria 3405
94 Ga0105243_10004145 3300009148 Bacteria 11512
95 Ga0105243_10090078 3300009148 Bacteria 2524
96 Ga0105242_10000194 3300009176 Bacteria 47231
97 Ga0105242_10002110 3300009176 Bacteria 15676
98 Ga0105248_10000249 3300009177 Bacteria 62662
99 Ga0105238_10000011 3300009551 Bacteria 261080
100 Ga0105249_10000068 3300009553 Bacteria 148594
101 Ga0105249_10004476 3300009553 Bacteria 12081
102 Ga0105249_10019441 3300009553 Bacteria 6060
103 Ga0105239_10076984 3300010375 Bacteria 3670
104 Ga0105239_10362385 3300010375 Bacteria 1637
105 Ga0105246_10108978 3300011119 Bacteria 2031
106 Ga0105246_10493466 3300011119 Bacteria 1038
107 Ga0157370_10017638 3300013104 Bacteria 7197
108 Ga0157370_10067705 3300013104 Bacteria 3375
109 Ga0157369_10000110 3300013105 Bacteria 115514
110 Ga0157374_10014426 3300013296 Bacteria 6915
111 Ga0157374_10174815 3300013296 Bacteria 2096
112 Ga0157374_10305541 3300013296 Bacteria 1574
113 Ga0157378_10008094 3300013297 Bacteria 9173
114 Ga0157378_10340324 3300013297 Bacteria 1463
115 Ga0157378_10541410 3300013297 Bacteria 1168
116 Ga0163162_10837461 3300013306 Bacteria 1036
117 Ga0157372_10000129 3300013307 Bacteria 82491
118 Ga0157375_10000112 3300013308 Bacteria 79146
119 Ga0157375_10061162 3300013308 Bacteria 3738
120 Ga0157375_10063673 3300013308 Bacteria 3670
121 Ga0157375_10172098 3300013308 Bacteria 2313
122 Ga0163163_10439851 3300014325 Bacteria 1364
123 Ga0157380_10000093 3300014326 Bacteria 48915
124 Ga0157380_10003475 3300014326 Bacteria 10819
125 Ga0157377_10171638 3300014745 Bacteria 1357
126 Ga0157379_10052432 3300014968 Bacteria 3644
127 Ga0157379_10127687 3300014968 Bacteria 2288
128 Ga0157376_10004948 3300014969 Bacteria 9292
129 Ga0157376_10059627 3300014969 Bacteria 3200
130 Ga0157376_10443840 3300014969 Bacteria 1264
131 Ga0163161_10180733 3300017792 Bacteria 1617
132 Ga0206354_11122204 3300020081 Bacteria 1596
133 Ga0207672_1003705 3300025223 Bacteria 872
134 Ga0207656_10000188 3300025321 Bacteria 22311
135 Ga0207653_10090823 3300025885 Bacteria 1069
136 Ga0207682_10002513 3300025893 Bacteria 8198
137 Ga0207692_10324664 3300025898 Bacteria 943
138 Ga0207642_10000031 3300025899 Bacteria 45198
139 Ga0207710_10040550 3300025900 Bacteria 2063
140 Ga0207688_10122865 3300025901 Bacteria 1516
141 Ga0207680_10214576 3300025903 Bacteria 1317
142 Ga0207680_10239657 3300025903 Bacteria 1249
143 Ga0207685_10000036 3300025905 Bacteria 65666
144 Ga0207695_10188375 3300025913 Bacteria 1981
145 Ga0207693_10015717 3300025915 Bacteria 6065
146 Ga0207693_10170942 3300025915 Bacteria 1711
147 Ga0207660_10040711 3300025917 Bacteria 3254
148 Ga0207662_10305405 3300025918 Bacteria 1059
149 Ga0207652_10000349 3300025921 Bacteria 47896
150 Ga0207652_10000917 3300025921 Bacteria 27806
151 Ga0207659_10000010 3300025926 Bacteria 286639
152 Ga0207687_10000007 3300025927 Bacteria 604185
153 Ga0207687_10000018 3300025927 Bacteria 236159
154 Ga0207687_10000177 3300025927 Bacteria 42164
155 Ga0207687_10002435 3300025927 Bacteria 12638
156 Ga0207687_10216367 3300025927 Bacteria 1506
157 Ga0207644_10198133 3300025931 Bacteria 1583
158 Ga0207686_10000033 3300025934 Bacteria 143602
159 Ga0207686_10001393 3300025934 Bacteria 13742
160 Ga0207709_10001837 3300025935 Bacteria 14145
161 Ga0207670_10008935 3300025936 Bacteria 5684
162 Ga0207670_10118552 3300025936 Bacteria 1920
163 Ga0207669_10000012 3300025937 Bacteria 138242
164 Ga0207704_10003446 3300025938 Bacteria 7187
165 Ga0207691_10000136 3300025940 Bacteria 67179
166 Ga0207711_10000020 3300025941 Bacteria 363325
167 Ga0207661_10000095 3300025944 Bacteria 56458
168 Ga0207661_10000610 3300025944 Bacteria 22901
169 Ga0207661_10007089 3300025944 Bacteria 7964
170 Ga0207661_10011700 3300025944 Bacteria 6369
171 Ga0207661_10017199 3300025944 Bacteria 5347
172 Ga0207667_10326591 3300025949 Bacteria 1567
173 Ga0207712_10000007 3300025961 Bacteria 539589
174 Ga0207712_10015480 3300025961 Bacteria 4922
175 Ga0207668_10044598 3300025972 Bacteria 3018
176 Ga0207640_10000015 3300025981 Bacteria 215411
177 Ga0207640_10008136 3300025981 Bacteria 5808
178 Ga0207658_10000769 3300025986 Bacteria 27425
179 Ga0207658_10017073 3300025986 Bacteria 4998
180 Ga0207658_10065959 3300025986 Bacteria 2721
181 Ga0207677_10002576 3300026023 Bacteria 9526
182 Ga0207677_10401801 3300026023 Bacteria 1162
183 Ga0207703_10000020 3300026035 Bacteria 251603
184 Ga0207703_10000040 3300026035 Bacteria 168191
185 Ga0207703_10568011 3300026035 Unclassified 1071
186 Ga0207703_10683473 3300026035 Bacteria 975
187 Ga0207639_10000915 3300026041 Bacteria 19983
188 Ga0207639_10090387 3300026041 Bacteria 2449
189 Ga0207678_10010801 3300026067 Bacteria 8022
190 Ga0207678_10050868 3300026067 Bacteria 3579
191 Ga0207708_10056810 3300026075 Bacteria 2986
192 Ga0207702_10000060 3300026078 Bacteria 125473
193 Ga0207702_10001486 3300026078 Bacteria 23204
194 Ga0207641_10000151 3300026088 Bacteria 99225
195 Ga0207641_10001324 3300026088 Bacteria 24526
196 Ga0207641_10093112 3300026088 Bacteria 2641
197 Ga0207648_10000848 3300026089 Bacteria 34516
198 Ga0207683_10114989 3300026121 Bacteria 2412
199 Ga0207683_10187876 3300026121 Bacteria 1875
200 Ga0207683_10367328 3300026121 Bacteria 1322
201 Ga0207698_10000012 3300026142 Bacteria 260061
202 Ga0268266_10000020 3300028379 Bacteria 527065
203 Ga0268266_10000085 3300028379 Bacteria 201288
204 Ga0268266_10160660 3300028379 Bacteria 2032
205 Ga0268265_10001801 3300028380 Bacteria 17161
206 Ga0268264_10009425 3300028381 Bacteria 8085
207 Ga0268264_10414502 3300028381 Bacteria 1298
208 Ga0265337_1000259 3300028556 Bacteria 28578
209 Ga0265326_10000007 3300028558 Bacteria 223057
210 Ga0265326_10017360 3300028558 Bacteria 2077
211 Ga0265319_1000025 3300028563 Bacteria 142639
212 Ga0265322_10000001 3300028654 Bacteria 543854
213 Ga0265336_10001017 3300028666 Bacteria 13775
214 Ga0265336_10030658 3300028666 Bacteria 1674
215 Ga0265338_10000473 3300028800 Bacteria 71777
216 Ga0265338_10284181 3300028800 Bacteria 1208
217 Ga0265324_10002362 3300029957 Bacteria 9735
218 Ga0265324_10091436 3300029957 Bacteria 1035
219 Ga0307511_10119917 3300030521 Bacteria 1632
220 Ga0265332_10015855 3300031238 Bacteria 3325
221 Ga0265328_10002019 3300031239 Bacteria 9202
222 Ga0265320_10000002 3300031240 Bacteria 542875
223 Ga0265329_10009101 3300031242 Bacteria 3724
224 Ga0265339_10089868 3300031249 Bacteria 1611
225 Ga0265331_10002720 3300031250 Bacteria 11779
226 Ga0265327_10000011 3300031251 Bacteria 543807
227 Ga0265316_10054160 3300031344 Bacteria 3141
228 Ga0307408_100155485 3300031548 Bacteria 1810
229 Ga0265313_10085397 3300031595 Bacteria 1426
230 Ga0265314_10000058 3300031711 Bacteria 167476
231 Ga0307410_10109259 3300031852 Bacteria 1998
232 Ga0307407_10204934 3300031903 Bacteria 1324
233 Ga0307409_100217718 3300031995 Bacteria 1721
234 Ga0307415_100273846 3300032126 Bacteria 1384
235 Ga0316574_0038819 3300035398 Bacteria 2925
236 Ga0373935_0532109 3300035692 Bacteria 855
237 Ga0373933_0469932 3300035724 Bacteria 823
238 Ga0316584_0010256 3300036712 Bacteria 6544
239 Ga0451849_0523774 3300041505 Bacteria 1287
240 Ga0451853_0957428 3300041512 Bacteria 1344
241 Ga0466963_0000001 3300044694 Bacteria 110556
242 Ga0466963_0017934 3300044694 Bacteria 4417
243 Ga0466957_0004093 3300044842 Bacteria 8077
244 Ga0466958_0451220 3300045836 Bacteria 832
245 Ga0466967_0000065 3300045976 Bacteria 39018
246 Ga0466967_0039945 3300045976 Bacteria 4037
247 Ga0495592_0043483 3300046454 Bacteria 3361
248 Ga0495592_0073815 3300046454 Bacteria 2479
249 Ga0495592_0294299 3300046454 Bacteria 1057
250 Ga0495592_0324007 3300046454 Bacteria 995
251 Ga0495603_0000030 3300046455 Bacteria 60760
252 Ga0495603_0000480 3300046455 Bacteria 22066
253 Ga0495629_0000870 3300046459 Bacteria 24352
254 Ga0495629_0020131 3300046459 Bacteria 4763
255 Ga0495629_0063481 3300046459 Bacteria 2579
256 Ga0495629_0118044 3300046459 Bacteria 1848
257 Ga0495629_0314080 3300046459 Bacteria 1072
258 Ga0495641_0000044 3300046461 Bacteria 77415
259 Ga0495641_0047910 3300046461 Bacteria 1961
260 Ga0495641_0178555 3300046461 Bacteria 950
261 Ga0495651_0028710 3300046462 Bacteria 4335
262 Ga0495651_0126893 3300046462 Bacteria 1868
263 Ga0495653_0174834 3300046463 Bacteria 1478
264 Ga0495653_0213022 3300046463 Bacteria 1303
265 Ga0495582_0000112 3300046473 Bacteria 42740
266 Ga0495582_0267954 3300046473 Bacteria 980
267 Ga0495664_0152065 3300046477 Bacteria 1404
268 Ga0495594_0000003 3300046499 Bacteria 199267
269 Ga0495606_0000221 3300046507 Bacteria 101157
270 Ga0495608_0000189 3300046511 Bacteria 43800
271 Ga0495608_0014505 3300046511 Bacteria 5466
272 Ga0495608_0043792 3300046511 Bacteria 2990
273 Ga0495618_0029461 3300046514 Bacteria 3426
274 Ga0495620_0000951 3300046515 Bacteria 17818
275 Ga0495628_0000144 3300046516 Bacteria 61254
276 Ga0495628_0040858 3300046516 Bacteria 3704
277 Ga0495628_0043470 3300046516 Bacteria 3579
278 Ga0495630_0142839 3300046517 Bacteria 1820
279 Ga0495630_0217086 3300046517 Bacteria 1460
280 Ga0495652_0000019 3300046529 Bacteria 190248
281 Ga0495652_0005533 3300046529 Bacteria 11884
282 Ga0495652_0128883 3300046529 Bacteria 2006
283 Ga0495640_0024327 3300046533 Bacteria 4408
284 Ga0495586_0001076 3300046535 Bacteria 15423
285 Ga0495587_0288224 3300046536 Bacteria 919
286 Ga0495598_0001418 3300046537 Bacteria 4747
287 Ga0495621_0000285 3300046539 Bacteria 12245
288 Ga0495645_0005903 3300046543 Bacteria 8456
289 Ga0495645_0013871 3300046543 Bacteria 5712
290 Ga0495645_0041022 3300046543 Bacteria 3375
291 Ga0495622_0000180 3300046557 Bacteria 51095
292 Ga0495633_0053930 3300046558 Bacteria 1892
293 Ga0495667_0000032 3300046559 Bacteria 143493
294 Ga0495634_0004028 3300046642 Bacteria 11655
295 Ga0495634_0004337 3300046642 Bacteria 11178
296 Ga0495625_0000766 3300046660 Bacteria 44778
297 Ga0495625_0358763 3300046660 Bacteria 919
298 Ga0495657_0000004 3300046675 Bacteria 266465
299 Ga0495599_0002456 3300046678 Bacteria 10807
300 Ga0495599_0078731 3300046678 Bacteria 2058
301 Ga0495623_0489696 3300046679 Bacteria 650
302 Ga0495647_0000054 3300046681 Bacteria 30734
303 Ga0495658_0000005 3300046683 Bacteria 149839
304 Ga0495669_0000088 3300046684 Bacteria 61314
305 Ga0495613_0061473 3300046689 Bacteria 2750
306 Ga0495624_0000008 3300046690 Bacteria 145035
307 Ga0495624_0164108 3300046690 Bacteria 1356
308 Ga0495600_0154591 3300046809 Bacteria 1484
309 Ga0495600_0292390 3300046809 Bacteria 1029
310 Ga0495604_0230714 3300047317 Bacteria 1270
311 Ga0495674_0000251 3300047319 Bacteria 45351
312 Ga0495672_0029676 3300047320 Bacteria 3441
313 Ga0495676_0001271 3300047321 Bacteria 21659
314 Ga0495676_0001697 3300047321 Bacteria 19216
315 Ga0495676_0089054 3300047321 Bacteria 2313
316 Ga0495680_0000317 3300047322 Bacteria 53949
317 Ga0495680_0004162 3300047322 Bacteria 13902
318 Ga0495675_0000380 3300047444 Bacteria 30671
319 Ga0495675_0192465 3300047444 Bacteria 1244
320 Ga0495673_0082782 3300047469 Unclassified 1326
321 Ga0495686_0038804 3300047472 Bacteria 3045
322 Ga0495593_0178970 3300047673 Bacteria 1068
323 Ga0495602_0030305 3300048088 Bacteria 5134
324 Ga0495602_0092591 3300048088 Bacteria 2503
325 Ga0495602_0270630 3300048088 Bacteria 1256
326 Ga0496100_0000002 3300048903 Bacteria 489057
327 Ga0496100_0000018 3300048903 Bacteria 162451
328 Ga0496100_0043698 3300048903 Bacteria 2867
329 Ga0496101_0000001 3300048904 Bacteria 489057
330 Ga0496101_0000308 3300048904 Bacteria 33852
331 Ga0496101_0036330 3300048904 Bacteria 3489
332 Ga0496102_0000039 3300048905 Bacteria 198306
333 Ga0496102_0036225 3300048905 Bacteria 4444
334 Ga0496102_0382563 3300048905 Bacteria 1324
335 Ga0496102_0509883 3300048905 Bacteria 1125
336 Ga0496103_0000008 3300048906 Bacteria 340474
337 Ga0496103_0004689 3300048906 Bacteria 8273
338 Ga0496103_0007480 3300048906 Bacteria 6508
339 Ga0496104_0000009 3300048907 Bacteria 488055
340 Ga0496104_0000129 3300048907 Bacteria 69982
341 Ga0496104_0010598 3300048907 Bacteria 8234
342 Ga0496104_0030287 3300048907 Bacteria 5027
343 Ga0496105_0000027 3300048908 Bacteria 148197
344 Ga0496105_0096738 3300048908 Bacteria 2438
345 Ga0496105_0144797 3300048908 Bacteria 1954
346 Ga0496106_0000081 3300048909 Bacteria 76468
347 Ga0496106_0000098 3300048909 Bacteria 66098
348 Ga0496106_0000229 3300048909 Bacteria 39124
349 Ga0496106_0069920 3300048909 Bacteria 2680
350 Ga0496107_0000006 3300048910 Bacteria 258746
351 Ga0496107_0000013 3300048910 Bacteria 178284
352 Ga0496107_0018829 3300048910 Bacteria 4866
353 Ga0496107_0022053 3300048910 Bacteria 4499
354 Ga0496108_0000001 3300048911 Bacteria 919044
355 Ga0496108_0000062 3300048911 Bacteria 122391
356 Ga0496108_0001220 3300048911 Bacteria 20175
357 Ga0496108_0003808 3300048911 Bacteria 12080
358 Ga0496109_0000003 3300048912 Bacteria 420862
359 Ga0496109_0000007 3300048912 Bacteria 247554
360 Ga0496109_0000168 3300048912 Bacteria 64462
361 Ga0496109_0028732 3300048912 Bacteria 4977
362 Ga0496109_0061146 3300048912 Bacteria 3443
363 Ga0496110_0000062 3300048913 Bacteria 53333
364 Ga0496110_0041280 3300048913 Bacteria 4025
365 Ga0496110_0054649 3300048913 Bacteria 3512
366 Ga0496110_0943557 3300048913 Bacteria 769
367 Ga0496111_0000093 3300048914 Bacteria 38167
368 Ga0496111_0157853 3300048914 Bacteria 1683
369 Ga0496112_0097852 3300048915 Bacteria 2904
370 Ga0496113_0000029 3300048916 Bacteria 61873
371 Ga0496113_0011015 3300048916 Bacteria 6010
372 Ga0496113_0012202 3300048916 Bacteria 5767
373 Ga0496113_0304027 3300048916 Bacteria 1277
374 Ga0496113_0700503 3300048916 Bacteria 808
375 Ga0496114_0000014 3300048917 Bacteria 297902
376 Ga0496114_0006594 3300048917 Bacteria 9150
377 Ga0496114_0013153 3300048917 Bacteria 6634
378 Ga0496114_0119487 3300048917 Bacteria 2266
379 Ga0496114_0251185 3300048917 Bacteria 1556
380 Ga0496115_0000003 3300048918 Bacteria 354994
381 Ga0496115_0000828 3300048918 Bacteria 22654
382 Ga0496115_0002008 3300048918 Bacteria 14544
383 Ga0496115_0126147 3300048918 Bacteria 2108
384 Ga0496116_0000680 3300048919 Bacteria 44185
385 Ga0496117_0044456 3300048920 Bacteria 3217
386 Ga0496118_0023216 3300048921 Bacteria 5394
387 Ga0496118_0104808 3300048921 Bacteria 1897
388 Ga0496119_0004679 3300048922 Bacteria 13483
389 Ga0496119_0018061 3300048922 Bacteria 5269
390 Ga0496119_0204634 3300048922 Bacteria 1019
391 Ga0496120_0006385 3300048923 Bacteria 9062
392 Ga0496121_0021463 3300048924 Bacteria 6322
393 Ga0496121_0178660 3300048924 Bacteria 1534
394 Ga0496121_0376656 3300048924 Bacteria 937
395 Ga0496124_0162930 3300048927 Bacteria 1736
396 Ga0496124_0353184 3300048927 Bacteria 1039
397 Ga0496126_0041262 3300048929 Bacteria 4272
398 Ga0496126_0283883 3300048929 Bacteria 1370
399 Ga0501031_0000137 3300049568 Bacteria 40779
400 Ga0501032_0006299 3300049569 Bacteria 8741
401 Ga0501033_0000223 3300049570 Bacteria 54471
402 Ga0501034_0192754 3300049571 Bacteria 1999
403 Ga0501036_0007859 3300049572 Bacteria 8723
404 Ga0501037_0000315 3300049573 Bacteria 41061
405 Ga0501038_0000323 3300049574 Bacteria 41119
406 Ga0501039_0007406 3300049575 Bacteria 8371
407 Ga0501039_0172199 3300049575 Bacteria 1702
408 Ga0501040_0068231 3300049576 Bacteria 2452
409 Ga0501041_0143791 3300049577 Bacteria 1488
410 Ga0501042_0018292 3300049578 Bacteria 4850
411 Ga0501042_0092117 3300049578 Bacteria 2176
412 Ga0501043_0007344 3300049579 Bacteria 8744
413 Ga0501043_0193321 3300049579 Bacteria 1582
414 Ga0501043_0272137 3300049579 Bacteria 1300
415 Ga0501046_0000443 3300049580 Bacteria 41637
416 Ga0501047_0000321 3300049581 Bacteria 55420
417 Ga0501047_0215882 3300049581 Bacteria 1775
418 Ga0501047_0298626 3300049581 Bacteria 1453
419 Ga0501048_0006771 3300049582 Bacteria 8705
420 Ga0501067_0106389 3300049583 Bacteria 1559
421 Ga0501068_0067392 3300049584 Bacteria 2181
422 Ga0501069_0097256 3300049585 Bacteria 1669
423 Ga0501070_0000354 3300049586 Bacteria 41627
424 Ga0501070_0003013 3300049586 Bacteria 14662
425 Ga0501070_0200809 3300049586 Bacteria 1637
426 Ga0501071_0207311 3300049587 Bacteria 1473
427 Ga0501071_0434467 3300049587 Bacteria 1004
428 Ga0501073_0009026 3300049589 Bacteria 7360
429 Ga0501074_0097021 3300049590 Bacteria 2110
430 Ga0501076_0062835 3300049592 Bacteria 2958
431 Ga0501076_0380622 3300049592 Bacteria 1160
432 Ga0501079_0075406 3300049741 Bacteria 2608
433 Ga0501080_0058243 3300049742 Bacteria 3596
434 Ga0501080_0157565 3300049742 Bacteria 2097
435 Ga0501083_0089921 3300049744 Bacteria 2028
436 Ga0501035_0000380 3300049822 Bacteria 51102
437 Ga0501044_0000681 3300049823 Bacteria 41084
438 Ga0501045_0098144 3300049824 Bacteria 2167
439 nmdc:mga03n38_41005_c1 3300050490 Bacteria 2015
440 nmdc:mga00v17_55296_c1 3300050491 Bacteria 2424
441 nmdc:mga0yw44_39112_c1 3300050492 Bacteria 2810
442 nmdc:mga0qj67_17294_c1 3300050509 Bacteria 5481
443 nmdc:mga0n895_698807_c1 3300050512 Bacteria 1010
444 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
445 nmdc:mga0a205_16346_c2 3300050515 Bacteria 5331
446 Ga0495601_0001639 3300053077 Bacteria 12351
447 Ga0495601_0027849 3300053077 Bacteria 3496
448 Ga0495601_0126057 3300053077 Bacteria 1666
449 Ga0495601_0317009 3300053077 Bacteria 1015
450 Ga0495612_0000068 3300053078 Bacteria 47169
451 Ga0495612_0003321 3300053078 Bacteria 6670
452 Ga0495612_0007177 3300053078 Bacteria 4559
453 Ga0495655_0000001 3300053083 Bacteria 419518
454 Ga0495655_0003402 3300053083 Bacteria 2623
455 Ga0495595_0000003 3300053084 Bacteria 266465
456 Ga0495619_0000021 3300053085 Bacteria 187095
457 Ga0495619_0000055 3300053085 Bacteria 95570
458 Ga0495619_0008756 3300053085 Bacteria 6397
459 Ga0495619_0029967 3300053085 Bacteria 3519
460 Ga0495619_0127313 3300053085 Bacteria 1749
461 Ga0495619_0138820 3300053085 Bacteria 1673
462 Ga0500566_0036853 3300053094 Bacteria 2836
463 Ga0500641_0005914 3300053096 Bacteria 4329
464 Ga0500595_004881 3300053119 Bacteria 5932
465 Ga0500595_024535 3300053119 Bacteria 2104
466 Ga0500614_001242 3300053123 Bacteria 6200
467 Ga0500628_000065 3300053129 Bacteria 28526
468 Ga0501084_0329994 3300054114 Bacteria 1289
469 Ga0501082_0042477 3300060353 Bacteria 3920
470 Ga0075365_10572645
471 CNAas_1002987
472 JGI24748J21848_1001262
473 JGI24034J26672_10000824
474 JGI24742J22300_10001581
475 JGI24751J29686_10046773
476 JGI25407J50210_10000323
477 JGI25407J50210_10004079
478 JGI25404J52841_10002289
479 Ga0070683_100000865
480 Ga0070683_100000942
481 Ga0070683_100016227
482 Ga0070683_100292292
483 Ga0070683_100380122
484 Ga0070677_10001273
485 Ga0070666_10076795
486 Ga0070680_100047083
487 Ga0070682_100000045
488 Ga0068868_100010847
489 Ga0068868_100296700
490 Ga0070689_100023093
491 Ga0070689_100092489
492 Ga0070691_10000012
493 Ga0070691_10006507
494 Ga0070669_100417955
495 Ga0070674_100000029
496 Ga0070688_100000252
497 Ga0070688_100348397
498 Ga0070667_100002490
499 Ga0070667_100057679
500 Ga0070703_10010392
501 Ga0070714_100042832
502 Ga0070711_100010698
503 Ga0070700_100030196
504 Ga0070663_100005121
505 Ga0070663_100087391
506 Ga0070678_100809612
507 Ga0070662_100000016
508 Ga0068867_100000266
509 Ga0070685_10000127
510 Ga0070679_100000388
511 Ga0070679_100006203
512 Ga0070684_100060646
513 Ga0070684_100124545
514 Ga0070684_100453106
515 Ga0068853_100059882
516 Ga0070672_100000027
517 Ga0070693_100002792
518 Ga0070665_100000244
519 Ga0070665_100116749
520 Ga0070665_100449725
521 Ga0068855_100357299
522 Ga0068854_100000114
523 Ga0068856_100002797
524 Ga0068856_100034443
525 Ga0068852_100000156
526 Ga0068866_10000001
527 Ga0068851_10000305
528 Ga0068863_100000021
529 Ga0068863_100001312
530 Ga0068863_100145853
531 Ga0068858_100000267
532 Ga0068858_100000590
533 Ga0068858_100434271
534 Ga0068860_100030377
535 Ga0068860_100496050
536 Ga0068862_100000574
537 Ga0081455_10013358
538 Ga0081455_10031938
539 Ga0081538_10000457
540 Ga0081538_10006779
541 Ga0081538_10008524
542 Ga0081538_10081237
543 Ga0081540_1000139
544 Ga0081539_10008106
545 Ga0075365_10021745
546 Ga0075363_100011512
547 Ga0075364_10047108
548 Ga0070715_10000001
549 Ga0070712_100053703
550 Ga0070712_100232135
551 Ga0075430_100019802
552 Ga0075433_10001110
553 Ga0075434_100768737
554 Ga0075434_100848746
555 Ga0068865_100006939
556 Ga0105240_10770442
557 Ga0105245_10000016
558 Ga0105245_10001295
559 Ga0105245_10004349
560 Ga0105245_10007771
561 Ga0105245_10033543
562 Ga0105245_10060727
563 Ga0105243_10004145
564 Ga0105243_10090078
565 Ga0105242_10000194
566 Ga0105242_10002110
567 Ga0105248_10000249
568 Ga0105238_10000011
569 Ga0105249_10000068
570 Ga0105249_10004476
571 Ga0105249_10019441
572 Ga0105239_10076984
573 Ga0105239_10362385
574 Ga0105246_10108978
575 Ga0105246_10493466
576 Ga0157370_10017638
577 Ga0157370_10067705
578 Ga0157369_10000110
579 Ga0157374_10014426
580 Ga0157374_10174815
581 Ga0157374_10305541
582 Ga0157378_10008094
583 Ga0157378_10340324
584 Ga0157378_10541410
585 Ga0163162_10837461
586 Ga0157372_10000129
587 Ga0157375_10000112
588 Ga0157375_10061162
589 Ga0157375_10063673
590 Ga0157375_10172098
591 Ga0163163_10439851
592 Ga0157380_10000093
593 Ga0157380_10003475
594 Ga0157377_10171638
595 Ga0157379_10052432
596 Ga0157379_10127687
597 Ga0157376_10004948
598 Ga0157376_10059627
599 Ga0157376_10443840
600 Ga0163161_10180733
601 Ga0206354_11122204
602 Ga0207672_1003705
603 Ga0207656_10000188
604 Ga0207653_10090823
605 Ga0207682_10002513
606 Ga0207692_10324664
607 Ga0207642_10000031
608 Ga0207710_10040550
609 Ga0207688_10122865
610 Ga0207680_10214576
611 Ga0207680_10239657
612 Ga0207685_10000036
613 Ga0207695_10188375
614 Ga0207693_10015717
615 Ga0207693_10170942
616 Ga0207660_10040711
617 Ga0207662_10305405
618 Ga0207652_10000349
619 Ga0207652_10000917
620 Ga0207659_10000010
621 Ga0207687_10000007
622 Ga0207687_10000018
623 Ga0207687_10000177
624 Ga0207687_10002435
625 Ga0207687_10216367
626 Ga0207644_10198133
627 Ga0207686_10000033
628 Ga0207686_10001393
629 Ga0207709_10001837
630 Ga0207670_10008935
631 Ga0207670_10118552
632 Ga0207669_10000012
633 Ga0207704_10003446
634 Ga0207691_10000136
635 Ga0207711_10000020
636 Ga0207661_10000095
637 Ga0207661_10000610
638 Ga0207661_10007089
639 Ga0207661_10011700
640 Ga0207661_10017199
641 Ga0207667_10326591
642 Ga0207712_10000007
643 Ga0207712_10015480
644 Ga0207668_10044598
645 Ga0207640_10000015
646 Ga0207640_10008136
647 Ga0207658_10000769
648 Ga0207658_10017073
649 Ga0207658_10065959
650 Ga0207677_10002576
651 Ga0207677_10401801
652 Ga0207703_10000020
653 Ga0207703_10000040
654 Ga0207703_10568011
655 Ga0207703_10683473
656 Ga0207639_10000915
657 Ga0207639_10090387
658 Ga0207678_10010801
659 Ga0207678_10050868
660 Ga0207708_10056810
661 Ga0207702_10000060
662 Ga0207702_10001486
663 Ga0207641_10000151
664 Ga0207641_10001324
665 Ga0207641_10093112
666 Ga0207648_10000848
667 Ga0207683_10114989
668 Ga0207683_10187876
669 Ga0207683_10367328
670 Ga0207698_10000012
671 Ga0268266_10000020
672 Ga0268266_10000085
673 Ga0268266_10160660
674 Ga0268265_10001801
675 Ga0268264_10009425
676 Ga0268264_10414502
677 Ga0265337_1000259
678 Ga0265326_10000007
679 Ga0265326_10017360
680 Ga0265319_1000025
681 Ga0265322_10000001
682 Ga0265336_10001017
683 Ga0265336_10030658
684 Ga0265338_10000473
685 Ga0265338_10284181
686 Ga0265324_10002362
687 Ga0265324_10091436
688 Ga0307511_10119917
689 Ga0265332_10015855
690 Ga0265328_10002019
691 Ga0265320_10000002
692 Ga0265329_10009101
693 Ga0265339_10089868
694 Ga0265331_10002720
695 Ga0265327_10000011
696 Ga0265316_10054160
697 Ga0307408_100155485
698 Ga0265313_10085397
699 Ga0265314_10000058
700 Ga0307410_10109259
701 Ga0307407_10204934
702 Ga0307409_100217718
703 Ga0307415_100273846
704 Ga0316574_0038819
705 Ga0373935_0532109
706 Ga0373933_0469932
707 Ga0316584_0010256
708 Ga0451849_0523774
709 Ga0451853_0957428
710 Ga0466963_0000001
711 Ga0466963_0017934
712 Ga0466957_0004093
713 Ga0466958_0451220
714 Ga0466967_0000065
715 Ga0466967_0039945
716 Ga0495592_0043483
717 Ga0495592_0073815
718 Ga0495592_0294299
719 Ga0495592_0324007
720 Ga0495603_0000030
721 Ga0495603_0000480
722 Ga0495629_0000870
723 Ga0495629_0020131
724 Ga0495629_0063481
725 Ga0495629_0118044
726 Ga0495629_0314080
727 Ga0495641_0000044
728 Ga0495641_0047910
729 Ga0495641_0178555
730 Ga0495651_0028710
731 Ga0495651_0126893
732 Ga0495653_0174834
733 Ga0495653_0213022
734 Ga0495582_0000112
735 Ga0495582_0267954
736 Ga0495664_0152065
737 Ga0495594_0000003
738 Ga0495606_0000221
739 Ga0495608_0000189
740 Ga0495608_0014505
741 Ga0495608_0043792
742 Ga0495618_0029461
743 Ga0495620_0000951
744 Ga0495628_0000144
745 Ga0495628_0040858
746 Ga0495628_0043470
747 Ga0495630_0142839
748 Ga0495630_0217086
749 Ga0495652_0000019
750 Ga0495652_0005533
751 Ga0495652_0128883
752 Ga0495640_0024327
753 Ga0495586_0001076
754 Ga0495587_0288224
755 Ga0495598_0001418
756 Ga0495621_0000285
757 Ga0495645_0005903
758 Ga0495645_0013871
759 Ga0495645_0041022
760 Ga0495622_0000180
761 Ga0495633_0053930
762 Ga0495667_0000032
763 Ga0495634_0004028
764 Ga0495634_0004337
765 Ga0495625_0000766
766 Ga0495625_0358763
767 Ga0495657_0000004
768 Ga0495599_0002456
769 Ga0495599_0078731
770 Ga0495623_0489696
771 Ga0495647_0000054
772 Ga0495658_0000005
773 Ga0495669_0000088
774 Ga0495613_0061473
775 Ga0495624_0000008
776 Ga0495624_0164108
777 Ga0495600_0154591
778 Ga0495600_0292390
779 Ga0495604_0230714
780 Ga0495674_0000251
781 Ga0495672_0029676
782 Ga0495676_0001271
783 Ga0495676_0001697
784 Ga0495676_0089054
785 Ga0495680_0000317
786 Ga0495680_0004162
787 Ga0495675_0000380
788 Ga0495675_0192465
789 Ga0495673_0082782
790 Ga0495686_0038804
791 Ga0495593_0178970
792 Ga0495602_0030305
793 Ga0495602_0092591
794 Ga0495602_0270630
795 Ga0496100_0000002
796 Ga0496100_0000018
797 Ga0496100_0043698
798 Ga0496101_0000001
799 Ga0496101_0000308
800 Ga0496101_0036330
801 Ga0496102_0000039
802 Ga0496102_0036225
803 Ga0496102_0382563
804 Ga0496102_0509883
805 Ga0496103_0000008
806 Ga0496103_0004689
807 Ga0496103_0007480
808 Ga0496104_0000009
809 Ga0496104_0000129
810 Ga0496104_0010598
811 Ga0496104_0030287
812 Ga0496105_0000027
813 Ga0496105_0096738
814 Ga0496105_0144797
815 Ga0496106_0000081
816 Ga0496106_0000098
817 Ga0496106_0000229
818 Ga0496106_0069920
819 Ga0496107_0000006
820 Ga0496107_0000013
821 Ga0496107_0018829
822 Ga0496107_0022053
823 Ga0496108_0000001
824 Ga0496108_0000062
825 Ga0496108_0001220
826 Ga0496108_0003808
827 Ga0496109_0000003
828 Ga0496109_0000007
829 Ga0496109_0000168
830 Ga0496109_0028732
831 Ga0496109_0061146
832 Ga0496110_0000062
833 Ga0496110_0041280
834 Ga0496110_0054649
835 Ga0496110_0943557
836 Ga0496111_0000093
837 Ga0496111_0157853
838 Ga0496112_0097852
839 Ga0496113_0000029
840 Ga0496113_0011015
841 Ga0496113_0012202
842 Ga0496113_0304027
843 Ga0496113_0700503
844 Ga0496114_0000014
845 Ga0496114_0006594
846 Ga0496114_0013153
847 Ga0496114_0119487
848 Ga0496114_0251185
849 Ga0496115_0000003
850 Ga0496115_0000828
851 Ga0496115_0002008
852 Ga0496115_0126147
853 Ga0496116_0000680
854 Ga0496117_0044456
855 Ga0496118_0023216
856 Ga0496118_0104808
857 Ga0496119_0004679
858 Ga0496119_0018061
859 Ga0496119_0204634
860 Ga0496120_0006385
861 Ga0496121_0021463
862 Ga0496121_0178660
863 Ga0496121_0376656
864 Ga0496124_0162930
865 Ga0496124_0353184
866 Ga0496126_0041262
867 Ga0496126_0283883
868 Ga0501031_0000137
869 Ga0501032_0006299
870 Ga0501033_0000223
871 Ga0501034_0192754
872 Ga0501036_0007859
873 Ga0501037_0000315
874 Ga0501038_0000323
875 Ga0501039_0007406
876 Ga0501039_0172199
877 Ga0501040_0068231
878 Ga0501041_0143791
879 Ga0501042_0018292
880 Ga0501042_0092117
881 Ga0501043_0007344
882 Ga0501043_0193321
883 Ga0501043_0272137
884 Ga0501046_0000443
885 Ga0501047_0000321
886 Ga0501047_0215882
887 Ga0501047_0298626
888 Ga0501048_0006771
889 Ga0501067_0106389
890 Ga0501068_0067392
891 Ga0501069_0097256
892 Ga0501070_0000354
893 Ga0501070_0003013
894 Ga0501070_0200809
895 Ga0501071_0207311
896 Ga0501071_0434467
897 Ga0501073_0009026
898 Ga0501074_0097021
899 Ga0501076_0062835
900 Ga0501076_0380622
901 Ga0501079_0075406
902 Ga0501080_0058243
903 Ga0501080_0157565
904 Ga0501083_0089921
905 Ga0501035_0000380
906 Ga0501044_0000681
907 Ga0501045_0098144
908 nmdc:mga03n38_41005_c1
909 nmdc:mga00v17_55296_c1
910 nmdc:mga0yw44_39112_c1
911 nmdc:mga0qj67_17294_c1
912 nmdc:mga0n895_698807_c1
913 nmdc:mga0a205_11_c1
914 nmdc:mga0a205_16346_c2
915 Ga0495601_0001639
916 Ga0495601_0027849
917 Ga0495601_0126057
918 Ga0495601_0317009
919 Ga0495612_0000068
920 Ga0495612_0003321
921 Ga0495612_0007177
922 Ga0495655_0000001
923 Ga0495655_0003402
924 Ga0495595_0000003
925 Ga0495619_0000021
926 Ga0495619_0000055
927 Ga0495619_0008756
928 Ga0495619_0029967
929 Ga0495619_0127313
930 Ga0495619_0138820
931 Ga0500566_0036853
932 Ga0500641_0005914
933 Ga0500595_004881
934 Ga0500595_024535
935 Ga0500614_001242
936 Ga0500628_000065
937 Ga0501084_0329994
938 Ga0501082_0042477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01895

PhoU

PhoU domain

23

108

0.97

PF01895

PhoU

PhoU domain

125

209

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t72-assembly1.cif.gz_A crystal structure of phosphate transport system protein phou from aquifex aeolicus 0.9413 6 215
2i0m-assembly1.cif.gz_A crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae 0.9196 8 218
1t72-assembly1.cif.gz_A crystal structure of phosphate transport system protein phou from aquifex aeolicus 0.9118 6 215
2i0m-assembly1.cif.gz_A crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae 0.9071 8 218
4q25-assembly1.cif.gz_B crystal structure of phou from pseudomonas aeruginosa 0.8968 8 215
ID Description Score Start End Superfamily
af_P0A9K7_1_117_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9613 2 105 1.20.58.220
1t72D01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9555 11 104 1.20.58.220
4q25A01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9411 7 105 1.20.58.220
1sumB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9403 8 107 1.20.58.220
4q25B01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9356 8 105 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A537YSN4-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9759 16 226 GO:0005737
GO:0006817
GO:0030643
GO:0045936
AF-A0A7V9DEY3-F1-model_v4 Phosphate signaling complex protein PhoU 0.9729 8 219 GO:0006817
GO:0030643
GO:0045936
AF-A0A538C7Y8-F1-model_v4 Phosphate signaling complex protein PhoU 0.9692 3 227 GO:0006817
GO:0030643
GO:0045936
AF-A0A7W0UA13-F1-model_v4 Phosphate signaling complex protein PhoU 0.9683 3 227 GO:0030643
GO:0045936
AF-A0A7W1RBM8-F1-model_v4 Phosphate signaling complex protein PhoU 0.9678 2 227 GO:0030643
GO:0045936

Map