F450133

General Info

Members Datasets Scaffolds Average Seq Length
468 225 936 368

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_4563_c1|nmdc:mga09592_4563_c1_4506_5612
Length 368
Sequence VDENFSPPNYTIGIEEELMILDAETLELVNAVESLLEGQSPERVKPELMESVLEIATSPQPNAAEAGAELRALRRRVADAAAQRGLTIGSAGTHPFAMWEEQRIVARPRYRDLVSDLRFVARQELLFGQHVHVGLDDREKAIHVANGMRVHLPVLLALSANSPFWRADATGLASTRTPIFRAFPRVGIPPTYEDWADYEQKIVFMVASRVIEDYTYLWYDVRPHPNLGTVEIRVMDAQTRVEHTLGLAALIQAMVKELAEHFEAGRELTRYPHQMVDENKWLAARHGLDGELVDLPSRERVSTRELARRLLDRLRPHAEELGSAAELAGVEDVLERGNGAARQLVVHEANHDLREVVAEIAAATVDVG

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
220 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 9.4
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_4563_c1 3300050508 Bacteria 11207
2 JGI25407J50210_10000068 3300003373 Bacteria 12778
3 JGI25407J50210_10000664 3300003373 Bacteria 7099
4 JGI25407J50210_10006566 3300003373 Bacteria 2900
5 Ga0070658_10026398 3300005327 Bacteria 4659
6 Ga0070658_10157133 3300005327 Bacteria 1906
7 Ga0070683_100005341 3300005329 Bacteria 10712
8 Ga0070683_100007308 3300005329 Bacteria 9324
9 Ga0070683_100010413 3300005329 Bacteria 7997
10 Ga0070680_100014377 3300005336 Bacteria 6185
11 Ga0070682_100016974 3300005337 Bacteria 4238
12 Ga0070682_100055098 3300005337 Bacteria 2497
13 Ga0070660_100010095 3300005339 Bacteria 6662
14 Ga0070661_100025146 3300005344 Bacteria 4277
15 Ga0070661_100117825 3300005344 Bacteria 1987
16 Ga0070668_100001500 3300005347 Bacteria 16863
17 Ga0070675_100043807 3300005354 Bacteria 3659
18 Ga0070675_100148902 3300005354 Bacteria 2005
19 Ga0070671_100236982 3300005355 Bacteria 1549
20 Ga0070674_100016281 3300005356 Bacteria 4659
21 Ga0070674_100030202 3300005356 Bacteria 3578
22 Ga0070688_100108322 3300005365 Bacteria 1843
23 Ga0070659_100006276 3300005366 Bacteria 8591
24 Ga0070659_100009615 3300005366 Bacteria 7107
25 Ga0070659_100160193 3300005366 Bacteria 1839
26 Ga0070709_10053572 3300005434 Bacteria 2541
27 Ga0070714_100000038 3300005435 Bacteria 121712
28 Ga0070714_100002632 3300005435 Bacteria 13220
29 Ga0070714_100101512 3300005435 Bacteria 2535
30 Ga0070714_100131097 3300005435 Bacteria 2240
31 Ga0070714_100213892 3300005435 Bacteria 1768
32 Ga0070713_100112820 3300005436 Bacteria 2372
33 Ga0070710_10000001 3300005437 Bacteria 552187
34 Ga0070710_10012449 3300005437 Bacteria 4226
35 Ga0070710_10131056 3300005437 Bacteria 1529
36 Ga0070711_100024100 3300005439 Bacteria 3966
37 Ga0070711_100065180 3300005439 Bacteria 2547
38 Ga0070711_100147305 3300005439 Bacteria 1772
39 Ga0070700_100017751 3300005441 Bacteria 4076
40 Ga0070662_100071598 3300005457 Bacteria 2557
41 Ga0070681_10031424 3300005458 Bacteria 5331
42 Ga0068867_100057286 3300005459 Bacteria 2885
43 Ga0070685_10011694 3300005466 Bacteria 4599
44 Ga0070679_100002504 3300005530 Bacteria 16640
45 Ga0070684_100022610 3300005535 Bacteria 5247
46 Ga0070684_100028892 3300005535 Bacteria 4693
47 Ga0070684_100061478 3300005535 Bacteria 3287
48 Ga0070672_100119288 3300005543 Bacteria 2158
49 Ga0070693_100137331 3300005547 Bacteria 1535
50 Ga0070665_100003731 3300005548 Bacteria 16131
51 Ga0070664_100218485 3300005564 Bacteria 1705
52 Ga0068857_100018351 3300005577 Bacteria 6138
53 Ga0068854_100086166 3300005578 Bacteria 2328
54 Ga0068856_100008470 3300005614 Bacteria 10008
55 Ga0068856_100013508 3300005614 Bacteria 7905
56 Ga0068852_100057085 3300005616 Bacteria 3376
57 Ga0068852_100308074 3300005616 Bacteria 1535
58 Ga0068859_100187596 3300005617 Bacteria 2152
59 Ga0068864_100039174 3300005618 Bacteria 4050
60 Ga0068866_10013902 3300005718 Bacteria 3541
61 Ga0068861_100005046 3300005719 Bacteria 8904
62 Ga0068861_100031308 3300005719 Bacteria 3908
63 Ga0068863_100169478 3300005841 Bacteria 2094
64 Ga0068862_100072374 3300005844 Bacteria 2977
65 Ga0081455_10055356 3300005937 Bacteria 3374
66 Ga0081538_10000550 3300005981 Bacteria 41448
67 Ga0081538_10000650 3300005981 Bacteria 38474
68 Ga0081538_10000897 3300005981 Bacteria 32265
69 Ga0081538_10001437 3300005981 Bacteria 24494
70 Ga0081538_10002641 3300005981 Bacteria 17305
71 Ga0081538_10003421 3300005981 Bacteria 15012
72 Ga0081538_10003460 3300005981 Bacteria 14910
73 Ga0081538_10003534 3300005981 Bacteria 14703
74 Ga0081538_10005294 3300005981 Bacteria 11640
75 Ga0081538_10010718 3300005981 Bacteria 7502
76 Ga0081538_10014284 3300005981 Bacteria 6222
77 Ga0081538_10015943 3300005981 Bacteria 5792
78 Ga0081538_10031938 3300005981 Bacteria 3539
79 Ga0081538_10082501 3300005981 Bacteria 1704
80 Ga0081540_1012878 3300005983 Bacteria 5469
81 Ga0081539_10003175 3300005985 Bacteria 20824
82 Ga0070717_10036497 3300006028 Bacteria 3986
83 Ga0070717_10063012 3300006028 Bacteria 3076
84 Ga0070717_10149675 3300006028 Bacteria 2019
85 Ga0075365_10201041 3300006038 Bacteria 1396
86 Ga0075432_10062619 3300006058 Bacteria 1327
87 Ga0070712_100024793 3300006175 Bacteria 3979
88 Ga0075428_100052481 3300006844 Bacteria 4469
89 Ga0075430_100008624 3300006846 Bacteria 8600
90 Ga0075430_100030566 3300006846 Bacteria 4575
91 Ga0075430_100088409 3300006846 Bacteria 2593
92 Ga0075431_100002773 3300006847 Bacteria 16973
93 Ga0075431_100013327 3300006847 Bacteria 8310
94 Ga0075431_100097904 3300006847 Bacteria 3029
95 Ga0075431_100133923 3300006847 Bacteria 2555
96 Ga0075431_100153874 3300006847 Bacteria 2367
97 Ga0075434_100039724 3300006871 Bacteria 4661
98 Ga0075434_100082757 3300006871 Bacteria 3207
99 Ga0075429_100009743 3300006880 Bacteria 8326
100 Ga0075429_100080649 3300006880 Bacteria 2837
101 Ga0097620_100187614 3300006931 Bacteria 2152
102 Ga0075435_100027784 3300007076 Bacteria 4430
103 Ga0075435_100068457 3300007076 Bacteria 2892
104 Ga0105240_10113455 3300009093 Bacteria 3275
105 Ga0105240_10184586 3300009093 Bacteria 2458
106 Ga0111539_10030723 3300009094 Bacteria 6530
107 Ga0111539_10032548 3300009094 Bacteria 6331
108 Ga0111539_10048843 3300009094 Bacteria 5050
109 Ga0111539_10356657 3300009094 Bacteria 1702
110 Ga0105245_10001196 3300009098 Bacteria 23481
111 Ga0105245_10014924 3300009098 Bacteria 6768
112 Ga0105245_10039367 3300009098 Bacteria 4207
113 Ga0105245_10149749 3300009098 Bacteria 2205
114 Ga0105247_10100346 3300009101 Bacteria 1850
115 Ga0114129_10002380 3300009147 Bacteria 26121
116 Ga0114129_10011624 3300009147 Bacteria 12531
117 Ga0114129_10018334 3300009147 Bacteria 9971
118 Ga0114129_10070781 3300009147 Bacteria 4864
119 Ga0114129_10102800 3300009147 Bacteria 3951
120 Ga0114129_10288590 3300009147 Bacteria 2190
121 Ga0105243_10013515 3300009148 Bacteria 6175
122 Ga0105243_10039614 3300009148 Bacteria 3675
123 Ga0105248_10201613 3300009177 Bacteria 2242
124 Ga0105237_10128083 3300009545 Bacteria 2533
125 Ga0105237_10207468 3300009545 Bacteria 1960
126 Ga0105238_10007174 3300009551 Bacteria 11146
127 Ga0105249_10004099 3300009553 Bacteria 12584
128 Ga0105249_10077622 3300009553 Bacteria 3080
129 Ga0105249_10095073 3300009553 Bacteria 2794
130 Ga0105249_10269518 3300009553 Bacteria 1696
131 Ga0105246_10032800 3300011119 Bacteria 3447
132 Ga0105246_10072055 3300011119 Bacteria 2435
133 Ga0157369_10287740 3300013105 Bacteria 1711
134 Ga0157374_10009955 3300013296 Bacteria 8162
135 Ga0157378_10238669 3300013297 Bacteria 1736
136 Ga0163162_10034125 3300013306 Bacteria 5061
137 Ga0157372_10047266 3300013307 Bacteria 4781
138 Ga0157372_10097945 3300013307 Bacteria 3345
139 Ga0157375_10092195 3300013308 Bacteria 3093
140 Ga0163163_10063073 3300014325 Bacteria 3673
141 Ga0157377_10001920 3300014745 Bacteria 9099
142 Ga0163161_10214335 3300017792 Bacteria 1489
143 Ga0206353_11621476 3300020082 Bacteria 2614
144 Ga0213874_10000318 3300021377 Bacteria 9539
145 Ga0213876_10044310 3300021384 Bacteria 2351
146 Ga0213876_10069796 3300021384 Bacteria 1856
147 Ga0213876_10131822 3300021384 Bacteria 1328
148 Ga0213875_10015898 3300021388 Bacteria 3656
149 Ga0213875_10036884 3300021388 Bacteria 2305
150 Ga0207692_10000004 3300025898 Bacteria 413600
151 Ga0207692_10018484 3300025898 Bacteria 3130
152 Ga0207692_10085159 3300025898 Bacteria 1700
153 Ga0207692_10199560 3300025898 Bacteria 1175
154 Ga0207688_10013483 3300025901 Bacteria 4442
155 Ga0207688_10017041 3300025901 Bacteria 3947
156 Ga0207688_10032921 3300025901 Bacteria 2865
157 Ga0207688_10085938 3300025901 Bacteria 1802
158 Ga0207643_10120773 3300025908 Bacteria 1552
159 Ga0207707_10120056 3300025912 Bacteria 2298
160 Ga0207707_10195118 3300025912 Bacteria 1766
161 Ga0207695_10105335 3300025913 Bacteria 2808
162 Ga0207695_10154770 3300025913 Bacteria 2228
163 Ga0207671_10112814 3300025914 Bacteria 2070
164 Ga0207693_10019479 3300025915 Bacteria 5396
165 Ga0207693_10034146 3300025915 Bacteria 4012
166 Ga0207693_10093141 3300025915 Bacteria 2361
167 Ga0207663_10044528 3300025916 Bacteria 2725
168 Ga0207660_10047950 3300025917 Bacteria 3022
169 Ga0207657_10009557 3300025919 Bacteria 9732
170 Ga0207657_10052776 3300025919 Bacteria 3527
171 Ga0207652_10019099 3300025921 Bacteria 5631
172 Ga0207652_10078250 3300025921 Bacteria 2887
173 Ga0207681_10063448 3300025923 Bacteria 2548
174 Ga0207694_10295296 3300025924 Bacteria 1333
175 Ga0207687_10021137 3300025927 Bacteria 4320
176 Ga0207687_10026559 3300025927 Bacteria 3878
177 Ga0207687_10053562 3300025927 Bacteria 2819
178 Ga0207687_10067768 3300025927 Bacteria 2540
179 Ga0207700_10037955 3300025928 Bacteria 3493
180 Ga0207664_10000040 3300025929 Bacteria 158895
181 Ga0207664_10003205 3300025929 Bacteria 10878
182 Ga0207664_10018804 3300025929 Bacteria 5096
183 Ga0207664_10031602 3300025929 Bacteria 4051
184 Ga0207664_10032459 3300025929 Bacteria 4001
185 Ga0207664_10443614 3300025929 Bacteria 1158
186 Ga0207644_10056527 3300025931 Bacteria 2832
187 Ga0207690_10000166 3300025932 Bacteria 51430
188 Ga0207690_10067453 3300025932 Bacteria 2454
189 Ga0207690_10105561 3300025932 Bacteria 2020
190 Ga0207704_10109176 3300025938 Bacteria 1865
191 Ga0207665_10084609 3300025939 Bacteria 2189
192 Ga0207665_10179404 3300025939 Bacteria 1533
193 Ga0207691_10076401 3300025940 Bacteria 3018
194 Ga0207691_10090840 3300025940 Bacteria 2737
195 Ga0207691_10154468 3300025940 Bacteria 2016
196 Ga0207711_10239780 3300025941 Bacteria 1662
197 Ga0207689_10020581 3300025942 Bacteria 5551
198 Ga0207661_10002146 3300025944 Bacteria 13578
199 Ga0207661_10005300 3300025944 Bacteria 9076
200 Ga0207661_10006163 3300025944 Bacteria 8477
201 Ga0207661_10228990 3300025944 Bacteria 1645
202 Ga0207679_10048245 3300025945 Bacteria 3099
203 Ga0207679_10129926 3300025945 Bacteria 2019
204 Ga0207712_10020393 3300025961 Bacteria 4340
205 Ga0207668_10025629 3300025972 Bacteria 3818
206 Ga0207668_10054114 3300025972 Bacteria 2785
207 Ga0207668_10111936 3300025972 Bacteria 2050
208 Ga0207658_10109756 3300025986 Bacteria 2179
209 Ga0207658_10179592 3300025986 Bacteria 1751
210 Ga0207678_10103594 3300026067 Bacteria 2429
211 Ga0207678_10165819 3300026067 Bacteria 1886
212 Ga0207678_10254772 3300026067 Bacteria 1504
213 Ga0207708_10000234 3300026075 Bacteria 43753
214 Ga0207708_10003129 3300026075 Bacteria 12181
215 Ga0207708_10023069 3300026075 Bacteria 4701
216 Ga0207708_10104328 3300026075 Bacteria 2196
217 Ga0207708_10343184 3300026075 Bacteria 1223
218 Ga0207702_10031128 3300026078 Bacteria 4447
219 Ga0207641_10239570 3300026088 Bacteria 1690
220 Ga0207648_10280404 3300026089 Bacteria 1490
221 Ga0207676_10047728 3300026095 Bacteria 3320
222 Ga0207676_10079797 3300026095 Bacteria 2655
223 Ga0207674_10018826 3300026116 Bacteria 7491
224 Ga0207674_10134715 3300026116 Bacteria 2432
225 Ga0207674_10265477 3300026116 Bacteria 1664
226 Ga0207675_100006144 3300026118 Bacteria 11415
227 Ga0207675_100245347 3300026118 Bacteria 1732
228 Ga0207683_10149064 3300026121 Bacteria 2110
229 Ga0207698_10080656 3300026142 Bacteria 2622
230 Ga0207428_10091881 3300027907 Bacteria 2356
231 Ga0268266_10042885 3300028379 Bacteria 3865
232 Ga0268265_10374262 3300028380 Bacteria 1308
233 Ga0268264_10060932 3300028381 Bacteria 3164
234 Ga0265326_10000008 3300028558 Bacteria 210923
235 Ga0265334_10000099 3300028573 Bacteria 59607
236 Ga0265336_10001790 3300028666 Bacteria 9396
237 Ga0265338_10006649 3300028800 Bacteria 14633
238 Ga0265338_10109964 3300028800 Bacteria 2222
239 Ga0265324_10001720 3300029957 Bacteria 12040
240 Ga0307408_100081656 3300031548 Bacteria 2417
241 Ga0307408_100103973 3300031548 Bacteria 2169
242 Ga0307413_10045259 3300031824 Bacteria 2607
243 Ga0307413_10093916 3300031824 Bacteria 1962
244 Ga0307413_10099387 3300031824 Bacteria 1918
245 Ga0307413_10223453 3300031824 Bacteria 1377
246 Ga0307410_10070144 3300031852 Bacteria 2426
247 Ga0307410_10207781 3300031852 Bacteria 1498
248 Ga0307406_10012068 3300031901 Bacteria 4916
249 Ga0307406_10214836 3300031901 Bacteria 1425
250 Ga0307407_10037107 3300031903 Bacteria 2691
251 Ga0307412_10056447 3300031911 Bacteria 2617
252 Ga0307412_10094187 3300031911 Bacteria 2103
253 Ga0307409_100074684 3300031995 Bacteria 2710
254 Ga0307409_100092619 3300031995 Bacteria 2480
255 Ga0307416_100126340 3300032002 Bacteria 2291
256 Ga0307416_100150660 3300032002 Bacteria 2132
257 Ga0307416_100230251 3300032002 Bacteria 1786
258 Ga0307411_10026355 3300032005 Bacteria 3499
259 Ga0307411_10037485 3300032005 Bacteria 3049
260 Ga0307415_100001209 3300032126 Bacteria 12111
261 Ga0307415_100023133 3300032126 Bacteria 3851
262 Ga0307415_100023788 3300032126 Bacteria 3811
263 Ga0373931_0122761 3300035691 Bacteria 1486
264 Ga0373933_0059228 3300035724 Bacteria 2306
265 Ga0373937_0030606 3300036401 Bacteria 4874
266 Ga0395899_0012959 3300037312 Bacteria 6378
267 Ga0395899_0213454 3300037312 Bacteria 1340
268 Ga0395900_0014319 3300037418 Bacteria 8097
269 Ga0395898_0009759 3300037466 Bacteria 10058
270 Ga0395898_0062633 3300037466 Bacteria 3612
271 Ga0395898_0129030 3300037466 Bacteria 2422
272 Ga0395898_0207153 3300037466 Bacteria 1871
273 Ga0395898_0381027 3300037466 Bacteria 1345
274 Ga0395898_0462611 3300037466 Bacteria 1208
275 Ga0395905_0013964 3300037471 Bacteria 7682
276 Ga0436364_0314883 3300037853 Bacteria 27454
277 Ga0436364_0383541 3300037853 Bacteria 4034
278 Ga0436364_0513584 3300037853 Bacteria 44658
279 Ga0436364_0713043 3300037853 Bacteria 13874
280 Ga0436364_0971417 3300037853 Bacteria 3699
281 Ga0436364_1337251 3300037853 Bacteria 2047
282 Ga0436364_1406657 3300037853 Bacteria 2277
283 Ga0395901_0010606 3300038443 Bacteria 9334
284 Ga0395901_0055093 3300038443 Bacteria 4134
285 Ga0395901_0092631 3300038443 Bacteria 3163
286 Ga0436365_0829003 3300039437 Bacteria 5079
287 Ga0436365_1126921 3300039437 Bacteria 11337
288 Ga0436365_1187404 3300039437 Bacteria 2053
289 Ga0436365_1313801 3300039437 Bacteria 9321
290 Ga0436365_1335305 3300039437 Bacteria 15686
291 Ga0436365_1516383 3300039437 Bacteria 4228
292 Ga0436365_1525496 3300039437 Bacteria 2516
293 Ga0436365_1818229 3300039437 Bacteria 32919
294 Ga0436365_1857775 3300039437 Bacteria 3043
295 Ga0436363_0136996 3300039450 Bacteria 2512
296 Ga0436363_0308674 3300039450 Bacteria 5105
297 Ga0436363_0424523 3300039450 Bacteria 1814
298 Ga0436363_0723455 3300039450 Bacteria 1568
299 Ga0436363_0784361 3300039450 Bacteria 1754
300 Ga0436363_1035518 3300039450 Bacteria 1303
301 Ga0436363_1612774 3300039450 Bacteria 12809
302 Ga0436362_0057084 3300039453 Bacteria 2207
303 Ga0436362_0234662 3300039453 Bacteria 1363
304 Ga0436362_0238646 3300039453 Bacteria 5471
305 Ga0436362_0312928 3300039453 Bacteria 2619
306 Ga0439464_0013249 3300042439 Bacteria 2205
307 Ga0466969_0028349 3300044656 Bacteria 2862
308 Ga0466966_0138122 3300044684 Bacteria 1490
309 Ga0466961_0021833 3300044693 Bacteria 4118
310 Ga0466963_0000913 3300044694 Bacteria 15031
311 Ga0466963_0060904 3300044694 Bacteria 2521
312 Ga0466963_0155272 3300044694 Bacteria 1590
313 Ga0466963_0185606 3300044694 Bacteria 1452
314 Ga0466963_0210049 3300044694 Bacteria 1362
315 Ga0466964_0022201 3300044706 Bacteria 2460
316 Ga0466964_0028625 3300044706 Bacteria 2196
317 Ga0466971_0048244 3300044719 Bacteria 1914
318 Ga0466968_0051152 3300044735 Bacteria 1765
319 Ga0466968_0080466 3300044735 Bacteria 1431
320 Ga0466970_0018283 3300044765 Bacteria 3627
321 Ga0466957_0018837 3300044842 Bacteria 4058
322 Ga0466957_0032116 3300044842 Bacteria 3142
323 Ga0466960_0087515 3300044901 Bacteria 1582
324 Ga0466960_0100044 3300044901 Bacteria 1492
325 Ga0466959_0015285 3300045049 Bacteria 5589
326 Ga0466959_0022795 3300045049 Bacteria 4629
327 Ga0466959_0041192 3300045049 Bacteria 3410
328 Ga0466959_0088379 3300045049 Bacteria 2228
329 Ga0466959_0088850 3300045049 Bacteria 2221
330 Ga0466959_0127991 3300045049 Bacteria 1801
331 Ga0466958_0001632 3300045836 Bacteria 10792
332 Ga0466958_0003325 3300045836 Bacteria 8330
333 Ga0466958_0025353 3300045836 Bacteria 3496
334 Ga0466958_0032190 3300045836 Bacteria 3119
335 Ga0466958_0033771 3300045836 Bacteria 3049
336 Ga0466958_0048098 3300045836 Bacteria 2576
337 Ga0466958_0162563 3300045836 Bacteria 1411
338 Ga0466967_0001485 3300045976 Bacteria 13680
339 Ga0466967_0018696 3300045976 Bacteria 5547
340 Ga0466967_0019429 3300045976 Bacteria 5462
341 Ga0466967_0023901 3300045976 Bacteria 5016
342 Ga0466967_0037180 3300045976 Bacteria 4164
343 Ga0466967_0053885 3300045976 Bacteria 3537
344 Ga0466967_0096197 3300045976 Bacteria 2701
345 Ga0466967_0123661 3300045976 Bacteria 2394
346 Ga0466967_0198075 3300045976 Bacteria 1901
347 Ga0495592_0131472 3300046454 Bacteria 1750
348 Ga0495641_0120227 3300046461 Bacteria 1172
349 Ga0495653_0123979 3300046463 Bacteria 1837
350 Ga0495582_0090833 3300046473 Bacteria 1703
351 Ga0495584_0071563 3300046491 Bacteria 1743
352 Ga0495596_0041752 3300046500 Bacteria 1808
353 Ga0495596_0065161 3300046500 Bacteria 1417
354 Ga0495608_0005958 3300046511 Bacteria 8668
355 Ga0495663_0040963 3300046525 Bacteria 1408
356 Ga0495652_0084445 3300046529 Bacteria 2611
357 Ga0495640_0031906 3300046533 Bacteria 3757
358 Ga0495656_0054330 3300046615 Bacteria 1723
359 Ga0495656_0076472 3300046615 Bacteria 1500
360 Ga0495668_0059889 3300046616 Bacteria 2101
361 Ga0495635_0003233 3300046663 Bacteria 11232
362 Ga0495646_0178881 3300046680 Bacteria 1165
363 Ga0495604_0015786 3300047317 Bacteria 6027
364 Ga0495674_0075393 3300047319 Bacteria 2903
365 Ga0495680_0042223 3300047322 Bacteria 3620
366 Ga0495684_0121428 3300047471 Bacteria 1967
367 Ga0495602_0060391 3300048088 Bacteria 3303
368 Ga0496100_0037861 3300048903 Bacteria 3053
369 Ga0496101_0048865 3300048904 Bacteria 3041
370 Ga0496102_0077085 3300048905 Bacteria 3067
371 Ga0496103_0059980 3300048906 Bacteria 2364
372 Ga0496104_0035334 3300048907 Bacteria 4666
373 Ga0496104_0060905 3300048907 Bacteria 3576
374 Ga0496104_0149078 3300048907 Bacteria 2246
375 Ga0496104_0237420 3300048907 Bacteria 1735
376 Ga0496104_0276535 3300048907 Bacteria 1592
377 Ga0496105_0032540 3300048908 Bacteria 4280
378 Ga0496105_0035934 3300048908 Bacteria 4080
379 Ga0496106_0035774 3300048909 Bacteria 3713
380 Ga0496107_0038396 3300048910 Bacteria 3435
381 Ga0496108_0013375 3300048911 Bacteria 6692
382 Ga0496108_0048451 3300048911 Bacteria 3553
383 Ga0496108_0077970 3300048911 Bacteria 2804
384 Ga0496108_0132775 3300048911 Bacteria 2140
385 Ga0496108_0273807 3300048911 Bacteria 1469
386 Ga0496109_0010802 3300048912 Bacteria 7817
387 Ga0496109_0034911 3300048912 Bacteria 4533
388 Ga0496109_0200808 3300048912 Bacteria 1874
389 Ga0496110_0023631 3300048913 Bacteria 5230
390 Ga0496110_0135672 3300048913 Bacteria 2224
391 Ga0496110_0152657 3300048913 Bacteria 2091
392 Ga0496111_0037377 3300048914 Bacteria 3474
393 Ga0496111_0040631 3300048914 Bacteria 3336
394 Ga0496111_0063355 3300048914 Bacteria 2681
395 Ga0496111_0156669 3300048914 Bacteria 1690
396 Ga0496112_0007246 3300048915 Bacteria 9829
397 Ga0496112_0008999 3300048915 Bacteria 8964
398 Ga0496112_0016032 3300048915 Bacteria 7006
399 Ga0496112_0099594 3300048915 Bacteria 2876
400 Ga0496112_0166324 3300048915 Bacteria 2171
401 Ga0496112_0174005 3300048915 Bacteria 2118
402 Ga0496112_0331936 3300048915 Bacteria 1464
403 Ga0496112_0442050 3300048915 Bacteria 1238
404 Ga0496112_0469027 3300048915 Bacteria 1196
405 Ga0496113_0014426 3300048916 Bacteria 5390
406 Ga0496113_0028941 3300048916 Bacteria 3992
407 Ga0496113_0085968 3300048916 Bacteria 2416
408 Ga0496113_0134902 3300048916 Bacteria 1939
409 Ga0496114_0041844 3300048917 Bacteria 3797
410 Ga0496114_0143630 3300048917 Bacteria 2068
411 Ga0496114_0403553 3300048917 Bacteria 1210
412 Ga0496121_0009854 3300048924 Bacteria 10903
413 Ga0496121_0022346 3300048924 Bacteria 6144
414 Ga0501031_0036523 3300049568 Bacteria 3205
415 Ga0501032_0151760 3300049569 Bacteria 1523
416 Ga0501034_0016871 3300049571 Bacteria 7488
417 Ga0501036_0081944 3300049572 Bacteria 2727
418 Ga0501039_0121357 3300049575 Bacteria 2048
419 Ga0501042_0079662 3300049578 Bacteria 2347
420 Ga0501048_0054793 3300049582 Bacteria 2833
421 Ga0501048_0076532 3300049582 Bacteria 2361
422 Ga0501071_0053963 3300049587 Bacteria 2900
423 Ga0501071_0118857 3300049587 Bacteria 1958
424 Ga0501071_0227690 3300049587 Bacteria 1404
425 Ga0501072_0023957 3300049588 Bacteria 4745
426 Ga0501072_0059391 3300049588 Bacteria 3015
427 Ga0501074_0091053 3300049590 Bacteria 2184
428 Ga0501075_0041520 3300049591 Bacteria 3447
429 Ga0501075_0113080 3300049591 Bacteria 2064
430 Ga0501076_0095418 3300049592 Bacteria 2395
431 Ga0501076_0131516 3300049592 Bacteria 2030
432 Ga0501079_0078748 3300049741 Bacteria 2549
433 Ga0501045_0025984 3300049824 Bacteria 4210
434 Ga0501045_0047778 3300049824 Bacteria 3118
435 nmdc:mga05p37_176792_c1 3300050507 Bacteria 2600
436 nmdc:mga05p37_235592_c1 3300050507 Bacteria 2203
437 nmdc:mga05p37_291037_c1 3300050507 Bacteria 1944
438 nmdc:mga05p37_291308_c1 3300050507 Bacteria 1943
439 nmdc:mga05p37_47263_c1 3300050507 Bacteria 5293
440 nmdc:mga05p37_6088_c1 3300050507 Bacteria 14205
441 nmdc:mga05p37_81759_c1 3300050507 Bacteria 3979
442 nmdc:mga05p37_84583_c1 3300050507 Bacteria 3908
443 nmdc:mga05p37_9019_c1 3300050507 Bacteria 11796
444 nmdc:mga09592_78372_c1 3300050508 Bacteria 2812
445 nmdc:mga0qj67_110973_c1 3300050509 Bacteria 2214
446 nmdc:mga0qj67_13208_c1 3300050509 Bacteria 6233
447 nmdc:mga0qj67_34937_c1 3300050509 Bacteria 3929
448 nmdc:mga06r32_195795_c1 3300050510 Bacteria 2008
449 nmdc:mga06r32_32781_c1 3300050510 Bacteria 4891
450 nmdc:mga08y16_66841_c1 3300050511 Bacteria 3751
451 nmdc:mga08y16_7698_c1 3300050511 Bacteria 11276
452 nmdc:mga08y16_84103_c1 3300050511 Bacteria 3317
453 nmdc:mga0n895_1297_c1 3300050512 Bacteria 18491
454 nmdc:mga0rr50_27858_c1 3300050513 Bacteria 3963
455 nmdc:mga0a205_20122_c1 3300050515 Bacteria 6297
456 nmdc:mga0a205_21423_c1 3300050515 Bacteria 6115
457 Ga0495655_0019533 3300053083 Bacteria 1506
458 Ga0500556_0001465 3300053104 Bacteria 9917
459 Ga0500616_0007342 3300053153 Bacteria 7024
460 Ga0500616_0011489 3300053153 Bacteria 5221
461 Ga0500616_0073519 3300053153 Bacteria 1735
462 Ga0500599_004983 3300053736 Bacteria 1659
463 Ga0501084_0019292 3300054114 Bacteria 5680
464 Ga0466962_0014874 3300061719 Bacteria 3750
465 Ga0466962_0019587 3300061719 Bacteria 3253
466 Ga0530510_0020373 3300061734 Bacteria 4715
467 Ga0530510_0040733 3300061734 Bacteria 3353
468 Ga0530510_0065789 3300061734 Bacteria 2627
469 nmdc:mga09592_4563_c1
470 JGI25407J50210_10000068
471 JGI25407J50210_10000664
472 JGI25407J50210_10006566
473 Ga0070658_10026398
474 Ga0070658_10157133
475 Ga0070683_100005341
476 Ga0070683_100007308
477 Ga0070683_100010413
478 Ga0070680_100014377
479 Ga0070682_100016974
480 Ga0070682_100055098
481 Ga0070660_100010095
482 Ga0070661_100025146
483 Ga0070661_100117825
484 Ga0070668_100001500
485 Ga0070675_100043807
486 Ga0070675_100148902
487 Ga0070671_100236982
488 Ga0070674_100016281
489 Ga0070674_100030202
490 Ga0070688_100108322
491 Ga0070659_100006276
492 Ga0070659_100009615
493 Ga0070659_100160193
494 Ga0070709_10053572
495 Ga0070714_100000038
496 Ga0070714_100002632
497 Ga0070714_100101512
498 Ga0070714_100131097
499 Ga0070714_100213892
500 Ga0070713_100112820
501 Ga0070710_10000001
502 Ga0070710_10012449
503 Ga0070710_10131056
504 Ga0070711_100024100
505 Ga0070711_100065180
506 Ga0070711_100147305
507 Ga0070700_100017751
508 Ga0070662_100071598
509 Ga0070681_10031424
510 Ga0068867_100057286
511 Ga0070685_10011694
512 Ga0070679_100002504
513 Ga0070684_100022610
514 Ga0070684_100028892
515 Ga0070684_100061478
516 Ga0070672_100119288
517 Ga0070693_100137331
518 Ga0070665_100003731
519 Ga0070664_100218485
520 Ga0068857_100018351
521 Ga0068854_100086166
522 Ga0068856_100008470
523 Ga0068856_100013508
524 Ga0068852_100057085
525 Ga0068852_100308074
526 Ga0068859_100187596
527 Ga0068864_100039174
528 Ga0068866_10013902
529 Ga0068861_100005046
530 Ga0068861_100031308
531 Ga0068863_100169478
532 Ga0068862_100072374
533 Ga0081455_10055356
534 Ga0081538_10000550
535 Ga0081538_10000650
536 Ga0081538_10000897
537 Ga0081538_10001437
538 Ga0081538_10002641
539 Ga0081538_10003421
540 Ga0081538_10003460
541 Ga0081538_10003534
542 Ga0081538_10005294
543 Ga0081538_10010718
544 Ga0081538_10014284
545 Ga0081538_10015943
546 Ga0081538_10031938
547 Ga0081538_10082501
548 Ga0081540_1012878
549 Ga0081539_10003175
550 Ga0070717_10036497
551 Ga0070717_10063012
552 Ga0070717_10149675
553 Ga0075365_10201041
554 Ga0075432_10062619
555 Ga0070712_100024793
556 Ga0075428_100052481
557 Ga0075430_100008624
558 Ga0075430_100030566
559 Ga0075430_100088409
560 Ga0075431_100002773
561 Ga0075431_100013327
562 Ga0075431_100097904
563 Ga0075431_100133923
564 Ga0075431_100153874
565 Ga0075434_100039724
566 Ga0075434_100082757
567 Ga0075429_100009743
568 Ga0075429_100080649
569 Ga0097620_100187614
570 Ga0075435_100027784
571 Ga0075435_100068457
572 Ga0105240_10113455
573 Ga0105240_10184586
574 Ga0111539_10030723
575 Ga0111539_10032548
576 Ga0111539_10048843
577 Ga0111539_10356657
578 Ga0105245_10001196
579 Ga0105245_10014924
580 Ga0105245_10039367
581 Ga0105245_10149749
582 Ga0105247_10100346
583 Ga0114129_10002380
584 Ga0114129_10011624
585 Ga0114129_10018334
586 Ga0114129_10070781
587 Ga0114129_10102800
588 Ga0114129_10288590
589 Ga0105243_10013515
590 Ga0105243_10039614
591 Ga0105248_10201613
592 Ga0105237_10128083
593 Ga0105237_10207468
594 Ga0105238_10007174
595 Ga0105249_10004099
596 Ga0105249_10077622
597 Ga0105249_10095073
598 Ga0105249_10269518
599 Ga0105246_10032800
600 Ga0105246_10072055
601 Ga0157369_10287740
602 Ga0157374_10009955
603 Ga0157378_10238669
604 Ga0163162_10034125
605 Ga0157372_10047266
606 Ga0157372_10097945
607 Ga0157375_10092195
608 Ga0163163_10063073
609 Ga0157377_10001920
610 Ga0163161_10214335
611 Ga0206353_11621476
612 Ga0213874_10000318
613 Ga0213876_10044310
614 Ga0213876_10069796
615 Ga0213876_10131822
616 Ga0213875_10015898
617 Ga0213875_10036884
618 Ga0207692_10000004
619 Ga0207692_10018484
620 Ga0207692_10085159
621 Ga0207692_10199560
622 Ga0207688_10013483
623 Ga0207688_10017041
624 Ga0207688_10032921
625 Ga0207688_10085938
626 Ga0207643_10120773
627 Ga0207707_10120056
628 Ga0207707_10195118
629 Ga0207695_10105335
630 Ga0207695_10154770
631 Ga0207671_10112814
632 Ga0207693_10019479
633 Ga0207693_10034146
634 Ga0207693_10093141
635 Ga0207663_10044528
636 Ga0207660_10047950
637 Ga0207657_10009557
638 Ga0207657_10052776
639 Ga0207652_10019099
640 Ga0207652_10078250
641 Ga0207681_10063448
642 Ga0207694_10295296
643 Ga0207687_10021137
644 Ga0207687_10026559
645 Ga0207687_10053562
646 Ga0207687_10067768
647 Ga0207700_10037955
648 Ga0207664_10000040
649 Ga0207664_10003205
650 Ga0207664_10018804
651 Ga0207664_10031602
652 Ga0207664_10032459
653 Ga0207664_10443614
654 Ga0207644_10056527
655 Ga0207690_10000166
656 Ga0207690_10067453
657 Ga0207690_10105561
658 Ga0207704_10109176
659 Ga0207665_10084609
660 Ga0207665_10179404
661 Ga0207691_10076401
662 Ga0207691_10090840
663 Ga0207691_10154468
664 Ga0207711_10239780
665 Ga0207689_10020581
666 Ga0207661_10002146
667 Ga0207661_10005300
668 Ga0207661_10006163
669 Ga0207661_10228990
670 Ga0207679_10048245
671 Ga0207679_10129926
672 Ga0207712_10020393
673 Ga0207668_10025629
674 Ga0207668_10054114
675 Ga0207668_10111936
676 Ga0207658_10109756
677 Ga0207658_10179592
678 Ga0207678_10103594
679 Ga0207678_10165819
680 Ga0207678_10254772
681 Ga0207708_10000234
682 Ga0207708_10003129
683 Ga0207708_10023069
684 Ga0207708_10104328
685 Ga0207708_10343184
686 Ga0207702_10031128
687 Ga0207641_10239570
688 Ga0207648_10280404
689 Ga0207676_10047728
690 Ga0207676_10079797
691 Ga0207674_10018826
692 Ga0207674_10134715
693 Ga0207674_10265477
694 Ga0207675_100006144
695 Ga0207675_100245347
696 Ga0207683_10149064
697 Ga0207698_10080656
698 Ga0207428_10091881
699 Ga0268266_10042885
700 Ga0268265_10374262
701 Ga0268264_10060932
702 Ga0265326_10000008
703 Ga0265334_10000099
704 Ga0265336_10001790
705 Ga0265338_10006649
706 Ga0265338_10109964
707 Ga0265324_10001720
708 Ga0307408_100081656
709 Ga0307408_100103973
710 Ga0307413_10045259
711 Ga0307413_10093916
712 Ga0307413_10099387
713 Ga0307413_10223453
714 Ga0307410_10070144
715 Ga0307410_10207781
716 Ga0307406_10012068
717 Ga0307406_10214836
718 Ga0307407_10037107
719 Ga0307412_10056447
720 Ga0307412_10094187
721 Ga0307409_100074684
722 Ga0307409_100092619
723 Ga0307416_100126340
724 Ga0307416_100150660
725 Ga0307416_100230251
726 Ga0307411_10026355
727 Ga0307411_10037485
728 Ga0307415_100001209
729 Ga0307415_100023133
730 Ga0307415_100023788
731 Ga0373931_0122761
732 Ga0373933_0059228
733 Ga0373937_0030606
734 Ga0395899_0012959
735 Ga0395899_0213454
736 Ga0395900_0014319
737 Ga0395898_0009759
738 Ga0395898_0062633
739 Ga0395898_0129030
740 Ga0395898_0207153
741 Ga0395898_0381027
742 Ga0395898_0462611
743 Ga0395905_0013964
744 Ga0436364_0314883
745 Ga0436364_0383541
746 Ga0436364_0513584
747 Ga0436364_0713043
748 Ga0436364_0971417
749 Ga0436364_1337251
750 Ga0436364_1406657
751 Ga0395901_0010606
752 Ga0395901_0055093
753 Ga0395901_0092631
754 Ga0436365_0829003
755 Ga0436365_1126921
756 Ga0436365_1187404
757 Ga0436365_1313801
758 Ga0436365_1335305
759 Ga0436365_1516383
760 Ga0436365_1525496
761 Ga0436365_1818229
762 Ga0436365_1857775
763 Ga0436363_0136996
764 Ga0436363_0308674
765 Ga0436363_0424523
766 Ga0436363_0723455
767 Ga0436363_0784361
768 Ga0436363_1035518
769 Ga0436363_1612774
770 Ga0436362_0057084
771 Ga0436362_0234662
772 Ga0436362_0238646
773 Ga0436362_0312928
774 Ga0439464_0013249
775 Ga0466969_0028349
776 Ga0466966_0138122
777 Ga0466961_0021833
778 Ga0466963_0000913
779 Ga0466963_0060904
780 Ga0466963_0155272
781 Ga0466963_0185606
782 Ga0466963_0210049
783 Ga0466964_0022201
784 Ga0466964_0028625
785 Ga0466971_0048244
786 Ga0466968_0051152
787 Ga0466968_0080466
788 Ga0466970_0018283
789 Ga0466957_0018837
790 Ga0466957_0032116
791 Ga0466960_0087515
792 Ga0466960_0100044
793 Ga0466959_0015285
794 Ga0466959_0022795
795 Ga0466959_0041192
796 Ga0466959_0088379
797 Ga0466959_0088850
798 Ga0466959_0127991
799 Ga0466958_0001632
800 Ga0466958_0003325
801 Ga0466958_0025353
802 Ga0466958_0032190
803 Ga0466958_0033771
804 Ga0466958_0048098
805 Ga0466958_0162563
806 Ga0466967_0001485
807 Ga0466967_0018696
808 Ga0466967_0019429
809 Ga0466967_0023901
810 Ga0466967_0037180
811 Ga0466967_0053885
812 Ga0466967_0096197
813 Ga0466967_0123661
814 Ga0466967_0198075
815 Ga0495592_0131472
816 Ga0495641_0120227
817 Ga0495653_0123979
818 Ga0495582_0090833
819 Ga0495584_0071563
820 Ga0495596_0041752
821 Ga0495596_0065161
822 Ga0495608_0005958
823 Ga0495663_0040963
824 Ga0495652_0084445
825 Ga0495640_0031906
826 Ga0495656_0054330
827 Ga0495656_0076472
828 Ga0495668_0059889
829 Ga0495635_0003233
830 Ga0495646_0178881
831 Ga0495604_0015786
832 Ga0495674_0075393
833 Ga0495680_0042223
834 Ga0495684_0121428
835 Ga0495602_0060391
836 Ga0496100_0037861
837 Ga0496101_0048865
838 Ga0496102_0077085
839 Ga0496103_0059980
840 Ga0496104_0035334
841 Ga0496104_0060905
842 Ga0496104_0149078
843 Ga0496104_0237420
844 Ga0496104_0276535
845 Ga0496105_0032540
846 Ga0496105_0035934
847 Ga0496106_0035774
848 Ga0496107_0038396
849 Ga0496108_0013375
850 Ga0496108_0048451
851 Ga0496108_0077970
852 Ga0496108_0132775
853 Ga0496108_0273807
854 Ga0496109_0010802
855 Ga0496109_0034911
856 Ga0496109_0200808
857 Ga0496110_0023631
858 Ga0496110_0135672
859 Ga0496110_0152657
860 Ga0496111_0037377
861 Ga0496111_0040631
862 Ga0496111_0063355
863 Ga0496111_0156669
864 Ga0496112_0007246
865 Ga0496112_0008999
866 Ga0496112_0016032
867 Ga0496112_0099594
868 Ga0496112_0166324
869 Ga0496112_0174005
870 Ga0496112_0331936
871 Ga0496112_0442050
872 Ga0496112_0469027
873 Ga0496113_0014426
874 Ga0496113_0028941
875 Ga0496113_0085968
876 Ga0496113_0134902
877 Ga0496114_0041844
878 Ga0496114_0143630
879 Ga0496114_0403553
880 Ga0496121_0009854
881 Ga0496121_0022346
882 Ga0501031_0036523
883 Ga0501032_0151760
884 Ga0501034_0016871
885 Ga0501036_0081944
886 Ga0501039_0121357
887 Ga0501042_0079662
888 Ga0501048_0054793
889 Ga0501048_0076532
890 Ga0501071_0053963
891 Ga0501071_0118857
892 Ga0501071_0227690
893 Ga0501072_0023957
894 Ga0501072_0059391
895 Ga0501074_0091053
896 Ga0501075_0041520
897 Ga0501075_0113080
898 Ga0501076_0095418
899 Ga0501076_0131516
900 Ga0501079_0078748
901 Ga0501045_0025984
902 Ga0501045_0047778
903 nmdc:mga05p37_176792_c1
904 nmdc:mga05p37_235592_c1
905 nmdc:mga05p37_291037_c1
906 nmdc:mga05p37_291308_c1
907 nmdc:mga05p37_47263_c1
908 nmdc:mga05p37_6088_c1
909 nmdc:mga05p37_81759_c1
910 nmdc:mga05p37_84583_c1
911 nmdc:mga05p37_9019_c1
912 nmdc:mga09592_78372_c1
913 nmdc:mga0qj67_110973_c1
914 nmdc:mga0qj67_13208_c1
915 nmdc:mga0qj67_34937_c1
916 nmdc:mga06r32_195795_c1
917 nmdc:mga06r32_32781_c1
918 nmdc:mga08y16_66841_c1
919 nmdc:mga08y16_7698_c1
920 nmdc:mga08y16_84103_c1
921 nmdc:mga0n895_1297_c1
922 nmdc:mga0rr50_27858_c1
923 nmdc:mga0a205_20122_c1
924 nmdc:mga0a205_21423_c1
925 Ga0495655_0019533
926 Ga0500556_0001465
927 Ga0500616_0007342
928 Ga0500616_0011489
929 Ga0500616_0073519
930 Ga0500599_004983
931 Ga0501084_0019292
932 Ga0466962_0014874
933 Ga0466962_0019587
934 Ga0530510_0020373
935 Ga0530510_0040733
936 Ga0530510_0065789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04107

GCS2

Glutamate-cysteine ligase family 2(GCS2)

12

288

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r8g-assembly1.cif.gz_B structure and function of ybdk 0.9388 2 349
1tt4-assembly1.cif.gz_B structure of np459575, a predicted glutathione synthase from salmonella typhimurium 0.9259 2 349
1r8g-assembly1.cif.gz_A structure and function of ybdk 0.9235 2 349
1r8g-assembly1.cif.gz_B structure and function of ybdk 0.8808 2 349
1tt4-assembly1.cif.gz_B structure of np459575, a predicted glutathione synthase from salmonella typhimurium 0.8755 2 349
ID Description Score Start End Superfamily
af_P9WPK9_8_375_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9613 2 349 3.30.590.20
af_P9WPK9_8_375_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9223 2 349 3.30.590.20
1r8gA00 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9202 1 349 3.30.590.20
1r8gA00 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.8687 1 349 3.30.590.20
af_I6YCS6_35_480_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.8048 2 338 3.30.590.20
ID Description Score Start End GO Terms
AF-A0A7W0A8W0-F1-model_v4 deleted 0.9872 118 352
AF-A0A7W0A8W0-F1-model_v4 deleted 0.9831 118 352
AF-A0A7W0RH08-F1-model_v4 YbdK family carboxylate-amine ligase 0.9824 1 258 GO:0004357
GO:0042398
AF-A0A7V9ARW3-F1-model_v4 YbdK family carboxylate-amine ligase 0.9818 1 300 GO:0004357
GO:0042398
AF-A0A838I5C2-F1-model_v4 YbdK family carboxylate-amine ligase 0.9806 1 253 GO:0004357
GO:0042398

Map