F450152

General Info

Members Datasets Scaffolds Average Seq Length
468 286 936 294

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954701450|2954705308
Length 336
Sequence TTRSRTPDRLCAEAVDLARAAAEEAAAPGVVGEHSGLVSEGDRVVTHFFECKELGYRGWRWAVTVARASRAKLVTLDEVVLLPGPDALLAPEWVPWSERLRPGDMGPGDLLPTDAEDLRLEPGYTGEDEPLPSAPVSEEMAELVEAEDAELTAGTPSNLPVAPTRGSIAAVAEELGMRRARVLSRYGLHVAADRWEDSFGAKTPMAQAAPAPCVSCGFLVPLGGSLGQAFGLCANEFAPADGRVVSLSYGCGGHSEAAVMPKPPQPAPPVIDETRVDPFPLRPGTGLGVGAGAGGRGHGGAGSLVGRAPLRGAAAPGPPPPGRSRADTGRTTSPRP

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
43 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
53 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
54 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
55 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
56 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
57 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
62 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
63 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
64 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
65 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
81 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
185 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
186 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
189 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
192 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
193 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
194 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
195 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
198 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
199 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
200 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
201 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
202 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
203 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
204 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
205 2643221548 Streptomyces sp. Root55 Isolate Unclassified
206 2643221578 Streptomyces sp. Root63 Isolate Unclassified
207 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
208 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
209 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
210 2643221647 Streptomyces sp. Root369 Isolate Unclassified
211 2643221670 Streptomyces sp. Root431 Isolate Unclassified
212 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
213 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
214 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
215 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
216 2643221714 Streptomyces sp. Root264 Isolate Unclassified
217 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
218 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
219 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
220 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
221 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
222 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
223 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
224 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
225 2808606448 Streptomyces sp. 193411 Isolate Unclassified
226 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
227 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
228 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
229 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
230 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
231 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
232 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
233 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
234 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
235 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
236 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
237 2862574272 Streptomyces sp. AcE210 Isolate Nodule
238 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
239 2867428634 Streptomyces sp. RP5T Isolate Unclassified
240 2867475112 Streptomyces sp. TM32 Isolate Unclassified
241 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
242 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
243 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
244 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
245 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
246 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
247 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
248 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
249 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
250 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
251 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
252 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
253 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
254 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
255 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
256 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
257 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
258 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
259 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
260 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
261 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
262 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
263 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
264 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
265 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
266 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
267 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
268 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
269 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
270 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
271 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
272 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
273 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
274 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
275 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
276 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
277 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
278 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
279 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
280 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
281 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
282 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
283 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
284 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
285 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
286 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.7
Metatranscriptomes 0.85
Isolates 19.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0.64
Rhizoplane 0.85
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10030663 3300003323 Bacteria 7316
2 JGI25160J50197_1032665 3300003354 Bacteria 1319
3 Ga0006562J51391_1083925 3300003578 Bacteria 5730
4 Ga0006562J51391_1083926 3300003578 Bacteria 4500
5 Ga0006562J51391_1152267 3300003578 Bacteria 1286
6 Ga0070709_10001322 3300005434 Bacteria 13497
7 Ga0070714_100013695 3300005435 Bacteria 6503
8 Ga0070713_100010571 3300005436 Bacteria 6674
9 Ga0070710_10001003 3300005437 Bacteria 13427
10 Ga0070706_100013218 3300005467 Bacteria 7638
11 Ga0070698_100002343 3300005471 Bacteria 20941
12 Ga0068853_100104729 3300005539 Bacteria 2505
13 Ga0070717_10012997 3300006028 Bacteria 6359
14 Ga0070716_100000703 3300006173 Bacteria 14262
15 Ga0070712_100001764 3300006175 Bacteria 13234
16 Ga0075367_10005155 3300006178 Bacteria 6454
17 Ga0105243_10544651 3300009148 Bacteria 1108
18 Ga0105243_10552623 3300009148 Bacteria 1100
19 Ga0105248_10140878 3300009177 Bacteria 2720
20 Ga0105238_10283829 3300009551 Bacteria 1637
21 Ga0105246_10013563 3300011119 Bacteria 5111
22 Ga0182008_10007321 3300014497 Bacteria 6104
23 Ga0182007_10003634 3300015262 Bacteria 7232
24 Ga0182005_1013146 3300015265 Bacteria 2330
25 Ga0183367_1005 3300015688 Bacteria 652063
26 Ga0213875_10001733 3300021388 Bacteria 13682
27 Ga0207426_1001263 3300025302 Bacteria 22089
28 Ga0207426_1002306 3300025302 Bacteria 12549
29 Ga0207426_1022263 3300025302 Bacteria 2177
30 Ga0207692_10017765 3300025898 Bacteria 3178
31 Ga0207647_10054937 3300025904 Bacteria 2448
32 Ga0207699_10000452 3300025906 Bacteria 20998
33 Ga0207684_10035776 3300025910 Bacteria 4216
34 Ga0207693_10002107 3300025915 Bacteria 17358
35 Ga0207650_10207577 3300025925 Bacteria 1572
36 Ga0207700_10000250 3300025928 Bacteria 32146
37 Ga0207664_10000298 3300025929 Bacteria 37109
38 Ga0207709_10022860 3300025935 Bacteria 3552
39 Ga0207709_10390697 3300025935 Bacteria 1061
40 Ga0207665_10008570 3300025939 Bacteria 6729
41 Ga0207702_10089885 3300026078 Bacteria 2686
42 Ga0307517_10009430 3300028786 Bacteria 13825
43 Ga0307517_10085751 3300028786 Bacteria 2635
44 Ga0307515_10000732 3300028794 Bacteria 75720
45 Ga0307515_10083685 3300028794 Bacteria 4110
46 Ga0307511_10022075 3300030521 Bacteria 5974
47 Ga0307511_10039634 3300030521 Bacteria 4020
48 Ga0307512_10002037 3300030522 Bacteria 26685
49 Ga0307512_10106111 3300030522 Bacteria 1876
50 Ga0307513_10025352 3300031456 Bacteria 6873
51 Ga0307509_10128321 3300031507 Bacteria 2497
52 Ga0307509_10153989 3300031507 Bacteria 2208
53 Ga0307508_10018479 3300031616 Bacteria 6335
54 Ga0307508_10030051 3300031616 Bacteria 4909
55 Ga0307508_10146953 3300031616 Bacteria 1961
56 Ga0307508_10191952 3300031616 Bacteria 1644
57 Ga0307514_10031987 3300031649 Bacteria 4214
58 Ga0307516_10006130 3300031730 Bacteria 14173
59 Ga0307516_10100138 3300031730 Bacteria 2714
60 Ga0307516_10274503 3300031730 Bacteria 1370
61 Ga0307410_10072630 3300031852 Bacteria 2390
62 Ga0307507_10030274 3300033179 Bacteria 5711
63 Ga0307510_10006030 3300033180 Bacteria 14452
64 Ga0307510_10050824 3300033180 Bacteria 4392
65 Ga0307510_10058517 3300033180 Bacteria 3989
66 Ga0395900_0100595 3300037418 Bacteria 2970
67 Ga0395900_0290087 3300037418 Bacteria 1625
68 Ga0395898_0001516 3300037466 Bacteria 32005
69 Ga0395898_0042551 3300037466 Bacteria 4480
70 Ga0395898_0545965 3300037466 Bacteria 1101
71 Ga0436364_0258391 3300037853 Bacteria 19221
72 Ga0395901_0034325 3300038443 Bacteria 5239
73 Ga0395901_0111648 3300038443 Bacteria 2871
74 Ga0439436_0000672 3300041404 Bacteria 9170
75 Ga0439439_0001630 3300041406 Bacteria 4533
76 Ga0451841_0421714 3300041498 Bacteria 1162
77 Ga0451853_0566122 3300041512 Bacteria 910
78 Ga0439433_0000071 3300041999 Bacteria 13066
79 Ga0439448_0023204 3300042005 Bacteria 1933
80 Ga0439449_0004703 3300042007 Bacteria 5269
81 Ga0439450_035714 3300042008 Bacteria 1135
82 Ga0439457_006692 3300042014 Bacteria 2801
83 Ga0439462_0006743 3300042015 Bacteria 2866
84 Ga0450900_002544 3300042136 Bacteria 1945
85 Ga0450900_016418 3300042136 Bacteria 1003
86 Ga0450902_013688 3300042137 Bacteria 1307
87 Ga0450903_003782 3300042138 Bacteria 2607
88 Ga0450903_006162 3300042138 Bacteria 2000
89 Ga0439458_0008180 3300042157 Bacteria 2324
90 Ga0466969_0001410 3300044656 Bacteria 12950
91 Ga0466969_0069986 3300044656 Bacteria 1688
92 Ga0466972_0000841 3300044658 Bacteria 14726
93 Ga0466972_0007559 3300044658 Bacteria 5455
94 Ga0466965_0020010 3300044683 Bacteria 3215
95 Ga0466965_0022533 3300044683 Bacteria 3036
96 Ga0466965_0024366 3300044683 Bacteria 2927
97 Ga0466966_0002493 3300044684 Bacteria 12060
98 Ga0466966_0010258 3300044684 Bacteria 6215
99 Ga0466966_0031498 3300044684 Bacteria 3438
100 Ga0466961_0009522 3300044693 Bacteria 6184
101 Ga0466961_0013959 3300044693 Bacteria 5148
102 Ga0466963_0001643 3300044694 Bacteria 12178
103 Ga0466963_0024243 3300044694 Bacteria 3861
104 Ga0466963_0129464 3300044694 Bacteria 1742
105 Ga0466964_0000595 3300044706 Bacteria 11432
106 Ga0466971_0000309 3300044719 Bacteria 18830
107 Ga0466968_0002671 3300044735 Bacteria 6573
108 Ga0466968_0066105 3300044735 Bacteria 1566
109 Ga0466970_0002310 3300044765 Bacteria 9221
110 Ga0466970_0007725 3300044765 Bacteria 5396
111 Ga0466970_0083359 3300044765 Bacteria 1730
112 Ga0466957_0001252 3300044842 Bacteria 13242
113 Ga0466959_0000404 3300045049 Bacteria 25274
114 Ga0466959_0001283 3300045049 Bacteria 15198
115 Ga0466958_0001470 3300045836 Bacteria 11223
116 Ga0466967_0017240 3300045976 Bacteria 5727
117 Ga0466967_0023396 3300045976 Bacteria 5061
118 Ga0466967_0097350 3300045976 Bacteria 2685
119 Ga0495617_003068 3300046452 Bacteria 6359
120 Ga0495627_010630 3300046453 Bacteria 3337
121 Ga0495592_0001818 3300046454 Bacteria 14986
122 Ga0495592_0021918 3300046454 Bacteria 4861
123 Ga0495603_0002717 3300046455 Bacteria 10429
124 Ga0495603_0009247 3300046455 Bacteria 5956
125 Ga0495603_0019497 3300046455 Bacteria 4104
126 Ga0495603_0026663 3300046455 Bacteria 3490
127 Ga0495629_0003140 3300046459 Bacteria 12511
128 Ga0495629_0003504 3300046459 Bacteria 11862
129 Ga0495629_0004770 3300046459 Bacteria 10165
130 Ga0495629_0017734 3300046459 Bacteria 5103
131 Ga0495629_0025846 3300046459 Bacteria 4172
132 Ga0495629_0034353 3300046459 Bacteria 3585
133 Ga0495629_0035490 3300046459 Bacteria 3524
134 Ga0495629_0070017 3300046459 Bacteria 2447
135 Ga0495629_0071088 3300046459 Bacteria 2429
136 Ga0495629_0171985 3300046459 Bacteria 1503
137 Ga0495629_0346810 3300046459 Bacteria 1013
138 Ga0495638_0013053 3300046460 Bacteria 5672
139 Ga0495651_0004717 3300046462 Bacteria 10433
140 Ga0495651_0021283 3300046462 Bacteria 5040
141 Ga0495653_0013648 3300046463 Bacteria 6621
142 Ga0495580_0003440 3300046472 Bacteria 13479
143 Ga0495582_0057641 3300046473 Bacteria 2142
144 Ga0495605_0125761 3300046474 Bacteria 1159
145 Ga0495639_0030541 3300046475 Bacteria 2395
146 Ga0495662_0010901 3300046476 Bacteria 4446
147 Ga0495662_0042424 3300046476 Bacteria 2196
148 Ga0495662_0049005 3300046476 Bacteria 2039
149 Ga0495664_0010626 3300046477 Bacteria 5168
150 Ga0495664_0102186 3300046477 Bacteria 1727
151 Ga0495664_0117412 3300046477 Bacteria 1608
152 Ga0495584_0030252 3300046491 Bacteria 2743
153 Ga0495585_0193784 3300046492 Bacteria 1038
154 Ga0495594_0006666 3300046499 Bacteria 5943
155 Ga0495594_0053222 3300046499 Bacteria 2229
156 Ga0495594_0112215 3300046499 Bacteria 1537
157 Ga0495607_0130519 3300046501 Bacteria 1308
158 Ga0495583_0092102 3300046506 Bacteria 1303
159 Ga0495608_0011417 3300046511 Bacteria 6182
160 Ga0495616_0005944 3300046513 Bacteria 7443
161 Ga0495618_0115005 3300046514 Bacteria 1722
162 Ga0495618_0144091 3300046514 Bacteria 1523
163 Ga0495620_0021230 3300046515 Bacteria 3156
164 Ga0495620_0038194 3300046515 Bacteria 2132
165 Ga0495620_0087510 3300046515 Bacteria 1253
166 Ga0495628_0004596 3300046516 Bacteria 12203
167 Ga0495628_0121820 3300046516 Bacteria 2000
168 Ga0495630_0102921 3300046517 Bacteria 2161
169 Ga0495630_0165123 3300046517 Bacteria 1686
170 Ga0495632_0017340 3300046519 Bacteria 3979
171 Ga0495632_0094095 3300046519 Bacteria 1417
172 Ga0495643_0012596 3300046522 Bacteria 5094
173 Ga0495648_0175448 3300046524 Bacteria 1094
174 Ga0495666_0006942 3300046526 Bacteria 5689
175 Ga0495666_0012839 3300046526 Bacteria 4175
176 Ga0495652_0029868 3300046529 Bacteria 4784
177 Ga0495652_0036990 3300046529 Bacteria 4238
178 Ga0495652_0345096 3300046529 Bacteria 1068
179 Ga0495665_0011688 3300046531 Bacteria 4756
180 Ga0495640_0096935 3300046533 Bacteria 1940
181 Ga0495586_0026316 3300046535 Bacteria 3113
182 Ga0495587_0007444 3300046536 Bacteria 7087
183 Ga0495587_0037882 3300046536 Bacteria 2893
184 Ga0495597_0008611 3300046542 Bacteria 5103
185 Ga0495597_0021742 3300046542 Bacteria 2981
186 Ga0495645_0016867 3300046543 Bacteria 5228
187 Ga0495645_0054126 3300046543 Bacteria 2916
188 Ga0495622_0011878 3300046557 Bacteria 4027
189 Ga0495622_0053632 3300046557 Bacteria 1871
190 Ga0495622_0082750 3300046557 Bacteria 1476
191 Ga0495667_0085244 3300046559 Bacteria 2050
192 Ga0495667_0299955 3300046559 Bacteria 1018
193 Ga0495668_0039893 3300046616 Bacteria 2620
194 Ga0495668_0128985 3300046616 Bacteria 1384
195 Ga0495634_0006322 3300046642 Bacteria 9015
196 Ga0495634_0039686 3300046642 Bacteria 3204
197 Ga0495611_0038263 3300046648 Bacteria 2133
198 Ga0495625_0007457 3300046660 Bacteria 9513
199 Ga0495625_0020430 3300046660 Bacteria 5112
200 Ga0495625_0074050 3300046660 Bacteria 2386
201 Ga0495635_0036241 3300046663 Bacteria 3419
202 Ga0495661_0008179 3300046665 Bacteria 7253
203 Ga0495588_0011853 3300046674 Bacteria 4103
204 Ga0495588_0033436 3300046674 Bacteria 2596
205 Ga0495588_0244771 3300046674 Bacteria 946
206 Ga0495657_0005176 3300046675 Bacteria 10328
207 Ga0495657_0018562 3300046675 Bacteria 5027
208 Ga0495657_0023468 3300046675 Bacteria 4406
209 Ga0495657_0145344 3300046675 Bacteria 1475
210 Ga0495657_0211943 3300046675 Bacteria 1177
211 Ga0495623_0015203 3300046679 Bacteria 4974
212 Ga0495623_0051370 3300046679 Bacteria 2608
213 Ga0495646_0000377 3300046680 Bacteria 23269
214 Ga0495646_0002684 3300046680 Bacteria 11016
215 Ga0495658_0011679 3300046683 Bacteria 4425
216 Ga0495613_0001277 3300046689 Bacteria 19224
217 Ga0495613_0011900 3300046689 Bacteria 6466
218 Ga0495613_0013851 3300046689 Bacteria 5982
219 Ga0495613_0119138 3300046689 Bacteria 1896
220 Ga0495613_0221369 3300046689 Bacteria 1328
221 Ga0495624_0048794 3300046690 Bacteria 2685
222 Ga0495624_0224530 3300046690 Bacteria 1138
223 Ga0495670_0010864 3300046691 Bacteria 4474
224 Ga0495670_0085521 3300046691 Bacteria 1610
225 Ga0495671_0049866 3300046692 Bacteria 2086
226 Ga0495671_0101750 3300046692 Bacteria 1404
227 Ga0495671_0109315 3300046692 Bacteria 1350
228 Ga0495671_0156046 3300046692 Bacteria 1111
229 Ga0495649_0166298 3300046694 Bacteria 1155
230 Ga0495589_0063655 3300046794 Bacteria 1809
231 Ga0495589_0077002 3300046794 Bacteria 1625
232 Ga0495589_0087550 3300046794 Bacteria 1512
233 Ga0495589_0106142 3300046794 Bacteria 1357
234 Ga0495600_0005404 3300046809 Bacteria 7701
235 Ga0495600_0020403 3300046809 Bacteria 4238
236 Ga0495600_0153094 3300046809 Bacteria 1492
237 Ga0495660_0008726 3300046810 Bacteria 5926
238 Ga0495660_0034856 3300046810 Bacteria 2814
239 Ga0495581_0005835 3300047315 Bacteria 7139
240 Ga0495581_0016600 3300047315 Bacteria 4279
241 Ga0495581_0028487 3300047315 Bacteria 3237
242 Ga0495581_0036688 3300047315 Bacteria 2836
243 Ga0495604_0000208 3300047317 Bacteria 53826
244 Ga0495604_0000705 3300047317 Bacteria 28417
245 Ga0495604_0004412 3300047317 Bacteria 11136
246 Ga0495604_0044749 3300047317 Bacteria 3456
247 Ga0495636_0002249 3300047318 Bacteria 7415
248 Ga0495636_0025512 3300047318 Bacteria 2400
249 Ga0495636_0077655 3300047318 Bacteria 1425
250 Ga0495636_0121113 3300047318 Bacteria 1157
251 Ga0495636_0150137 3300047318 Bacteria 1045
252 Ga0495674_0066107 3300047319 Bacteria 3138
253 Ga0495676_0004665 3300047321 Bacteria 12553
254 Ga0495676_0012021 3300047321 Bacteria 7807
255 Ga0495676_0015680 3300047321 Bacteria 6738
256 Ga0495676_0034988 3300047321 Bacteria 4207
257 Ga0495676_0051553 3300047321 Bacteria 3290
258 Ga0495680_0020677 3300047322 Bacteria 5528
259 Ga0495683_0062712 3300047323 Bacteria 1838
260 Ga0495687_002090 3300047443 Bacteria 16780
261 Ga0495687_003000 3300047443 Bacteria 12757
262 Ga0495687_025045 3300047443 Bacteria 2826
263 Ga0495675_0004686 3300047444 Bacteria 8310
264 Ga0495675_0012607 3300047444 Bacteria 5320
265 Ga0495675_0144888 3300047444 Bacteria 1470
266 Ga0495685_000820 3300047447 Bacteria 9482
267 Ga0495685_001018 3300047447 Bacteria 8544
268 Ga0495685_002292 3300047447 Bacteria 5966
269 Ga0495685_006497 3300047447 Bacteria 3829
270 Ga0495685_026944 3300047447 Bacteria 1977
271 Ga0495681_0003349 3300047470 Bacteria 11151
272 Ga0495681_0003707 3300047470 Bacteria 10597
273 Ga0495681_0017114 3300047470 Bacteria 4038
274 Ga0495684_0015555 3300047471 Bacteria 5857
275 Ga0495684_0123594 3300047471 Bacteria 1948
276 Ga0495686_0039850 3300047472 Bacteria 2998
277 Ga0495686_0042441 3300047472 Bacteria 2892
278 Ga0495686_0097338 3300047472 Bacteria 1779
279 Ga0495593_0002365 3300047673 Bacteria 11331
280 Ga0495593_0017007 3300047673 Bacteria 4093
281 Ga0495593_0034292 3300047673 Bacteria 2761
282 Ga0495593_0090349 3300047673 Bacteria 1577
283 Ga0495602_0030767 3300048088 Bacteria 5086
284 Ga0495602_0210557 3300048088 Bacteria 1476
285 Ga0495614_0000859 3300048089 Bacteria 12845
286 Ga0495614_0009749 3300048089 Bacteria 4244
287 Ga0495614_0020332 3300048089 Bacteria 2871
288 Ga0496106_0031001 3300048909 Bacteria 3986
289 Ga0496109_0259927 3300048912 Bacteria 1635
290 Ga0496110_0132137 3300048913 Bacteria 2254
291 Ga0501323_010334 3300049539 Bacteria 1111
292 Ga0501031_0196785 3300049568 Bacteria 1315
293 Ga0501032_0047155 3300049569 Bacteria 2910
294 Ga0501032_0069704 3300049569 Bacteria 2346
295 Ga0501032_0124355 3300049569 Bacteria 1704
296 Ga0501033_0001467 3300049570 Bacteria 20887
297 Ga0501033_0044298 3300049570 Bacteria 3312
298 Ga0501033_0265393 3300049570 Bacteria 1214
299 Ga0501033_0366946 3300049570 Bacteria 1007
300 Ga0501034_0002305 3300049571 Bacteria 23363
301 Ga0501034_0011069 3300049571 Bacteria 9369
302 Ga0501034_0088166 3300049571 Bacteria 3101
303 Ga0501034_0142770 3300049571 Bacteria 2373
304 Ga0501034_0187443 3300049571 Bacteria 2031
305 Ga0501036_0004198 3300049572 Bacteria 11613
306 Ga0501036_0005527 3300049572 Bacteria 10254
307 Ga0501036_0029609 3300049572 Bacteria 4624
308 Ga0501036_0469860 3300049572 Bacteria 1047
309 Ga0501036_0541681 3300049572 Bacteria 967
310 Ga0501037_0027343 3300049573 Bacteria 4215
311 Ga0501037_0175281 3300049573 Bacteria 1523
312 Ga0501038_0006999 3300049574 Bacteria 10417
313 Ga0501038_0037963 3300049574 Bacteria 4219
314 Ga0501038_0076250 3300049574 Bacteria 2832
315 Ga0501038_0351088 3300049574 Bacteria 1148
316 Ga0501039_0046397 3300049575 Bacteria 3356
317 Ga0501039_0147434 3300049575 Bacteria 1849
318 Ga0501039_0449818 3300049575 Bacteria 1011
319 Ga0501042_0362389 3300049578 Bacteria 1049
320 Ga0501043_0001789 3300049579 Bacteria 18478
321 Ga0501043_0039834 3300049579 Bacteria 3693
322 Ga0501043_0069687 3300049579 Bacteria 2762
323 Ga0501046_0080598 3300049580 Bacteria 2515
324 Ga0501046_0094578 3300049580 Bacteria 2296
325 Ga0501046_0237020 3300049580 Bacteria 1347
326 Ga0501047_0011889 3300049581 Bacteria 8236
327 Ga0501047_0019420 3300049581 Bacteria 6520
328 Ga0501047_0040964 3300049581 Bacteria 4477
329 Ga0501047_0048773 3300049581 Bacteria 4089
330 Ga0501047_0205815 3300049581 Bacteria 1827
331 Ga0501047_0244366 3300049581 Bacteria 1644
332 Ga0501048_0088749 3300049582 Bacteria 2181
333 Ga0501069_0074177 3300049585 Bacteria 1909
334 Ga0501070_0000381 3300049586 Bacteria 40532
335 Ga0501070_0002977 3300049586 Bacteria 14753
336 Ga0501070_0024311 3300049586 Bacteria 5081
337 Ga0501074_0009025 3300049590 Bacteria 7241
338 Ga0501080_0042904 3300049742 Bacteria 4211
339 Ga0501080_0257232 3300049742 Bacteria 1591
340 Ga0501035_0000885 3300049822 Bacteria 31783
341 Ga0501035_0007747 3300049822 Bacteria 10031
342 Ga0501035_0013935 3300049822 Bacteria 7418
343 Ga0501035_0025882 3300049822 Bacteria 5376
344 Ga0501035_0126960 3300049822 Bacteria 2226
345 Ga0501035_0138454 3300049822 Bacteria 2117
346 Ga0501035_0219569 3300049822 Bacteria 1623
347 Ga0501035_0361310 3300049822 Bacteria 1213
348 Ga0501044_0000276 3300049823 Bacteria 65263
349 Ga0501044_0003934 3300049823 Bacteria 16657
350 Ga0501044_0072650 3300049823 Bacteria 3497
351 Ga0501044_0078048 3300049823 Bacteria 3356
352 Ga0501044_0092694 3300049823 Bacteria 3046
353 Ga0501044_0157112 3300049823 Bacteria 2253
354 Ga0501044_0164737 3300049823 Bacteria 2191
355 Ga0501045_0026222 3300049824 Bacteria 4191
356 Ga0501045_0385491 3300049824 Bacteria 1043
357 nmdc:mga03n38_16179_c1 3300050490 Bacteria 2898
358 nmdc:mga06z11_5928_c1 3300050494 Bacteria 4936
359 nmdc:mga04h51_1819_c1 3300050495 Bacteria 4988
360 Ga0495655_0001745 3300053083 Bacteria 3370
361 Ga0495595_0195557 3300053084 Bacteria 1006
362 Ga0495619_0117803 3300053085 Bacteria 1819
363 Ga0500566_0154584 3300053094 Bacteria 1202
364 Ga0500560_022872 3300053107 Bacteria 1806
365 Ga0500569_004341 3300053109 Bacteria 2973
366 Ga0500614_023745 3300053123 Bacteria 1443
367 Ga0500652_006081 3300053131 Bacteria 3855
368 Ga0500658_0058921 3300053134 Bacteria 1591
369 Ga0500559_0135155 3300053136 Bacteria 1153
370 Ga0500573_0098348 3300053140 Bacteria 1648
371 Ga0500573_0109181 3300053140 Bacteria 1549
372 Ga0500579_081944 3300053143 Bacteria 1798
373 Ga0500600_0040787 3300053149 Bacteria 2679
374 Ga0500624_002646 3300053157 Bacteria 2396
375 Ga0500633_0000700 3300053160 Bacteria 5659
376 Ga0500656_001492 3300053732 Bacteria 2022
377 Ga0466962_0002299 3300061719 Bacteria 9058
378 2954705308 2954701450 Bacteria 10834262
379 2547408152 2547132111 Bacteria 8013147
380 2554257781 2554235005 Bacteria 6457341
381 2585299180 2582581312 Bacteria 7308206
382 2585308837 2582581313 Bacteria 10042643
383 2585313527 2582581314 Bacteria 11452267
384 2616695033 2616644814 Bacteria 11555299
385 2616902202 2616644941 Bacteria 8510691
386 2643764976 2643221548 Bacteria 8053412
387 2643902545 2643221578 Bacteria 9213798
388 2643942218 2643221587 Bacteria 7586415
389 2644017161 2643221601 Bacteria 7493239
390 2644173878 2643221631 Bacteria 8168043
391 2644262324 2643221647 Bacteria 10741251
392 2644389888 2643221670 Bacteria 6497041
393 2644404946 2643221673 Bacteria 9196637
394 2644429301 2643221677 Bacteria 7584031
395 2644437193 2643221678 Bacteria 9540101
396 2644461184 2643221682 Bacteria 6743283
397 2644628934 2643221714 Bacteria 9015452
398 2784588607 2784132148 Bacteria 8627943
399 2785343256 2784746763 Bacteria 9783172
400 2785369548 2784746768 Bacteria 10036182
401 2786670650 2786546132 Bacteria 10419719
402 2793984855 2791355406 Bacteria 11364898
403 2804847002 2802429296 Bacteria 7227771
404 2808842092 2808606359 Bacteria 9866990
405 2808920617 2808606375 Bacteria 9466072
406 2809232220 2808606448 Bacteria 8656184
407 2811849101 2808606982 Bacteria 7791042
408 2812358044 2811994879 Bacteria 9313447
409 2812480479 2811994917 Bacteria 7761064
410 2819695427 2818991463 Bacteria 7948711
411 2819741176 2818991472 Bacteria 10089953
412 2852636613 2852635781 Bacteria 8251373
413 2862179444 2862178590 Bacteria 8583590
414 2862285705 2862281513 Bacteria 9621493
415 2862291818 2862290372 Bacteria 7471434
416 2862388882 2862382967 Bacteria 10317375
417 2862511765 2862507626 Bacteria 9425308
418 2862579223 2862574272 Bacteria 10567477
419 2863404561 2863404153 Bacteria 9672205
420 2867432863 2867428634 Bacteria 9590268
421 2867475171 2867475112 Bacteria 6909112
422 2875395705 2875391855 Bacteria 7600475
423 2877681070 2877676314 Bacteria 9512378
424 2912719911 2912715099 Bacteria 9460473
425 2912724314 2912723979 Bacteria 8557534
426 2912760821 2912757875 Bacteria 7940295
427 2918505600 2918501144 Bacteria 8668083
428 2919469481 2919468124 Bacteria 9133025
429 2935393382 2935390628 Bacteria 7043367
430 2946048938 2946045630 Bacteria 8527308
431 2946067798 2946064051 Bacteria 8957905
432 2946075950 2946072368 Bacteria 8999607
433 2947229186 2947224130 Bacteria 9938529
434 2954007357 2954002825 Bacteria 9173742
435 2954386187 2954380949 Bacteria 10050426
436 2954676973 2954673503 Bacteria 9685905
437 2954687185 2954682443 Bacteria 9862841
438 2954696830 2954691527 Bacteria 10720516
439 2954716201 2954711539 Bacteria 10867210
440 2954726144 2954721474 Bacteria 10456478
441 2954735666 2954731030 Bacteria 10243860
442 2954745070 2954740390 Bacteria 10229294
443 2954754522 2954749733 Bacteria 10366972
444 2966601668 2966598605 Bacteria 7676064
445 2990065881 2990059506 Bacteria 9321252
446 2990093841 2990088156 Bacteria 6657676
447 2995465871 2995463766 Bacteria 8577691
448 2995466725 2995463766 Bacteria 8577691
449 2997457801 2997451912 Bacteria 8492419
450 2997600380 2997600082 Bacteria 9896405
451 3006393925 3006393351 Bacteria 6615579
452 3006491051 3006486233 Bacteria 8157040
453 3006500792 3006493962 Bacteria 8825450
454 8008567259 8008558824 Bacteria 10610750
455 8008578850 8008574985 Bacteria 7815457
456 8023630135 8023623736 Bacteria 8593882
457 8025417807 8025413630 Bacteria 7014048
458 8025480313 8025478263 Bacteria 8209203
459 8025537992 8025530807 Bacteria 8495698
460 8047898078 8047893842 Bacteria 11723082
461 8048360815 8048356638 Bacteria 11044339
462 8048375041 8048369669 Bacteria 11666822
463 8048383165 8048379754 Bacteria 11877923
464 8048412713 8048406513 Bacteria 8936924
465 8054166496 8054160619 Bacteria 7783213
466 8056453016 8056447290 Bacteria 7680491
467 8056669593 8056667051 Bacteria 6953971
468 8056833589 8056829672 Bacteria 9045328
469 rootH1_10030663
470 JGI25160J50197_1032665
471 Ga0006562J51391_1083925
472 Ga0006562J51391_1083926
473 Ga0006562J51391_1152267
474 Ga0070709_10001322
475 Ga0070714_100013695
476 Ga0070713_100010571
477 Ga0070710_10001003
478 Ga0070706_100013218
479 Ga0070698_100002343
480 Ga0068853_100104729
481 Ga0070717_10012997
482 Ga0070716_100000703
483 Ga0070712_100001764
484 Ga0075367_10005155
485 Ga0105243_10544651
486 Ga0105243_10552623
487 Ga0105248_10140878
488 Ga0105238_10283829
489 Ga0105246_10013563
490 Ga0182008_10007321
491 Ga0182007_10003634
492 Ga0182005_1013146
493 Ga0183367_1005
494 Ga0213875_10001733
495 Ga0207426_1001263
496 Ga0207426_1002306
497 Ga0207426_1022263
498 Ga0207692_10017765
499 Ga0207647_10054937
500 Ga0207699_10000452
501 Ga0207684_10035776
502 Ga0207693_10002107
503 Ga0207650_10207577
504 Ga0207700_10000250
505 Ga0207664_10000298
506 Ga0207709_10022860
507 Ga0207709_10390697
508 Ga0207665_10008570
509 Ga0207702_10089885
510 Ga0307517_10009430
511 Ga0307517_10085751
512 Ga0307515_10000732
513 Ga0307515_10083685
514 Ga0307511_10022075
515 Ga0307511_10039634
516 Ga0307512_10002037
517 Ga0307512_10106111
518 Ga0307513_10025352
519 Ga0307509_10128321
520 Ga0307509_10153989
521 Ga0307508_10018479
522 Ga0307508_10030051
523 Ga0307508_10146953
524 Ga0307508_10191952
525 Ga0307514_10031987
526 Ga0307516_10006130
527 Ga0307516_10100138
528 Ga0307516_10274503
529 Ga0307410_10072630
530 Ga0307507_10030274
531 Ga0307510_10006030
532 Ga0307510_10050824
533 Ga0307510_10058517
534 Ga0395900_0100595
535 Ga0395900_0290087
536 Ga0395898_0001516
537 Ga0395898_0042551
538 Ga0395898_0545965
539 Ga0436364_0258391
540 Ga0395901_0034325
541 Ga0395901_0111648
542 Ga0439436_0000672
543 Ga0439439_0001630
544 Ga0451841_0421714
545 Ga0451853_0566122
546 Ga0439433_0000071
547 Ga0439448_0023204
548 Ga0439449_0004703
549 Ga0439450_035714
550 Ga0439457_006692
551 Ga0439462_0006743
552 Ga0450900_002544
553 Ga0450900_016418
554 Ga0450902_013688
555 Ga0450903_003782
556 Ga0450903_006162
557 Ga0439458_0008180
558 Ga0466969_0001410
559 Ga0466969_0069986
560 Ga0466972_0000841
561 Ga0466972_0007559
562 Ga0466965_0020010
563 Ga0466965_0022533
564 Ga0466965_0024366
565 Ga0466966_0002493
566 Ga0466966_0010258
567 Ga0466966_0031498
568 Ga0466961_0009522
569 Ga0466961_0013959
570 Ga0466963_0001643
571 Ga0466963_0024243
572 Ga0466963_0129464
573 Ga0466964_0000595
574 Ga0466971_0000309
575 Ga0466968_0002671
576 Ga0466968_0066105
577 Ga0466970_0002310
578 Ga0466970_0007725
579 Ga0466970_0083359
580 Ga0466957_0001252
581 Ga0466959_0000404
582 Ga0466959_0001283
583 Ga0466958_0001470
584 Ga0466967_0017240
585 Ga0466967_0023396
586 Ga0466967_0097350
587 Ga0495617_003068
588 Ga0495627_010630
589 Ga0495592_0001818
590 Ga0495592_0021918
591 Ga0495603_0002717
592 Ga0495603_0009247
593 Ga0495603_0019497
594 Ga0495603_0026663
595 Ga0495629_0003140
596 Ga0495629_0003504
597 Ga0495629_0004770
598 Ga0495629_0017734
599 Ga0495629_0025846
600 Ga0495629_0034353
601 Ga0495629_0035490
602 Ga0495629_0070017
603 Ga0495629_0071088
604 Ga0495629_0171985
605 Ga0495629_0346810
606 Ga0495638_0013053
607 Ga0495651_0004717
608 Ga0495651_0021283
609 Ga0495653_0013648
610 Ga0495580_0003440
611 Ga0495582_0057641
612 Ga0495605_0125761
613 Ga0495639_0030541
614 Ga0495662_0010901
615 Ga0495662_0042424
616 Ga0495662_0049005
617 Ga0495664_0010626
618 Ga0495664_0102186
619 Ga0495664_0117412
620 Ga0495584_0030252
621 Ga0495585_0193784
622 Ga0495594_0006666
623 Ga0495594_0053222
624 Ga0495594_0112215
625 Ga0495607_0130519
626 Ga0495583_0092102
627 Ga0495608_0011417
628 Ga0495616_0005944
629 Ga0495618_0115005
630 Ga0495618_0144091
631 Ga0495620_0021230
632 Ga0495620_0038194
633 Ga0495620_0087510
634 Ga0495628_0004596
635 Ga0495628_0121820
636 Ga0495630_0102921
637 Ga0495630_0165123
638 Ga0495632_0017340
639 Ga0495632_0094095
640 Ga0495643_0012596
641 Ga0495648_0175448
642 Ga0495666_0006942
643 Ga0495666_0012839
644 Ga0495652_0029868
645 Ga0495652_0036990
646 Ga0495652_0345096
647 Ga0495665_0011688
648 Ga0495640_0096935
649 Ga0495586_0026316
650 Ga0495587_0007444
651 Ga0495587_0037882
652 Ga0495597_0008611
653 Ga0495597_0021742
654 Ga0495645_0016867
655 Ga0495645_0054126
656 Ga0495622_0011878
657 Ga0495622_0053632
658 Ga0495622_0082750
659 Ga0495667_0085244
660 Ga0495667_0299955
661 Ga0495668_0039893
662 Ga0495668_0128985
663 Ga0495634_0006322
664 Ga0495634_0039686
665 Ga0495611_0038263
666 Ga0495625_0007457
667 Ga0495625_0020430
668 Ga0495625_0074050
669 Ga0495635_0036241
670 Ga0495661_0008179
671 Ga0495588_0011853
672 Ga0495588_0033436
673 Ga0495588_0244771
674 Ga0495657_0005176
675 Ga0495657_0018562
676 Ga0495657_0023468
677 Ga0495657_0145344
678 Ga0495657_0211943
679 Ga0495623_0015203
680 Ga0495623_0051370
681 Ga0495646_0000377
682 Ga0495646_0002684
683 Ga0495658_0011679
684 Ga0495613_0001277
685 Ga0495613_0011900
686 Ga0495613_0013851
687 Ga0495613_0119138
688 Ga0495613_0221369
689 Ga0495624_0048794
690 Ga0495624_0224530
691 Ga0495670_0010864
692 Ga0495670_0085521
693 Ga0495671_0049866
694 Ga0495671_0101750
695 Ga0495671_0109315
696 Ga0495671_0156046
697 Ga0495649_0166298
698 Ga0495589_0063655
699 Ga0495589_0077002
700 Ga0495589_0087550
701 Ga0495589_0106142
702 Ga0495600_0005404
703 Ga0495600_0020403
704 Ga0495600_0153094
705 Ga0495660_0008726
706 Ga0495660_0034856
707 Ga0495581_0005835
708 Ga0495581_0016600
709 Ga0495581_0028487
710 Ga0495581_0036688
711 Ga0495604_0000208
712 Ga0495604_0000705
713 Ga0495604_0004412
714 Ga0495604_0044749
715 Ga0495636_0002249
716 Ga0495636_0025512
717 Ga0495636_0077655
718 Ga0495636_0121113
719 Ga0495636_0150137
720 Ga0495674_0066107
721 Ga0495676_0004665
722 Ga0495676_0012021
723 Ga0495676_0015680
724 Ga0495676_0034988
725 Ga0495676_0051553
726 Ga0495680_0020677
727 Ga0495683_0062712
728 Ga0495687_002090
729 Ga0495687_003000
730 Ga0495687_025045
731 Ga0495675_0004686
732 Ga0495675_0012607
733 Ga0495675_0144888
734 Ga0495685_000820
735 Ga0495685_001018
736 Ga0495685_002292
737 Ga0495685_006497
738 Ga0495685_026944
739 Ga0495681_0003349
740 Ga0495681_0003707
741 Ga0495681_0017114
742 Ga0495684_0015555
743 Ga0495684_0123594
744 Ga0495686_0039850
745 Ga0495686_0042441
746 Ga0495686_0097338
747 Ga0495593_0002365
748 Ga0495593_0017007
749 Ga0495593_0034292
750 Ga0495593_0090349
751 Ga0495602_0030767
752 Ga0495602_0210557
753 Ga0495614_0000859
754 Ga0495614_0009749
755 Ga0495614_0020332
756 Ga0496106_0031001
757 Ga0496109_0259927
758 Ga0496110_0132137
759 Ga0501323_010334
760 Ga0501031_0196785
761 Ga0501032_0047155
762 Ga0501032_0069704
763 Ga0501032_0124355
764 Ga0501033_0001467
765 Ga0501033_0044298
766 Ga0501033_0265393
767 Ga0501033_0366946
768 Ga0501034_0002305
769 Ga0501034_0011069
770 Ga0501034_0088166
771 Ga0501034_0142770
772 Ga0501034_0187443
773 Ga0501036_0004198
774 Ga0501036_0005527
775 Ga0501036_0029609
776 Ga0501036_0469860
777 Ga0501036_0541681
778 Ga0501037_0027343
779 Ga0501037_0175281
780 Ga0501038_0006999
781 Ga0501038_0037963
782 Ga0501038_0076250
783 Ga0501038_0351088
784 Ga0501039_0046397
785 Ga0501039_0147434
786 Ga0501039_0449818
787 Ga0501042_0362389
788 Ga0501043_0001789
789 Ga0501043_0039834
790 Ga0501043_0069687
791 Ga0501046_0080598
792 Ga0501046_0094578
793 Ga0501046_0237020
794 Ga0501047_0011889
795 Ga0501047_0019420
796 Ga0501047_0040964
797 Ga0501047_0048773
798 Ga0501047_0205815
799 Ga0501047_0244366
800 Ga0501048_0088749
801 Ga0501069_0074177
802 Ga0501070_0000381
803 Ga0501070_0002977
804 Ga0501070_0024311
805 Ga0501074_0009025
806 Ga0501080_0042904
807 Ga0501080_0257232
808 Ga0501035_0000885
809 Ga0501035_0007747
810 Ga0501035_0013935
811 Ga0501035_0025882
812 Ga0501035_0126960
813 Ga0501035_0138454
814 Ga0501035_0219569
815 Ga0501035_0361310
816 Ga0501044_0000276
817 Ga0501044_0003934
818 Ga0501044_0072650
819 Ga0501044_0078048
820 Ga0501044_0092694
821 Ga0501044_0157112
822 Ga0501044_0164737
823 Ga0501045_0026222
824 Ga0501045_0385491
825 nmdc:mga03n38_16179_c1
826 nmdc:mga06z11_5928_c1
827 nmdc:mga04h51_1819_c1
828 Ga0495655_0001745
829 Ga0495595_0195557
830 Ga0495619_0117803
831 Ga0500566_0154584
832 Ga0500560_022872
833 Ga0500569_004341
834 Ga0500614_023745
835 Ga0500652_006081
836 Ga0500658_0058921
837 Ga0500559_0135155
838 Ga0500573_0098348
839 Ga0500573_0109181
840 Ga0500579_081944
841 Ga0500600_0040787
842 Ga0500624_002646
843 Ga0500633_0000700
844 Ga0500656_001492
845 Ga0466962_0002299
846 2954705308
847 2547408152
848 2554257781
849 2585299180
850 2585308837
851 2585313527
852 2616695033
853 2616902202
854 2643764976
855 2643902545
856 2643942218
857 2644017161
858 2644173878
859 2644262324
860 2644389888
861 2644404946
862 2644429301
863 2644437193
864 2644461184
865 2644628934
866 2784588607
867 2785343256
868 2785369548
869 2786670650
870 2793984855
871 2804847002
872 2808842092
873 2808920617
874 2809232220
875 2811849101
876 2812358044
877 2812480479
878 2819695427
879 2819741176
880 2852636613
881 2862179444
882 2862285705
883 2862291818
884 2862388882
885 2862511765
886 2862579223
887 2863404561
888 2867432863
889 2867475171
890 2875395705
891 2877681070
892 2912719911
893 2912724314
894 2912760821
895 2918505600
896 2919469481
897 2935393382
898 2946048938
899 2946067798
900 2946075950
901 2947229186
902 2954007357
903 2954386187
904 2954676973
905 2954687185
906 2954696830
907 2954716201
908 2954726144
909 2954735666
910 2954745070
911 2954754522
912 2966601668
913 2990065881
914 2990093841
915 2995465871
916 2995466725
917 2997457801
918 2997600380
919 3006393925
920 3006491051
921 3006500792
922 8008567259
923 8008578850
924 8023630135
925 8025417807
926 8025480313
927 8025537992
928 8047898078
929 8048360815
930 8048375041
931 8048383165
932 8048412713
933 8054166496
934 8056453016
935 8056669593
936 8056833589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11228

DUF3027

Protein of unknown function (DUF3027)

32

258

0.93

Map